NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16676.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16676.1 Public Mus musculus 2 Fbn1 21 106 86 CCDS HistoryNCBI Gene:14118Re-query CCDS DB by CCDS ID:16676.1Re-query CCDS DB by GeneID:14118See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16676.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000028633 ENSMUSP00000028633 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028633Link to Ensembl Protein Viewer:ENSMUSP00000028633Re-query CCDS DB by Nucleotide ID:ENSMUST00000028633Re-query CCDS DB by Protein ID:ENSMUSP00000028633
Original member Current member EBI,WTSI ENSMUST00000103234 ENSMUSP00000099524 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000103234Link to Ensembl Protein Viewer:ENSMUSP00000099524Re-query CCDS DB by Nucleotide ID:ENSMUST00000103234Re-query CCDS DB by Protein ID:ENSMUSP00000099524
Original member Current member EBI,WTSI OTTMUST00000036335 OTTMUSP00000016325 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000036335Link to Vega Protein Viewer:OTTMUSP00000016325Re-query CCDS DB by Nucleotide ID:OTTMUST00000036335Re-query CCDS DB by Protein ID:OTTMUSP00000016325
Original member Current member EBI,WTSI OTTMUST00000036337 OTTMUSP00000016326 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000036337Link to Vega Protein Viewer:OTTMUSP00000016326Re-query CCDS DB by Nucleotide ID:OTTMUST00000036337Re-query CCDS DB by Protein ID:OTTMUSP00000016326
Original member Current member NCBI NM_007993.2 NP_032019.2 Accepted alive Link to Nucleotide Sequence:NM_007993.2Link to Protein Sequence:NP_032019.2Re-query CCDS DB by Nucleotide ID:NM_007993Re-query CCDS DB by Protein ID:NP_032019Link to BLink:NP_032019.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032019.2 2873 Q61554 2873 100% 0 0

Chromosomal Locations for CCDS 16676.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 125301586 125301975 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125303086 125303260 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125306270 125306501 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125308470 125308589 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125309381 125309509 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125309757 125309873 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125312500 125312622 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125312839 125312964 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125314594 125314800 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125315359 125315484 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125316967 125317098 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125317412 125317534 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125318997 125319116 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125320863 125320979 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125321196 125321261 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125321616 125321765 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125324826 125324951 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125328093 125328212 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125328991 125329119 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125330533 125330649 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125332258 125332383 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125335365 125335487 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125338433 125338558 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125341256 125341327 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125342003 125342161 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125342800 125342922 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125343805 125343930 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125344025 125344093 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125345855 125346019 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125346330 125346452 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125348107 125348229 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125350246 125350371 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125351682 125351804 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125351953 125352075 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125358806 125358931 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125360108 125360233 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125361184 125361306 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125362462 125362587 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125362675 125362800 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125363612 125363740 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125363862 125363987 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125365484 125365711 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125367583 125367708 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125369334 125369384 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125369794 125369931 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125370146 125370265 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125370776 125370901 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125372391 125372516 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125373911 125373964 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125377787 125377939 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125379007 125379129 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125381985 125382107 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125383611 125383736 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125387266 125387385 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125389171 125389311 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125389880 125390065 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125394612 125394770 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125397778 125397903 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125403104 125403229 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125412606 125412803 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125466603 125466698 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125468543 125468638 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125477497 125477595 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125479190 125479272 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 125505440 125505603 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (8622 nt):
ATGCGGCGAGGAGGGCTGCTGGAGGTCGCGCTGGCGTTCGCCCTGCTCCTCGAGTCCTACACGAGCCATG
GG
GCGGACGCCAATTTGGAGGCTGGGAGCCTGAAGGAGACCAGAGCCAATCGGGCCAAGAGAAGAGGCGG
C
GGAGGACACGATGCGCTGAAAGGACCCAATGTCTGTGGATCACGTTATAATGCATACTGTTGTCCTGGA
TGG
AAAACCTTACCTGGTGGAAATCAGTGTATTGTTCCCATTTGCCGGCATTCCTGTGGGGATGGATTCT
GC
TCGAGGCCAAATATGTGCACTTGCCCGTCTGGTCAGATATCTCCTTCCTGTGGCTCCAGATCCATCCA
A
CACTGCAGCATCCGCTGTATGAATGGGGGCAGCTGCAGCGATGACCACTGTCTGTGCCAGAAAGGGTAC
ATC
GGCACTCACTGTGGACAGCCTGTCTGTGAAAGTGGCTGTCTCAACGGAGGGAGGTGTGTGGCCCCAA
AT
CGGTGTGCTTGCACGTACGGCTTTACTGGACCCCAGTGTGAAAGAGATTACAGAACAGGCCCATGTTT
T
ACTGTGGTAAGCAACCAGATGTGCCAGGGACAGCTCAGCGGGATTGTCTGCACCAAAACACTTTGCTGT
GCC
ACCGTGGGCCGAGCCTGGGGCCACCCCTGTGAGATGTGTCCTGCCCAGCCTCACCCCTGCCGCCGCG
GC
TTCATTCCCAACATCCGCACTGGAGCTTGTCAAGATGTGGATGAATGTCAGGCCATCCCAGGGATGTG
T
CAAGGAGGAAATTGCATTAATACCGTTGGATCTTTTGAGTGCAAATGCCCTGCTGGACACAAATTTAAT
GAA
GTGTCACAAAAATGTGAAGATATTGACGAGTGCAGCACCATTCCTGGAGTCTGCGATGGCGGGGAAT
GT
ACAAACACTGTCAGCAGCTACTTCTGCAAATGTCCCCCTGGTTTTTACACCTCTCCTGATGGCACCAG
A
TGCGTAGATGTTCGCCCTGGTTACTGCTACACAGCTCTGGCAAACGGGCGCTGCTCTAACCAGCTGCCA
CAG
TCCATAACCAAAATGCAGTGCTGTTGCGATCTTGGCCGGTGCTGGTCTCCAGGGGTTACTGTTGCTC
CC
GAGATGTGTCCCATCAGGTCAACTGAGGATTTCAACAAGCTGTGCTCTGTCCCTCTGGTAATTCCCGG
G
AGACCAGAATATCCTCCCCCACCCATTGGCCCCCTTCCTCCAGTTCAGCCCGTTCCTCCTGGCTATCCT
CCT
GGGCCTGTGATTCCAGCCCCTCGGCCACCGCCAGAATATCCATATCCATCTCCGTCTCGGGAACCAC
CA
AGGGTGCTGCCTTTCAACGTTACTGACTACTGTCAACTGGTCCGCTATCTCTGTCAAAATGGGCGCTG
C
ATTCCAACTCCCGGTAGCTACCGCTGCGAGTGCAACAAGGGCTTCCAGCTGGATATCCGTGGCGAATGC
ATC
GACGTGGATGAGTGTGAGAAGAACCCATGCACTGGTGGCGAGTGCATCAACAACCAGGGCTCCTACA
CC
TGTCACTGCAGAGCTGGCTACCAGAGCACACTCACCAGAACTGAGTGCAGAGACATAGATGAGTGTCT
T
CAGAATGGCCGGATCTGCAACAATGGTCGCTGTATCAACACAGACGGCAGCTTCCACTGCGTATGCAAT
GCG
GGCTTTCATGTCACGCGGGACGGAAAGAACTGTGAAGATATGGATGAGTGCAGCATCCGAAACATGT
GC
CTAAACGGAATGTGTATTAATGAAGATGGCAGTTTCAAGTGTATTTGCAAACCTGGGTTCCAACTGGC
A
TCAGATGGCCGCTACTGCAAAGATATCAATGAGTGTGAGACACCTGGGATCTGCATGAACGGACGCTGT
GTG
AACACGGATGGCTCCTACAGATGCGAATGCTTCCCCGGATTGGCTGTGGGTCTAGACGGACGTGTGT
GT
GTTGACACACACATGCGGAGCACATGCTATGGAGGATACAGGAGAGGCCAGTGCGTGAAGCCGTTGTT
T
GGTGCTGTTACCAAATCGGAATGCTGTTGTGCCAGCACTGAGTATGCCTTTGGGGAACCCTGCCAGCCG
TGT
CCTGCACAGAATTCAGCGGAATATCAGGCACTCTGCAGCAGTGGACCGGGAATGACATCAGCAGGCA
CT
GATATAAACGAATGTGCATTAGATCCTGATATTTGCCCAAATGGAATTTGTGAAAATCTCCGTGGGAC
C
TACAAATGTATATGCAACTCGGGATATGAAGTAGACATAACTGGGAAAAACTGTGTCGATATTAATGAG
TGT
GTGCTGAACAGTCTACTTTGTGACAATGGACAATGTCGAAACACACCTGGAAGTTTTGTCTGCACCT
GC
CCCAAAGGATTTGTGTACAAACCTGACCTAAAAACCTGTGAAGACATTGATGAATGTGAATCGAGTCC
T
TGCATTAATGGAGTCTGCAAGAACAGCCCTGGCTCCTTCATTTGTGAATGTTCTCCTGAAAGTACTCTG
GAC
CCAACAAAAACCATCTGCATAGAAACCATCAAGGGCACTTGCTGGCAGACTGTCATCGACGGGCGCT
GT
GAGATCAACATCAACGGAGCCACCTTGAAGTCCGAGTGCTGCTCCTCCCTTGGTGCTGCGTGGGGGAG
C
CCGTGCACCATCTGTCAACTTGATCCCATTTGTGGTAAAGGGTTCTCAAGAATTAAAGGCACGCAATGT
GAA
GATATCAATGAGTGTGAAGTGTTCCCGGGAGTATGCAAGAACGGCCTGTGTGTCAACTCCAGGGGTT
CA
TTCAAGTGCGAGTGTCCCAATGGAATGACTTTGGATGCTACAGGAAGAATCTGTCTTGACATCCGCCT
G
GAGACCTGCTTCCTCAAGTATGACGATGAAGAGTGCACCTTGCCCATCGCTGGCCGCCACCGAATGGAT
GCC
TGCTGCTGCTCTGTTGGGGCAGCCTGGGGAACGGAAGAGTGTGAGGAGTGTCCATTGAGAAACAGCC
GG
GAGTATGAGGAACTCTGTCCCCGAGGACCTGGGTTTGCCACAAAAGACATTACAAATGGGAAACCTTT
C
TTCAAAGATATCAATGAGTGCAAGATGATACCCAGCCTCTGTACCCACGGCAAGTGCAGGAACACCATT
GGC
AGCTTCAAGTGTAGGTGTGACAGTGGCTTTGCTCTGGATTCTGAAGAGAGGAACTGTACAGACATTG
AT
GAGTGCCGCATATCTCCTGACCTCTGTGGCCGAGGCCAGTGTGTGAACACCCCGGGGGACTTTGAATG
C
AAGTGTGATGAAGGCTATGAAAGTGGCTTCATGATGATGAAGAACTGCATGGATATTGATGAATGTCAG
AGA
GATCCTCTCCTGTGTCGAGGAGGCATTTGCCACAACACAGAGGGAAGCTATCGCTGCGAATGTCCTC
CT
GGTCACCAATTGTCCCCAAACATCTCTGCATGCATTGACATCAACGAGTGTGAGCTGAGTGCGAATCT
C
TGTCCCCATGGGCGTTGTGTGAACCTCATAGGGAAGTACCAGTGTGCCTGCAACCCTGGCTACCACCCC
ACT
CATGACAGGCTCTTCTGTGTCGATATTGATGAATGCAGCATAATGAACGGTGGTTGTGAGACCTTCT
GC
ACAAACTCTGACGGGAGCTATGAATGTAGCTGTCAGCCAGGCTTCGCGCTAATGCCAGACCAGCGATC
G
TGCACAGACATTGATGAGTGTGAAGACAACCCCAATATCTGTGATGGTGGCCAGTGCACAAACATACCT
GGG
GAGTACAGGTGCCTGTGCTATGATGGGTTCATGGCATCTGAAGACATGAAGACTTGTGTGGATGTCA
AT
GAGTGTGACCTGAATCCAAACATCTGCCTTAGTGGGACCTGTGAAAATACTAAAGGCTCGTTCATCTG
C
CACTGTGATATGGGATATTCAGGGAAGAAAGGAAAAACGGGCTGTACAGATATCAATGAATGTGAGATC
GGA
GCACACAACTGTGGCAGACATGCTGTATGCACAAATACAGCCGGGAGCTTCAAGTGCAGCTGCAGTC
CC
GGCTGGATTGGAGACGGCATTAAGTGCACAGATCTGGATGAATGCTCTAATGGAACCCACATGTGCAG
C
CAACACGCGGACTGCAAGAACACCATGGGGTCATATCGCTGTCTCTGTAAGGATGGCTATACAGGGGAT
GGC
TTCACCTGTACAGACCTCGACGAGTGCTCCGAGAACCTGAACCTCTGTGGCAATGGCCAGTGCCTCA
AC
GCCCCTGGCGGGTACCGCTGTGAATGCGACATGGGCTTCGTGCCCAGTGCTGACGGGAAGGCCTGTGA
A
GATATCGATGAGTGCTCCCTTCCAAACATCTGTGTCTTTGGAACTTGCCACAACCTCCCGGGCCTCTTC
CGT
TGCGAGTGTGAGATTGGCTATGAACTGGACCGAAGTGGTGGAAACTGCACAGATGTTAATGAGTGTC
TG
GATCCCACCACCTGCATCAGTGGAAACTGTGTCAACACTCCCGGTAGTTACACATGCGATTGTCCTCC
G
GATTTTGAGCTGAATCCAACTCGTGTCGGCTGTGTCGATACTCGCTCTGGAAACTGCTATCTGGATATC
CGA
CCCCGGGGAGACAATGGAGATACAGCCTGCAGCAATGAAATTGGAGTTGGTGTCTCTAAGGCTTCCT
GC
TGTTGTTCACTGGGTAAAGCTTGGGGAACCCCATGTGAGCTGTGTCCTTCTGTGAACACATCTGAGTA
T
AAAATTCTTTGCCCTGGAGGAGAAGGTTTTCGTCCAAATCCCATCACCGTTATATTGGAAGACATCGAT
GAG
TGCCAGGAGCTTCCAGGGCTGTGCCAAGGGGGGAAGTGCATCAATACCTTTGGCAGCTTCCAGTGTC
GC
TGTCCAACTGGTTACTACCTGAATGAAGACACTCGAGTGTGTGATGATGTGAACGAATGTGAGACTCC
T
GGAATCTGTGGTCCGGGGACCTGTTACAACACCGTTGGCAACTATACCTGCATTTGTCCTCCAGACTAC
ATG
CAAGTGAACGGGGGAAATAATTGCATGGACATGAGAAGAAGTCTATGCTACAGAAACTATTACGCTG
AC
AACCAGACCTGCGATGGAGAACTCCTGTTCAACATGACCAAGAAGATGTGCTGTTGCTCCTACAACAT
C
GGCAGAGCCTGGAACAAACCCTGTGAACAGTGCCCCATCCCAAGCACAGATGAGTTTGCTACCCTCTGT
GGG
AGCCAGAGGCCCGGCTTCGTGATTGACATTTATACGGGTTTACCCGTGGATATTGATGAATGCCGGG
AG
ATCCCTGGGGTCTGTGAAAATGGAGTGTGCATCAACATGGTTGGCAGCTTCCGGTGTGAGTGTCCCGT
G
GGATTCTTCTATAACGACAAGTTACTGGTTTGTGAAGATATCGACGAGTGTCAGAATGGCCCTGTGTGC
CAG
CGAAATGCGGAATGCATCAACACTGCAGGCAGCTACCGCTGTGACTGTAAGCCCGGCTACCGCCTTA
CC
TCCACAGGTCAATGCAACGATCGAAACGAGTGCCAAGAAATCCCGAACATATGCAGTCATGGCCAGTG
C
ATCGACACCGTGGGAAGCTTCTACTGCCTTTGTCACACTGGCTTCAAAACAAATGTGGATCAGACCATG
TGC
TTAGACATAAATGAGTGTGAGAGAGACGCCTGTGGGAACGGGACTTGCAGAAACACGATTGGCTCCT
TC
AACTGTCGCTGTAACCATGGCTTCATACTGTCTCACAACAATGACTGCATAGATGTTGATGAGTGTGC
A
ACTGGAAACGGGAACCTTTGCAGAAATGGCCAGTGTGTCAATACCGTGGGCTCCTTTCAGTGCAGGTGC
AAT
GAAGGCTATGAGGTGGCTCCGGACGGCAGGACCTGTGTGGATATCAACGAGTGTGTTCTGGATCCTG
GG
AAATGTGCACCTGGAACCTGTCAGAACCTGGATGGCTCCTACAGATGCATTTGCCCGCCTGGGTATAG
T
CTACAGAATGACAAGTGTGAAGATATTGATGAGTGTGTTGAAGAGCCAGAAATCTGTGCCTTGGGGACC
TGC
AGCAACACTGAGGGTAGCTTCAAATGTCTGTGTCCAGAGGGGTTCTCCCTGTCCTCCACTGGAAGAA
GG
TGCCAAGATTTGCGAATGAGCTACTGCTATGCGAAGTTTGAAGGTGGGAAGTGTTCATCACCCAAATC
C
AGAAACCATTCCAAGCAGGAGTGCTGCTGTGCTTTGAAGGGAGAAGGCTGGGGAGATCCTTGTGAGTTG
TGC
CCCACTGAGCCAGATGAGGCTTTCCGCCAGATCTGCCCCTTTGGAAGTGGGATCATTGTGGGCCCTG
AT
GACTCAGCAGTTGATATGGACGAATGCAAAGAACCTGATGTCTGTAGACATGGGCAGTGCATTAACAC
A
GACGGCTCCTATCGATGCGAGTGTCCTTTTGGTTATATTCTGGAAGGGAATGAGTGTGTGGATACCGAT
GAA
TGCTCTGTGGGCAATCCTTGTGGAAATGGGACCTGCAAGAATGTGATTGGAGGTTTTGAATGTACCT
GT
GAGGAGGGGTTCGAGCCTGGCCCAATGATGACTTGTGAAGATATAAATGAATGTGCCCAGAATCCTCT
G
CTCTGCGCCTTCCGCTGTGTAAATACCTACGGGTCCTATGAATGCAAATGCCCTGTTGGATACGTTCTC
CGA
GAAGACAGGAGGATGTGTAAAGATGAGGATGAGTGTGCAGAGGGAAAACACGACTGTACTGAGAAGC
AA
ATGGAGTGTAAGAACCTCATTGGTACCTACATGTGCATCTGCGGCCCTGGGTACCAGCGCAGACCCGA
T
GGAGAGGGCTGCATAGATGAGAATGAGTGTCAGACCAAGCCCGGGATCTGTGAGAATGGGCGTTGCCTC
AAC
ACCCTGGGTAGCTACACTTGTGAGTGTAACGATGGCTTCACAGCCAGCCCCACTCAGGATGAGTGCT
TG
GACAACCGGGAAGGGTACTGCTTTTCGGAGGTCTTGCAAAACATGTGCCAGATTGGCTCAAGCAACAG
G
AACCCCGTCACCAAGTCCGAGTGCTGCTGTGATGGAGGGAGAGGCTGGGGACCCCACTGTGAGATCTGC
CCT
TTCGAGGGCACAGTGGCTTACAAGAAGCTCTGTCCCCACGGCCGAGGATTCATGACCAACGGAGCAG
AT
ATTGATGAGTGCAAGGTTATTCATGATGTTTGCCGAAATGGGGAGTGTGTCAACGACAGAGGGTCCTA
T
CACTGCATCTGTAAAACTGGCTACACTCCGGATATAACAGGGACCGCCTGTGTAGATCTGAATGAATGC
AAC
CAGGCTCCCAAACCCTGCAATTTTATATGCAAAAACACAGAAGGGAGTTACCAGTGTTCCTGCCCGA
AG
GGCTACATTCTGCAAGAGGATGGAAGGAGCTGCAAAGATCTTGACGAGTGTGCAACCAAGCAGCATAA
C
TGTCAGTTCCTGTGTGTTAACACCATCGGTGGCTTCACATGCAAATGCCCTCCTGGGTTTACCCAGCAT
CAC
ACTGCCTGCATTGATAACAATGAGTGCACGTCTGATATCAACCTGTGTGGGTCCAAGGGTGTTTGCC
AG
AACACTCCAGGAAGCTTCACCTGTGAATGCCAACGGGGGTTCTCACTCGATCAGAGTGGTGCCAGCTG
T
GAAGATGTGGACGAGTGTGAGGGTAACCACCGCTGTCAACATGGCTGCCAGAACATCATCGGAGGCTAT
AGG
TGTAGCTGCCCCCAGGGCTACCTCCAGCACTACCAATGGAACCAGTGTGTAGATGAAAACGAGTGCC
TG
AGTGCACATGTCTGTGGAGGAGCCTCCTGCCACAACACCCTGGGGAGTTACAAGTGCATGTGTCCCAC
C
GGCTTCCAGTACGAACAGTTCAGTGGAGGCTGCCAAGACATCAATGAGTGTGGCTCATCCCAGGCCCCC
TGC
AGTTACGGTTGCTCTAATACTGAGGGTGGCTACCTGTGTGGCTGTCCACCAGGATACTTCCGGATAG
GC
CAAGGGCATTGTGTTTCTGGAATGGGCATGGGCCGAGGCGGCCCAGAGCCACCTGCCAGCAGCGAGAT
G
GACGACAACTCACTGTCCCCAGAGGCCTGCTATGAGTGTAAGATCAACGGCTACCCAAAACGAGGCCGG
AAA
CGGAGAAGCACGAACGAAACGGATGCCTCCGACATCCAGGACGGGTCTGAGATGGAAGCCAACGTGA
GC
CTCGCCAGCTGGGATGTGGAGAAGCCGGCTAGCTTTGCTTTCAATATTTCCCATGTCAATAACAAGGT
C
CGAATCCTAGAGCTCCTGCCGGCCCTCACAACTCTGATGAACCACAACAGATACTTGATTGAATCTGGA
AAT
GAAGATGGCTTCTTTAAAATCAACCAGAAAGAAGGGGTCAGCTACCTCCACTTCACGAAGAAGAAGC
CG
GTGGCTGGGACCTACTCCTTACAAATCAGCAGCACCCCACTTTATAAAAAGAAAGAACTTAACCAGTT
A
GAAGACAGATATGACAAAGACTACCTCAGTGGTGAACTGGGCGATAACCTGAAGATGAAAATTCAGATC
TTG
CTGCATTAA


Translation (2873 aa):
MRRGGLLEVALAFALLLESYTSHGADANLEAGSLKETRANRAKRRGGGGHDALKGPNVCGSRYNAYCCPG
W
KTLPGGNQCIV
PICRHSCGDGFCSRPNMCTCPSGQISPSCGSRSIQHCSIRCMNGGSCSDDHCLCQKGY
I
GTHCGQ
PVCESGCLNGGRCVAPNRCACTYGFTGPQCERDYRTGPCFTVVSNQMCQGQLSGIVCTKTLCC
A
TVGRAWGHPCEMCPAQPHPCRRGFIPNIRTGACQ
DVDECQAIPGMCQGGNCINTVGSFECKCPAGHKFN
E
VSQKCE
DIDECSTIPGVCDGGECTNTVSSYFCKCPPGFYTSPDGTRCVDVRPGYCYTALANGRCSNQLP
Q
SITKMQCCCDLGRCWSPGVTVAPEMCPIRST
EDFNKLCSVPLVIPGRPEYPPPPIGPLPPVQPVPPGYP
P
GPVIPAPRPPPEYPYPSPSREPP
RVLPFNVTDYCQLVRYLCQNGRCIPTPGSYRCECNKGFQLDIRGEC
I
DVDECEKNPCTGGECINNQGSYTCHCRAGYQSTLTRTECRDIDECLQNGRICNNGRCINTDGSFHCVCN
A
GFHVTRDGKNCE
DMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRC
V
NTDGSYRCECFPGLAVGLDGRVCV
DTHMRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQP
C
PAQNS
AEYQALCSSGPGMTSAGTDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDINE
C
VLNSLLCDNGQCRNTPGSFVCTCPKGFVYKPDLKTCE
DIDECESSPCINGVCKNSPGSFICECSPESTL
D
PTKTICI
ETIKGTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTICQLDPICGKGFSRIKGTQC
E
DINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDATGRICLDIRLETCFLKYDDEECTLPIAGRHRMD
A
CCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKDITNGKPFFK
DINECKMIPSLCTHGKCRNTI
G
SFKCRCDSGFALDSEERNCT
DIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQ
R
DPLLCRGGICHNTEGSYRCECPPGHQLSPNISACI
DINECELSANLCPHGRCVNLIGKYQCACNPGYHP
T
HDRLFCV
DIDECSIMNGGCETFCTNSDGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIP
G
EYRCLCYDGFMASEDMKTCV
DVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEI
G
AHNCGRHAVCTNTAGSFKCSCSPGWIGDGIKCT
DLDECSNGTHMCSQHADCKNTMGSYRCLCKDGYTGD
G
FTCT
DLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGLF
R
CECEIGYELDRSGGNCT
DVNECLDPTTCISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDI
R
PRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCELCPSVNT
SEYKILCPGGEGFRPNPITVILEDID
E
CQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCD
DVNECETPGICGPGTCYNTVGNYTCICPPDY
M
QVNGGNNCM
DMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLC
G
SQRPGFVIDIYTGLPV
DIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNGPVC
Q
RNAECINTAGSYRCDCKPGYRLTSTGQCN
DRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTM
C
L
DINECERDACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCVNTVGSFQCRC
N
EGYEVAPDGRTCV
DINECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGT
C
SNTEGSFKCLCPEGFSLSSTGRRCQ
DLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCEL
C
PTEPD
EAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGYILEGNECVDTD
E
CSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCE
DINECAQNPLLCAFRCVNTYGSYECKCPVGYVL
R
EDRRMCK
DEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPGICENGRCL
N
TLGSYTCECNDGFTASPTQDECL
DNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEIC
P
FEGTVAYKKLCPHGRGFMTNGA
DIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNEC
N
QAPKPCNFICKNTEGSYQCSCPKGYILQEDGRSCK
DLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQH
H
TACI
DNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASCEDVDECEGNHRCQHGCQNIIGGY
R
CSCPQGYLQHYQWNQCV
DENECLSAHVCGGASCHNTLGSYKCMCPTGFQYEQFSGGCQDINECGSSQAP
C
SYGCSNTEGGYLCGCPPGYFRIGQ
GHCVSGMGMGRGGPEPPASSEMDDNSLSPEACYECKINGYPKRGR
K
RRSTNETDASDIQ
DGSEMEANVSLASWDVEKPASFAFNISHVNNKVRILELLPALTTLMNHNRYLIESG
N
EDGFFKINQKEGVSYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDRYDKDYLSGELGDNLKMKIQI
L
LH




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser