NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16880.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16880.1 Public Mus musculus 2 Tbc1d20 21 106 86 CCDS HistoryNCBI Gene:67231Re-query CCDS DB by CCDS ID:16880.1Re-query CCDS DB by GeneID:67231See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16880.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000028963 ENSMUSP00000028963 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028963Link to Ensembl Protein Viewer:ENSMUSP00000028963Re-query CCDS DB by Nucleotide ID:ENSMUST00000028963Re-query CCDS DB by Protein ID:ENSMUSP00000028963
Original member Current member EBI,WTSI OTTMUST00000037640 OTTMUSP00000016876 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000037640Link to Vega Protein Viewer:OTTMUSP00000016876Re-query CCDS DB by Nucleotide ID:OTTMUST00000037640Re-query CCDS DB by Protein ID:OTTMUSP00000016876
Original member NCBI NM_024196.3 NP_077158.1 Updated not alive Link to Nucleotide Sequence:NM_024196.3Link to Protein Sequence:NP_077158.1Re-query CCDS DB by Nucleotide ID:NM_024196Re-query CCDS DB by Protein ID:NP_077158
Current member NCBI NM_024196.4 NP_077158.1 Accepted alive Link to Nucleotide Sequence:NM_024196.4Link to Protein Sequence:NP_077158.1Re-query CCDS DB by Nucleotide ID:NM_024196Re-query CCDS DB by Protein ID:NP_077158Link to BLAST:NP_077158.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_077158.1 402 Q9D9I4 402 100% 0 0

Chromosomal Locations for CCDS 16880.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 152293974 152294040 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 152302152 152302337 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 152304946 152305026 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 152307989 152308175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 152308330 152308431 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 152310386 152310527 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 152311317 152311504 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 152311710 152311965 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1209 nt):
ATGGCCCTCCGGCCCTCAAAGGGCGACGGCTCCGCCGGCCGCTGGGACCGCGGCGCAGGGAAGGCAGACT
TT
AATGCCAAAAGGAAAAAGAAGGTGGCAGAGATACACCAGGCTCTGAACAGTGATCCCATCGACTTGGC
T
GCCCTCCGACGAATGGCTATCAGTGAGGGAGGGCTCCTGACTGATGAGATCAGGTGCCAAGTATGGCCT
AAG
CTCCTCAACGTGAACACCAGTGAGCCACCGCCTGTGTCAAGGAAGGACCTTCGAGACATGAGCAAGG
AC
TACCAGCAAGTGCTGCTGGACGTCAGGCGATCTCTTCGGCGCTTCCCCCCTGGCATGCCGGACGAGCA
G
AGAGAAGGGCTCCAGGAAGAGCTAATCGATATCATCCTCCTCGTCCTGGATCGCAACCCTCAGCTCCAC
TAC
TACCAGGGCTACCATGACATCGTGGTCACATTTCTGCTGGTGGTGGGGGAGAGGCTGGCAACATCCC
TG
GTAGAAAAATTGTCTACCCACCACCTCAGGGATTTCATGGATCCCACAATGGACAACACCAAGCACAT
C
CTAAATTATCTGATGCCCATCATTGACCAAGTGAGCCCAGAGCTCCACGACTTCATGCAGAGTGCTGAG
GTG
GGGACCATCTTTGCCCTCAGCTGGCTTATCACCTGGTTTGGGCACGTCCTGATGGACTTCAGGCACG
TT
GTGAGGTTATACGACTTCTTCCTGGCCTGCCACCCACTTATGCCCATTTACTTTGCAGCTGTGATCGT
G
CTGTACCGGGAGCAGGAAGTCCTGGACTGTGACTGTGACATGGCCTCTGTCCACCACCTGTTGTCCCAG
ATC
CCTCAGGACCTGCCCTATGAGACGCTCATCAGCAGAGCAGGAGACCTCTTTGTTCAGTTTCCCCCTT
CT
GAACTTGCAAGGGAGGCAGCTGCTCAGCAGGAGGCTGAGAGAACGGCAGCCTCTACTTTCAAAGACTT
T
GAGCTGGCATCAACTCAGCAGAGGCCAGACATGGTGCTGCGGCAGCGGTTTCGGGGACTTCTGAGGCCT
GAG
GCTCGAACAAAAGATGTCCTGACCAAACCAAGGACCAACCGCTTTGTGAAACTGGCAGTGATGGGGC
TG
ACGGTGGCCCTCGGAGCAGCAGCACTAGCAGTGGTGAAGAGCGCCCTGGAGTGGGCCCCTAAGTTCCA
G
CTGCAGCTGTTCCCCTAA


Translation (402 aa):
MALRPSKGDGSAGRWDRGAGKADFNAKRKKKVAEIHQALNSDPIDLAALRRMAISEGGLLTDEIRCQVWP
K
LLNVNTSEPPPVS
RKDLRDMSKDYQQVLLDVRRSLRRFPPGMPDEQREGLQEELIDIILLVLDRNPQLH
Y
YQGYHDIVVTFLLVVGERLATSLVEKLSTHHL
RDFMDPTMDNTKHILNYLMPIIDQVSPELHDFMQSAE
V
GTIFALSWLITWFGHVLMDFRHVVRLYDFFLACHPLMPIYFAAV
IVLYREQEVLDCDCDMASVHHLLSQ
I
PQDLPYETLISRAGDLFVQFPPSELAREAAAQQEAE
RTAASTFKDFELASTQQRPDMVLRQRFRGLLRP
E
ARTKDVLTKPRTNRFVKLAVMGLTVALGAAALAVVKSALEWAPKFQLQLFP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser