NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16811.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16811.1 Public Mus musculus 2 Bfsp1 21 106 86 CCDS HistoryNCBI Gene:12075Re-query CCDS DB by CCDS ID:16811.1Re-query CCDS DB by GeneID:12075See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16811.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000028907 ENSMUSP00000028907 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028907Link to Ensembl Protein Viewer:ENSMUSP00000028907Re-query CCDS DB by Nucleotide ID:ENSMUST00000028907Re-query CCDS DB by Protein ID:ENSMUSP00000028907
Original member Current member EBI,WTSI OTTMUST00000006429 OTTMUSP00000003027 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000006429Link to Vega Protein Viewer:OTTMUSP00000003027Re-query CCDS DB by Nucleotide ID:OTTMUST00000006429Re-query CCDS DB by Protein ID:OTTMUSP00000003027
Original member Current member NCBI NM_009751.2 NP_033881.2 Accepted alive Link to Nucleotide Sequence:NM_009751.2Link to Protein Sequence:NP_033881.2Re-query CCDS DB by Nucleotide ID:NM_009751Re-query CCDS DB by Protein ID:NP_033881Link to BLink:NP_033881.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033881.2 663 A2AMT1-2 663 100% 0 0

Chromosomal Locations for CCDS 16811.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 143826666 143827639 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 143830084 143830169 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 143831837 143832057 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 143841674 143841781 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 143845901 143845990 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 143848928 143849023 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 143858057 143858117 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 143862576 143862931 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1992 nt):
ATGTACCGCCGCAGCTACGTCTTCCAGGCCCGCCAGGAGCGCTACGAGCGCGCCCAGCCCGCGGGCCCCG
CC
GCCCAGCCCGGGGGAACCGCGCCCGGCCTGGCAGCGCTGCAGGCGCTGGGCGAGCGCGTGGCAGTCCA
G
GTCCAGCGGGCCCGCGCGCTCCAGCAGCGCCACGCCGGCCTGCGGCGGCAGCTCGACGCCTTCCAGCGC
CTG
GGCGAGCAGCCCGGGCCCGAGGACGCGCTCGCCCGCCACGTCGAGGCCAATCTGCAGCGCGCCCGGG
AC
CTGACAGCCGAGCACGCGCGGCTCGAGAGGCAGGAGGCCGAGGCGCAGCGCGCGCTCGACGAGTTCCG
C
AGCAAATACGAAAATGAGTGTGAATGTCAGTTGGTGCTAAAGGAAATGCTGGAACGGCTTAACAAGGAA
GCC
GATGAAGCCTTATTGCGTAACCTGCACCTTCAGTTGGAGGCACAGTTTCTGCAGGCAGATATCAGTG
TG
GCCAAGGACAGGTACAAGAAGAATCTTCTGGAGATTCAGACCTACATCACCGTCCTGCAGCAGATCGT
A
CAGACTGCTCCTCAAGTGTCCCTGGTTACTGGGATGAGGGAGGAGAAGCTGTTCACAGAACGGGAAGTG
GCT
GCCCTGCAGAACCAGCTGGAGGAGGGCCGAGAGGCAGTCACCCACCTGCAGGCACAGAAAGCTGAGC
TG
CAGGCCCAGACCACGGCCCTGGAACAAGCTATTAAGCATGCTCATGAGTGTTACGATGAGGAGCTACA
G
CTTTACAACGAGCAGATCGAAAACCTTCGGAAGGAGATCGAGGAGGCGGAGCGGTCTCTGGAGAGGTCG
TCC
TATGACTGCAGGCAGCTAGCCGTGGCCCAGCAGACGCTGAGGAATGAGCTAGACCGTTATCATCGGA
TC
ATTGAGATTGAAGGCAGCAGGCTGAGCTCTGTTTTCATTGAGACGCCCATCTCTCTGATCACCCCGAG
C
CATGGGGCCCCTCTCAGCCTTGGATCCAGTGTGAAAGATCTTGCCAGGGCCGTGCAGGATATTACAGCA
GCT
AAACCGAGACAGAAGGCCCTCCCCAAGAGCCTTCCAAAAAGAAAGGAGATTATAGCTCAAGATAAGG
TG
GAGGAAACTCTGGAAGATGCACCATTAAAACCTCCGCAGGAGCCAAAGGCACTGCAGGTGGAACGGAA
A
GCAGAAGGTGGCTCTCAGCCCGGAGCAGGGGGAGGACATGGAGTAAGTCCCACACAAGAAGGGGGTCCT
GAG
GATGTGCCAGACGGGGGCCAGATAAGCAAAGCCTTTGGGAAACTGTGCAAAGTAGTGAAAGAGAGAG
TG
AGCGGCCACAAAGAGCCCGAGCCTGAGCCGCCCACGGACCTTTTCACCAAAGGACGGCATGTACTCGT
C
ACAGGGGAGTCTAGTTTTGTTGACCCCGAGTTCTACTCCTCCTCCATCCCAGCTAGAGGTGGGGTGGTG
ATT
TCCATTGAGGAAGACTCTATGCATCATGACGGCCACGTAGAGCCCTCTCCTGGACAGCCCATGCCAC
CT
GTGGAGAATGGACAGGGCGTTCCCCAGGGCAGGGAAGGTGACCACTCAAACCATCAGCAGGGTACAGA
C
AAGAATGGGTTACGGGCCAAGGAACCAAAAGACCTGGAGGAAAAAGATGATGATGGCAAGAAGGAAGCT
GAG
GGGAGCAGGAGACCCTGTCCTGTGATCATACCTGGTCCTGATGAACCATCTACATCCCATTCACAGA
CG
TCTGGGTCCAATCAGGGTGGACCAGTGGGGCCTGCGAGTAAGAGCAGTAGCCTGCTGGCAAAGGGCCC
T
TCGAAGGCTCTGTCTATTAAGAAGGTGGAGGTGGTGGAATCCATTGAGAAGATTTCAACAGAGAGTATT
CAG
ACATATGAAGAGACTTCCGTAATTGTGGAGACTCTGATTGGGAAGTCAAAGGGCAACAAGAAACTGG
GA
GAGAAGAGCTTGCCAGACACAAGGGCTTGA


Translation (663 aa):
MYRRSYVFQARQERYERAQPAGPAAQPGGTAPGLAALQALGERVAVQVQRARALQQRHAGLRRQLDAFQR
L
GEQPGPEDALARHVEANLQRARDLTAEHARLERQEAEAQRALDEFRS
KYENECECQLVLKEMLERLNKE
A
DEALLRNLHLQLEAQFLQADISVAKDRYKK
NLLEIQTYITVLQQIVQTAPQVSLVTGMREEKLFTEREV
A
ALQNQLEEGREAVTHLQAQKAELQAQ
TTALEQAIKHAHECYDEELQLYNEQIENLRKEIEEAERSLERS
S
YDCRQLAVAQQTLRNELDRYHRIIEIEGS
RLSSVFIETPISLITPSHGAPLSLGSSVKDLARAVQDITA
A
KPRQKALPKSLPKRKEIIAQDKVEETLEDAPLKPPQEPKALQVERKAEGGSQPGAGGGHGVSPTQEGGP
E
DVPDGGQISKAFGKLCKVVKERVSGHKEPEPEPPTDLFTKGRHVLVTGESSFVDPEFYSSSIPARGGVV
I
SIEEDSMHHDGHVEPSPGQPMPPVENGQGVPQGREGDHSNHQQGTDKNGLRAKEPKDLEEKDDDGKKEA
E
GSRRPCPVIIPGPDEPSTSHSQTSGSNQGGPVGPASKSSSLLAKGPSKALSIKKVEVVESIEKISTESI
Q
TYEETSVIVETLIGKSKGNKKLGEKSLPDTRA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser