NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16819.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16819.1 Public Mus musculus 2 Kat14 21 106 86 CCDS HistoryNCBI Gene:228714Re-query CCDS DB by CCDS ID:16819.1Re-query CCDS DB by GeneID:228714See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16819.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000028911 ENSMUSP00000028911 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028911Link to Ensembl Protein Viewer:ENSMUSP00000028911Re-query CCDS DB by Nucleotide ID:ENSMUST00000028911Re-query CCDS DB by Protein ID:ENSMUSP00000028911
Original member Current member EBI,WTSI OTTMUST00000007543 OTTMUSP00000003639 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000007543Link to Vega Protein Viewer:OTTMUSP00000003639Re-query CCDS DB by Nucleotide ID:OTTMUST00000007543Re-query CCDS DB by Protein ID:OTTMUSP00000003639
Original member Current member NCBI NM_181417.3 NP_852082.2 Accepted alive Link to Nucleotide Sequence:NM_181417.3Link to Protein Sequence:NP_852082.2Re-query CCDS DB by Nucleotide ID:NM_181417Re-query CCDS DB by Protein ID:NP_852082Link to BLAST:NP_852082.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_852082.2 779 Q8CID0 779 100% 0 0

Chromosomal Locations for CCDS 16819.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 144373597 144373855 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 144375845 144375963 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 144380707 144380828 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 144389175 144389356 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 144393304 144393720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 144393816 144394378 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 144400686 144400822 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 144402395 144402570 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 144403999 144404189 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 144406623 144406796 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2340 nt):
ATGGATAGTAGCATCCACCTGAGTGGGCTCCTCAGTCGGCATGACGATGACGCCACGAGAACGTCCACCT
CG
GAAGGGCTGGAGGAAGGCGAGGTGGAGGGAGAGACTCTCCTAATTGTGGAATCGGAGGATCAGGCGTC
A
GTGGACTTATCTCACGACCAGAGTGGGGATTCCCTCAACAGCGATGAAGGAGATGTGTCCTGGATGGAG
GAA
CAGCTGTCTTACTTCTGTGACAAGTGCCAAAAGTGGATCCCAGCCAGTCAGCTGAGGGAGCAGCTCA
GT
TACCTGAAGGGCGATAACTTTTTCAGGTTTACTTGTTGCGATTGCTCTGCAGACGGCAAGGAGCAGTA
C
GAGAGGCTGAAACTGACATGGCAGCAAGTGGTCATGCTGGCAATGTACAACCTGTCTCTGGAAGGAAGT
GGA
CGTCAAGGTTATTTCCGGTGGAAAGAAGATATCTGTGCTTTTATTGAGAAACATTGGACTTTTTTAC
TA
GGAAATAGGAAAAAGACGTCGACGTGGTGGAGCACAGTAGCAGGCTGCCTCAGCGTGGGAAGCCCTGT
T
TATTTCCGGTCAGGTGCTCAGGAGTTTGGAGAGCCCGGATGGTGGAAACTTGTTCATAACAGACCCCCA
ACC
ATGAGGCCGGAGGGAGAGAAGCTGGCTGCCTCCACCTTGAAAGTGAAAGCTTCAAAGCCAACGCTGG
AT
CCCATCATTACTGTTGAGGGACTCAGAAAACGGGCAAGCCGGAATCCTGTGGAATCTGCCATGGAATT
G
AAAGAGAAGCGGTCGCGAACACAGGAAGCTAAAGACATCAGAAGAGCTCAGAAAGAAGCGGCTGGCCTC
CTC
GACAGGAGCACCTCTTCCACCCCCGTCAAGTTCATAAGCCGAGGCCGGAGGCCGGATCTGATTTTGG
AG
AAAGGAGAAGTGATCGACTTCTCGTCCCTGAGCTCCTCAGACCGCACTCCCCTCACAAGCCCGTCTCC
T
TCTCCGTCTCTGGATTTCTCCGCCCCGGGGACGCCAGCCTCGCACTCGGCCACACCTAGCTTGCTTTCC
GAA
GCAGACCTCATCCCAGACGTGATGCCACCCCAAGCCCTGTTTCATGATGACGATGAGCTGGAAGGAG
AT
GGAGTTATAGACCCAGGGATGGAGTACATCCCACCCCCAGCTGGGTCAGCGTCTGGGCTGCTTGGGAG
C
AGAAAGAAGGTCCGAGCTCCGGAACAGATAAAACAGGAAGTGGACAGCGAGGAGGAGAAGCCAGACAGG
ATG
GATGGAGATAGCGAAGACACAGATTCAAACATTTCTCTGCACACTAGAGCTCGAGAAAAGAGGAAGC
CG
CCACTGGAAAAGGACATGAAGCCCAAGGGCCCCAGGTATACACCCGTGAGCATCTATGAGGAGAAGCT
G
CTGCTCAAGAGGCTGGAGGCGTGCCCCGGCGCCGTGGCCATGACTCCAGAAGCCAGGAGGCTGAAACGG
AAA
CTGATCGTCCGGCAAGCGAAAAGAGATCGGGGTTTACCACTATTTGACTTGGACGAGGTTGTGAATG
CC
GCACTTCTGTTAGTCGATGGGATTTATGGAGCCAAAGATGGAGGAGCTTCCCGGCTTGCAGCTGGACA
A
GCTACATACCGGACCACCTGCCAGGACTTTCGGATCCTGGACCGGTACCAGACTGCCTTACCAGCCAGG
AAA
GGATTCCGGCACCAGACCACGAGATTTTTGTATCGTTTGGTGGGATCAGAAGATCTGGCTGTGGACC
AA
AGTATTATCAGCCCTTATACTTCTCGGATCTTGAAACCTTATATCAGGCGTGATTATGAGACAAAGCC
A
CCCAAACTACAGCTCCTGTCACAGATCCGTTCCCACCTGCACAGGAGTGACCCTCACTGGACACCTGGA
CCT
GATGCACCCCTCGATTACTGCTATGTCCGACCAAATCACATCCCAACCATCAACTCCATGTGCCAGG
AG
TTTTTCTGGCCTGGCATTGACCTGTCTGAGTGTCTGCAGTATCCAGACTTCAGTGTTGTAGTCCTTTA
T
AAAAAAGTCATTGTTGCCTTTGGCTTCATGGTTCCTGATGTGAAGTACAACGAAGCTTACATCTCATTT
CTG
CTTGTTCATCCTGAGTGGAGGAGAGCAGGGATCGCCACATTCATGATCTATCATCTGATTCAGACAT
GC
ATGGGCAAGGATGTGACTCTTCATGTCTCGGCAAGCAACCCCGCCATGCTGCTGTACCAGAAGTTTGG
C
TTCAAGACCGAGGAGTATGTTTTGGATTTTTATGATAAGTATTACCCGCTGGAGAGTACGGAGTGTAAG
CAT
GCATTCTTCCTGAGGCTCCGACGCTGA


Translation (779 aa):
MDSSIHLSGLLSRHDDDATRTSTSEGLEEGEVEGETLLIVESEDQASVDLSHDQSGDSLNSDEGDVSWME
E
QLSYFCDKCQKWIPA
SQLREQLSYLKGDNFFRFTCCDCSADGKEQYERLKLTWQQVVMLAMYNLSLEGS
G
RQGYFRWKEDICAFIEKHWTFLLGN
RKKTSTWWSTVAGCLSVGSPVYFRSGAQEFGEPGWWKLVHNRPP
T
MRPEGEKLAASTLKVK
ASKPTLDPIITVEGLRKRASRNPVESAMELKEKRSRTQEAKDIRRAQKEAAGL
L
DRSTSSTPVKFISRGRRPDLILEKGEVIDFSSLSSSDRTPLTSPSPSPSLDFSAPGTPASHSATPSLLS
E
ADLIPDVMPPQALFH
DDDELEGDGVIDPGMEYIPPPAGSASGLLGSRKKVRAPEQIKQEVDSEEEKPDR
M
DGDSEDTDSNISLHTRAREKRKPPLEKDMKPKGPRYTPVSIYEEKLLLKRLEACPGAVAMTPEARRLKR
K
LIVRQAKRDRGLPLFDLDEVVNAALLLVDGIYGAKDGGASRLAAGQATYRTTCQDFRILDRYQ
TALPAR
K
GFRHQTTRFLYRLVGSEDLAVDQSIISPYTSRILKPYI
RRDYETKPPKLQLLSQIRSHLHRSDPHWTPG
P
DAPLDYCYVRPNHIPTINSMCQEFFWP
GIDLSECLQYPDFSVVVLYKKVIVAFGFMVPDVKYNEAYISF
L
LVHPEWRRAGIATFMIYHLIQ
TCMGKDVTLHVSASNPAMLLYQKFGFKTEEYVLDFYDKYYPLESTECK
H
AFFLRLRR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser