NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16788.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16788.1 Public Mus musculus 2 Plcb4 21 106 86 CCDS HistoryNCBI Gene:18798Re-query CCDS DB by CCDS ID:16788.1Re-query CCDS DB by GeneID:18798See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 16788.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000035646 ENSMUSP00000038409 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000035646Link to Ensembl Protein Viewer:ENSMUSP00000038409Re-query CCDS DB by Nucleotide ID:ENSMUST00000035646Re-query CCDS DB by Protein ID:ENSMUSP00000038409
Original member Current member EBI,WTSI ENSMUST00000110109 ENSMUSP00000105736 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000110109Link to Ensembl Protein Viewer:ENSMUSP00000105736Re-query CCDS DB by Nucleotide ID:ENSMUST00000110109Re-query CCDS DB by Protein ID:ENSMUSP00000105736
Original member Current member EBI,WTSI OTTMUST00000037929 OTTMUSP00000017026 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000037929Link to Vega Protein Viewer:OTTMUSP00000017026Re-query CCDS DB by Nucleotide ID:OTTMUST00000037929Re-query CCDS DB by Protein ID:OTTMUSP00000017026
Original member Current member NCBI NM_013829.2 NP_038857.1 Accepted alive Link to Nucleotide Sequence:NM_013829.2Link to Protein Sequence:NP_038857.1Re-query CCDS DB by Nucleotide ID:NM_013829Re-query CCDS DB by Protein ID:NP_038857Link to BLink:NP_038857.1

Chromosomal Locations for CCDS 16788.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 135877398 135877481 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135907499 135907579 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135908350 135908409 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135910101 135910244 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135929955 135930034 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135932249 135932302 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135938260 135938341 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135939210 135939310 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135939947 135940004 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135947046 135947154 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135950212 135950422 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135951993 135952086 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135954346 135954425 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135954915 135954999 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135958055 135958145 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135958642 135958737 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135961719 135961819 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135967025 135967166 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135967917 135968001 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135968321 135968445 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135970394 135970445 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135971758 135971860 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135972912 135973076 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135976099 135976303 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135982033 135982121 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135982976 135983126 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135987480 135987529 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135987837 135987902 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135994294 135994409 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 135998677 135998752 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 136000134 136000309 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 136002559 136002660 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 136007340 136007397 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 136007823 136007909 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 136012966 136013034 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3528 nt):
ATGGCCAAACCTTACGAATTTAACTGGCAGAAGGAAGTGCCCTCTTTCTTGCAAGAAGGAGCAGTTTTTG
AC
AGATACGAAGAGGAATCTTTTGTGTTTGAGCCCAACTGCCTCTTCAAAGTAGATGAATTCGGCTTCTT
C
CTGACGTGGAAGAGTGAAGGCAAGGAAGGACAAGTGCTAGAATGTTCCCTCATCAACAGTATTCGCCAA
GCA
GCCATACCAAAGGATCCCAAAATCCTGGCTGCTCTCGAAGCTGTTGGAAAATCTGAAAATGATCTGG
AA
GGGCGGATATTGTGTGTCTGCAGCGGCACGGATCTGGTGAATATCGGCTTCACTTACATGGTGGCTGA
A
AATCCAGAAGTAACTAAGCAATGGGTAGAAGGCCTGAGATCGATCATTCACAACTTCAGGGCAAACAAC
GTC
AGTCCGATGACATGCCTCAAGAAACACTGGATGAAACTGGCCTTTCTGACCAACACAACTGGTAAAA
TC
CCAGTGAGGAGTATCACTAGAACCTTCGCATCAGGGAAAACAGAAAAGGTGATCTTTCAAGCCCTCAA
G
GAACTAGGTCTTCCCAGTGGAAAGAATGATGAAATTGAACCTGCTGCATTTACTTATGAAAAGTTCTAT
GAA
CTGACACAAAAGATTTGTCCTCGGACAGATATAGAAGATCTTTTTAAAAAAATCAATGGAGACAAAA
CT
GATTATTTAACGGTAGACCAATTAGTGAGCTTTCTAAACGAACATCAGCGAGATCCTCGGCTGAATGA
A
ATTTTATTCCCATTTTATGATGCTAAAAGAGCAATGCAGATCATTGAAATGTATGAGCCTGATGAAGAG
CTG
AAGAAAAAAGGCCTCATATCCAGTGATGGATTCTGCAGATATCTGATGTCAGATGAAAATGCCCCTG
TC
TTCTTAGATCGCTTAGAACTTTACCAGGAGATGGACCACCCGCTGGCTCATTACTTCATCAGTTCCTC
C
CACAACACCTATCTCACTGGCCGGCAATTTGGAGGAAAGTCTTCAGTGGAAATGTACAGACAAGTTCTC
CTG
GCTGGTTGCAGGTGTGTTGAACTTGACTGTTGGGATGGAAAAGGTGAAGATCAGGAACCGATAATAA
CT
CACGGAAAAGCAATGTGTACAGACATCCTTTTTAAGGATGTAATCCAGGCCATCAAGGAAACGGCGTT
T
GTCACATCAGAATACCCTGTCATTCTCTCCTTCGAAAACCACTGCAGCAAATATCAACAGTACAAGATG
TCC
AAGTATTGTGAAGATCTATTTGGGGATCTCCTGTTGAAACAAGCACTTGAGTCGCATCCACTTGAAC
CA
GGAAGGCCCTTGCCGTCTCCTAATGACCTCAAAAGAAAAATACTCATCAAGAATAAGAGGCTGAAGCC
T
GAAGTTGAAAAGAAACAGCTTGAAGCTTTGAAAAGCATGATGGAAGCTGGAGAGTCAGCCGCCCCAGCT
AGC
ATCTTGGAAGACGACAATGAAGAGGAAATAGAAAGTGCTGATCAAGAGGAAGAAGCCCACCCTGAAT
AC
AAATTTGGAAATGAACTTTCTGCCGATGACTACAGTCACAAGGAAGCGGTTGCAAACAGCGTCAAGAA
G
GGCCTGGTCACCGTAGAGGATGAGCAAGCATGGATGGCATCTTATAAATACGTAGGTGCTACCACGAAC
ATC
CATCCGTACTTGTCCACGATGATCAACTATGCCCAGCCCGTGAAGTTTCAAGGTTTCCACGTGGCTG
AA
GAGCGCAATATTCACTATAACATGTCTTCTTTTAACGAGTCGGTTGGCCTTGGCTACTTGAAGACGCA
C
GCGATTGAGTTTGTAAATTACAATAAGCGACAAATGAGCCGCATTTACCCCAAGGGAGGCCGAGTTGAT
TCC
AGTAATTACATGCCTCAGATTTTCTGGAACGCTGGTTGCCAGATGGTTTCACTGAACTATCAAACCC
CA
GATTTAGCGATGCAATTGAATCAAGGAAAATTTGAGTATAATGGATCATGCGGGTACCTTCTCAAGCC
A
GATTTCATGAGGCGGCCTGATCGGACATTTGACCCCTTCTCTGAAACCCCTGTGGACGGGGTTATTGCA
GCC
ACGTGCTCAGTGCAGGTTATATCAGGGCAGTTCCTCTCAGATAAGAAGATCGGGACATACGTGGAAG
TC
GATATGTACGGGCTGCCCACCGACACCATACGGAAAGAGTTCCGAACCCGCATGGTTATGAACAATGG
A
CTCAACCCAGTGTATAATGAAGAATCGTTTGTGTTTCGAAAGGTGATCCTGCCTGACCTAGCTGTCCTG
AGA
ATCGCAGTCTACGATGACAACAACAAGCTAATTGGCCAGAGGATCCTTCCTTTGGATGGTCTCCAAG
CA
GGCTACCGACACATCTCCCTGAGAAACGAGGGAAACAAACCATTATCACTGCCAACAATTTTCTGCAA
T
ATTGTTCTTAAAACATACGTGCCTGATGGATTTGGAGATATTGTGGATGCTTTATCCGATCCAAAGAAA
TTT
CTTTCAATCACAGAGAAGAGAGCAGACCAAATGAGAGCAATGGGCATTGAAACTAGTGACATAGCAG
AT
GTGCCCAGTGACACTTCCAAAAATGACAAGAAAGGCAAGGCCAACCCAGCCAAAGCGAACGTGACCCC
T
CAGAGCAGCTCTGAGCTCAGACCAACCACCACAGCCGCCCTGGGCTCTGGCCAGGAAGCCAAGAAAGGT
ATT
GAACTTATCCCTCAAGTGAGGATAGAAGATTTAAAGCAAATGAAGGCTTACTTGAAGCATTTAAAGA
AA
CAACAGAAGGAGTTAAACTCTTTAAAGAAGAAACATGCAAAGGAGCACAGTACCATGCAGAAGTTACA
C
TGCACACAAGTTGACAAAATCGTGGCCCAGTATGACAAAGAGAAGTCGACTCATGAGAAAATCCTAGAG
AAG
GCGATGAAGAAGAAGGGGGGAAGTAATTGTCTTGAAATAAAAAAAGAAACAGAAATTAAAATTCAGA
CC
CTGACAACGGATCACAAATCTAAGGTCAAAGAGATTGTGGCCCAGCACACAAAGGAGTGGTCAGAAAT
G
ATCAACACTCACAGTGCGGAGGAGCAGGAAATCCGGGATCTGCACCTGAGCCAGCAGTGTGAGCTGCTG
AGA
AAGCTGCTCATCAATGCTCATGAGCAGCAGACCCAGCAGCTGAAACTCTCCCATGACAGGGAAAGCA
AG
GAGATGAGAGCCCATCAGGCTAAGATTTCTATGGAAAATAGCAAGGCCATCAGTCAAGATAAATCTAT
C
AAGAACAAGGCAGAACGGGAAAGGCGAGTCAGGGAGTTGAACAGCAGCAACACTAAGAAGTTCCTAGAA
GAA
AGAAAGAGACTGGCGATGAAGCAGTCAAAAGAAATGGATCAGTTGAAAAAAGTCCAGCTGGAGCACC
TA
GAATTCCTAGAGAAACAGAACGAGCAGGCGAAGGAGATGCAGCAGATGGTGAAATTGGAAGCCGAGAT
G
GACCGCAGACCAGCAACAGTAGTATGA


Translation (1175 aa):
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRQ
A
AIPK
DPKILAALEAVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPEVTKQWVEGLRSIIHNFRANN
V
SPMTCLKK
HWMKLAFLTNTTGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPAAFTYEKFY
E
LTQKICPRTDIEDLFKK
INGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEE
L
KKK
GLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVL
L
AGC
RCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
S
KYCEDLFGDLLLKQALESHP
LEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSMMEAGESAAPA
S
ILEDDNEEEIES
ADQEEEAHPEYKFGNELSADDYSHKEAVANSVKKGLVTVEDEQAWMASYKYVGATTN
I
HPYLSTMINYAQPVKFQGFHVAE
ERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVD
S
SNYMPQIFWNAGCQMVSLNYQTP
DLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIA
A
TCSVQ
VISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVL
R
IAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFG
DIVDALSDPKK
F
LSITEKRADQMRAMGIET
SDIADVPSDTSKNDKKGKANPAKANVTPQSSSELRPTTTAALGSGQEAKKG
I
ELIPQVRIEDLKQMK
AYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILE
K
AMKKK
GGSNCLEIKKETEIKIQTLTTDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELL
R
KLLINAHEQQTQQLKLSHD
RESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLE
E
RKR
LAMKQSKEMDQLKKVQLEHLEFLEKQNEQAKEMQQMVKLEAEMDRRPATVV



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser