NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16983.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16983.1 Public Mus musculus 2 Tti1 21 106 86 CCDS HistoryNCBI Gene:75425Re-query CCDS DB by CCDS ID:16983.1Re-query CCDS DB by GeneID:75425See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16983.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000029179 ENSMUSP00000029179 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000029179Link to Ensembl Protein Viewer:ENSMUSP00000029179Re-query CCDS DB by Nucleotide ID:ENSMUST00000029179Re-query CCDS DB by Protein ID:ENSMUSP00000029179
Original member Current member EBI,WTSI ENSMUST00000109522 ENSMUSP00000105148 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000109522Link to Ensembl Protein Viewer:ENSMUSP00000105148Re-query CCDS DB by Nucleotide ID:ENSMUST00000109522Re-query CCDS DB by Protein ID:ENSMUSP00000105148
Original member Current member EBI,WTSI OTTMUST00000037776 OTTMUSP00000016947 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000037776Link to Vega Protein Viewer:OTTMUSP00000016947Re-query CCDS DB by Nucleotide ID:OTTMUST00000037776Re-query CCDS DB by Protein ID:OTTMUSP00000016947
Original member NCBI NM_029282.1 NP_083558.1 Updated not alive Link to Nucleotide Sequence:NM_029282.1Link to Protein Sequence:NP_083558.1Re-query CCDS DB by Nucleotide ID:NM_029282Re-query CCDS DB by Protein ID:NP_083558
Current member NCBI NM_029282.2 NP_083558.1 Accepted alive Link to Nucleotide Sequence:NM_029282.2Link to Protein Sequence:NP_083558.1Re-query CCDS DB by Nucleotide ID:NM_029282Re-query CCDS DB by Protein ID:NP_083558Link to BLAST:NP_083558.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_083558.1 1085 Q91V83 1085 100% 0 0

Chromosomal Locations for CCDS 16983.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 157982274 157982460 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157992968 157993055 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157993354 157993558 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157995381 157995521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157997077 157997225 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 158000620 158000808 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 158007019 158009317 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3258 nt):
ATGGCGGTGTTTGACACTCCTGAGGAGGCTTTTGGCGTCTTACGTCCGGTCTGTGTTCAGCTCACAAAGA
CC
CAGACAGTGGAGAATGTGGAGCATCTGCAGACACAGTTACAAGCCATAAGTGACACTGCTCTTCAGGA
A
CTACAGCAGTACATCCTCTTCCCTTTGCGATTTGCCCTGAAGACCCCAGGGCCCAAAAGAGAGCGCCTG
GTG
CAGAGTGTGGTGGAATGTCTCACCTTTGTCCTCTCTTCCACATGTGTGAGAGAGCAGGAGCTTCTGC
AG
GAACTCTTCTCGGAGCTTTCTGCCTGTCTGTACTCTCCCAGCTCCCAGAAACCCGCAGCTTTGTCAGA
G
GAGTTGAAATTGGCTGTCATCCAGGGACTTAGCACCTTAATGCACTCAGCTTACAGGGACATCATTCTG
ACT
TTTTATGAGCCCTCCATTCTGCCTCGTTTAGGATTTGCTGTGTCTTTACTGTTAGGATTGGCAGAGC
AG
GAGAAGTCAAAACAGATTAAAATTGCTGCCTTACAGTGTCTGCAGGTTCTCCTCCTTCAGTGTGATTG
T
CAGGACCATCCAAGGCCCTTGGATGAACTGGAGCAGCAGCAGCTGGGGGATTTGTTGGCATCTTTCTTA
CCT
GGGATCTCAACTGCGCTGACCAGAATCATCACAGGAGACTTTAAACAAGGTCACAGCATTGTCGTGT
CT
TCTCTAAAGGTCTTTTACAAGACAGTGGGCTTCATCATGGCTGATGAACAGCTCACAAGGATTCCAAA
G
GCCCAAGCAAAACCTGTAGTTGAGCACAGAGTAGCAGCCCTGATGATTCACAGAGAAGCAGACTGGGTA
AAA
AGTACTGGTGACAAGCTGGCCATCTTTATTAAAAAGATAATTGACTGTGTCTCCGTTCACCCACACT
GG
AAGGTGAGGCTGGAACTGGTAGAGTTTGTGGAAATCCTGCTTTTGAAGTGCACTCAGTCCCTGGTTGA
A
TCCACGGGACCCCTCTTGAAGGTGTTAGTTGGCCTAGTGAATGATGAAAGTCCGGAAGTCCAGGCCCGG
TGC
AGTACAGTGCTGAGGCGTCTTGCAGATCAGAAAGTAGTAGTGGGCAGCAGAGCCTTGGCTGACATCT
TG
TCAGAAAGCCTGCATTCACTGGCCACGTCTCTTCCCCGCCTGATGAACACACAGGATGATCAGGGCAA
A
TTCTCTACCCTTTCCCTGTTACTTGGGTATCTGAAACTGTTGGGCCCCAAAGTGCATGTGATTCTCAAT
TCT
GTGGCCCATGTGCAACGCCTTTCCAGGGCCCTCATCCAAGTACTGGAGCTAGAGGTGACTGATGTCA
AG
ATGGTGGAAGAGCGGCGCTGGAACTCTGATAACCTGAGTGCTTCTGCAGAGGTCTCAGCTGCACGGCC
A
TGGAGCAGAGTCCAGAGGCGATACTTCCGATGCTTCACTGACGAGAGGGTCTTCCTGCTCCTTCGGAAG
ATC
TGTCAGCTCCTGGGTTATTATGGGGACCTGTATTTGCTTGTGGATCACTTTATGGAACTGTACCATA
CA
TCTGTAGTTTATCGGAAGCAAGCTGCCATGATCCTTAATGAACTGGTTGTAGGGGCTGCTGGACTGGA
T
GTAGAAGATATTCATAACAAATGTCCAAGCATGGGCCCAGAGGAGTTGAGAGAGATTGTGAAATCTATA
CTA
GAGGAATACACAAGCCAAGAAAACTGGTACTTGATTACCTGTTTTGAAGCTGAGGAGGGGGAGGAGG
TG
ATGATGAAGCAGCAAGGCTTCCAGGCTGTCACATCTGGTGTCCACACCTGCCAAGTTGTATCTTTTCC
A
GCCCTGTCAAAGCCGAGTCCCACTATCTGCTCCATGAACAGTAACATCTGGCAGATATGCATTCAGTTG
GAA
GGGATTGGCCAGTTTGCATATGCATTAGGAAAAGACTTTCGTTTGCTTTTGATGTCAGCTCTCTATC
CA
ATACTGGAGAAGGCGGGAGATCCAACCTTGCTTATTAGTCAAGTGGCTACTAGCACCATGGTAGATAT
T
TGCCACGCTTGTGGCTACAACTCTGTACAACACCTGATCAATCAAAATTCAGACTATTTGGTGAATGGA
ATC
TCTTTAAATCTGCGTCACCTCGCTCTGCACCCTCATGCCCCAAAAGTCCTAGAAGCCATGCTTCGGA
AC
GCGGATGCCAGCCTACTTCCTTTGGTAGCAGATGTGGTTCAGGACGTCCTGGCCACCCTGGACCAATT
T
TATGATAAGAGAGCTGCTTCCTTTGTCAGCGTTCTGCATGCTCTGCTGGCAGCATTAGCACACTGGTTC
CCA
GACTCGGGTTCTACTGGGCAACTCCAACAGCGTAGTTTAGAAGAGGAGGGGAGGCAACTGCCAGCAG
CT
GGCGAGGCTAGCACCACAGCCGAGGACATCGAGCAGTTTGTACTGAGCTACCTCCAAGAGAAGGATGT
G
GCAGAGGGAAATGTTTCTGACCTTGAAGCTGAAGAAGAGGTGCAGTCAGCCCCTCCCAAAGTGGATGAG
AAT
GACACCCTTCCAGATGTGGAACCACCACTGCCAACGCACATCCAGATAGCCAAGGACGTGATGGAGC
GC
TGCATCCACTTGTCAGCAGATAAAAATCTGAAAATCCGCCTGAAGGTCTTGGATGTGCTGGGTTTGTG
T
GTGGAGGTTCTACAGACCCACAAGAACCAGCTCCTTCCCCTAGCTCATCGGGCCTGGCCTTCACTCGTA
CAC
CGACTTACAAGTGATGACCCCCTGGCAGTGCTCAGAGCCTTCAAGGTTTTACAGACACTTGGAAGCA
GA
TGTGGCGATTTTCTCCGGAGTCGGTTCTGTAAAGATGTCCTGCCAAAACTGACCAGCTCCTTAATCAC
C
CAGGCCCCCATCAGTGCCAGGGCTGGACCAGTTTATTCTCATACACTGGCCTTCAAGCTACAGCTGGCT
GTC
TTGCAGGGCCTGGGCCCCCTCTGTGAAAATCTGGACTTGGGTGAGGGTGACCTGAATAAAGTGGCTG
AT
GCCTGCGTGATTTACCTCAGTACCAAACAGCCCGTGAAATTACAAGAGGCTGCCAGGAGCGTCTTCCT
C
CACCTGATGAGAGTAGACCCTGACTCCACCTGGCTCCTCCTGCATGAGCTGTACTGCCCTGTGCAGCAA
TTC
ACAGCCCCGCATCCCAGCCTTCACCCAGTGCAGCTGCAGGGGGCCACTCAGCCACAGAACCCCTATG
CC
ACCAATGTGTGCCACCTGCTTCTTCAACTGCAGTGA


Translation (1085 aa):
MAVFDTPEEAFGVLRPVCVQLTKTQTVENVEHLQTQLQAISDTALQELQQYILFPLRFALKTPGPKRERL
V
QSVVECLTFVLSSTCVREQELLQELFSELSACLYSPSSQKPAALSEELKLAVIQGLSTLMHSAYRDIIL
T
FYEPSILPRLGFAVSLLLGLAEQEKSKQIKIAALQCLQVLLLQCDCQDHPRPLDELEQQQLGDLLASFL
P
GISTALTRIITGDFKQGHSIVVSSLKVFYKTVGFIMADEQLTRIPKAQAKPVVEHRVAALMIHREADWV
K
STGDKLAIFIKKIIDCVSVHPHWKVRLELVEFVEILLLKCTQSLVESTGPLLKVLVGLVNDESPEVQAR
C
STVLRRLADQKVVVGSRALADILSESLHSLATSLPRLMNTQDDQGKFSTLSLLLGYLKLLGPKVHVILN
S
VAHVQRLSRALIQVLELEVTDVKMVEERRWNSDNLSASAEVSAARPWSRVQRRYFRCFTDERVFLLLRK
I
CQLLGYYGDLYLLVDHFMELYHTSVVYRKQAAMILNELVVGAAGLDVEDIHNKCPSMGPEELREIVKSI
L
EEYTSQENWYLITCFEAEEGEEVMMKQQGFQAVTSGVHTCQVVSFPALSKPSPTICSMNSNIWQICIQL
E
GIGQFAYALGKDFRLLLMSALYPILEKAGDPTLLISQVATSTMVDICHACGYNSVQHLINQNSDYLVNG
I
SLNLRHLALHPHAPKVLEAMLRNADASLLPLVADVVQDVLATLDQFYDKRAASFVSVLHALLAAL
AHWF
P
DSGSTGQLQQRSLEEEGRQLPAAGEASTTAEDIEQFVLSYLQEKDVAEGNVSDLEAEE
EVQSAPPKVDE
N
DTLPDVEPPLPTHIQIAKDVMERCIHLSADKNLKIRLK
VLDVLGLCVEVLQTHKNQLLPLAHRAWPSLV
H
RLTSDDPLAVLRAFK
VLQTLGSRCGDFLRSRFCKDVLPKLTSSLITQAPISARAGPVYSHTLAFKLQLA
V
LQGLGPLCENLDL
GEGDLNKVADACVIYLSTKQPVKLQEAARSVFLHLMRVDPDSTWLLLHELYCPVQQ
F
TAPHPSLHPVQLQGATQPQNPYATNVCHLLLQLQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser