NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16621.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16621.1 Public Mus musculus 2 Zfp106 21 106 86 CCDS HistoryNCBI Gene:20402Re-query CCDS DB by CCDS ID:16621.1Re-query CCDS DB by GeneID:20402See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16621.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000055241 ENSMUSP00000055602 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000055241Link to Ensembl Protein Viewer:ENSMUSP00000055602Re-query CCDS DB by Nucleotide ID:ENSMUST00000055241Re-query CCDS DB by Protein ID:ENSMUSP00000055602
Original member Current member EBI,WTSI OTTMUST00000037093 OTTMUSP00000016632 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000037093Link to Vega Protein Viewer:OTTMUSP00000016632Re-query CCDS DB by Nucleotide ID:OTTMUST00000037093Re-query CCDS DB by Protein ID:OTTMUSP00000016632
Original member NCBI NM_011743.2 NP_035873.2 Updated not alive Link to Nucleotide Sequence:NM_011743.2Link to Protein Sequence:NP_035873.2Re-query CCDS DB by Nucleotide ID:NM_011743Re-query CCDS DB by Protein ID:NP_035873
Current member NCBI NM_011743.3 NP_035873.2 Accepted alive Link to Nucleotide Sequence:NM_011743.3Link to Protein Sequence:NP_035873.2Re-query CCDS DB by Nucleotide ID:NM_011743Re-query CCDS DB by Protein ID:NP_035873Link to BLAST:NP_035873.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035873.2 1888 O88466-1 1888 99.1525% 0 16

Chromosomal Locations for CCDS 16621.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 120510086 120510142 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120510487 120510633 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120512703 120512774 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120513617 120513688 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120514143 120514262 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120515442 120515504 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120515914 120516105 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120519065 120519181 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120520411 120520545 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120522685 120522830 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120523521 120523573 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120523865 120524624 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120526749 120527084 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120528337 120528397 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120528475 120528629 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120530448 120530517 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120531595 120532222 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120533511 120535679 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120539295 120539492 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120545843 120545904 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 120555231 120555284 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5667 nt):
ATGGTACGAGAACGAAAATGCATATTGTGCCACATCGTGTATGGCTCAAAAAAGGAGATGGATGAACACA
TG
CGAAGCATGTTGCATCACAGGGAACTTGAGAACCTGAAGGGCAGGGACATTAGTCATGAGTGCCGAGT
G
TGCCGGGTCACAGAAGTGGGTCTCTCTGCATATGCAAAGCACATTTCTGGCCAGTTGCACAAAGATAAT
GTT
GATGCCCAGGAAAGAGAAGATGATGGAAAGGAAGAGGAAGAGGAAGAGTATTTTGATAAGGAACTTG
TT
CAGTTAATACAAGAAAGAAAAGAACAAAGTCGACAAGATGAACCTCCCAGTAACAGCCAAGAAGTAAA
C
TCAGATGACAGGCAGCCCCAGTGGAGACGAGAAGACCGAATCCCTTACCAAGACAGAGAGAGCTATAGT
CAG
CCACCAAGACACCATCGTGGACCCCCACAGAGAGACTGGAAATGGGAAAAGGATGGCTTTAATAGTA
CT
AGAAAAAACAGCTTTCCACATTCTTTGAGGAATAGTGGTGGACCAAGAGGAAGTTCTGTCTGGCATAA
A
GGTGCTACAAGAGGCTCTTCAACTTGGTTCCTTAATCATAGCAATTCTGGAGGAGGCTGGCATTCAAAC
AAT
GGGATGGTAGATTGGAATTATAATGGTACAGGAAGGAATTCCAGTTGGCATTCTGAAGGAACAGGTG
GC
TTTCCCAGCTGGCACATGAACAACAGTAACGGAAACTGGAAATCCAGTGTACGTAGTACGAATAGCTG
G
AATTACAATGGCCCTGGAGACAAATTTCAACAAGGCAGAAACAGAAATCCTAACTATCAAATGGAAGAC
ATG
ACCAAGATGTGGAACAAGAAATCTAATAAGCCAAGCAAGTACAGTCAGGAGAGATGCAAGTGGCAGA
GG
CAAGACAGGGACAAAGCTGCCAAGTACAGGAGTCCTCCTGAGGGATACGCAAGCGATACGTTTCCTTC
A
GAAGGCTTACTTGAGTTCAATTTTGAACAGCGAGAAAGTCAAACCACTAAACAAACAGACACGGCAGCC
TCA
AAAATTAATGGAAAAAATGGCACCAAAGCAAGGGACAAGTTCCGCCGCTGGACACCTTACCCTTCCC
AG
AAGACTCTAGATTTACAGTCAGCCCTGAAAGAAGTCATTGGCAGCAAGTCAGACACACTAGAGAAGCC
T
CTCTTTAATTTTAGCTTAATAACTGCAGGACTGCGCAAACCAGTTGATAAAACAAGTAATCCTCCAGTG
ATA
AAAACACAAAAAGCAGGACCTCCTGGATCTCCCAGTCACAAAGCCATTTCTGATGGCACTGCTTTCT
GT
GAGGTGCCAAGAGCTTGCCCCATTACCGAGCAATCTGAGCCACATCAGAAGTCAAATAAGATTCCATT
A
CTGAAATCCCCACTCCTTCCACTTCCAACCCCTAAATCAGGTCCTCATAAGCAAAATTTAAAGAACCGC
TCA
AAAAATAAGGAGACAAAGTCCTTTCCTTCTGGAGATCACTCACATCTCCTGAACACTTCTACTTTAG
AA
GGTAGCCATGGTTCTTCCTACACATCCAAATCACGCGGTTTATGTCCTCGTGTTTTAAAGGAGAATAA
A
ACTGTATCAGGCACTCAAAAAGAACCTGACGAGAAGTTAAATAGCACATCACAGAAAGCCCAAGACACA
GTG
CTACAGTGTCCCAAAACACTGCAGAATCCACTCCCTACCACACCCAAAAGGACGGAGAACGATGCAA
AA
GAAAGTAGTGTAGAAGAGTCTGCCAAAGACTCTCTGAGCATCGAGTCTCAGCCACACTCAGCTGGAAA
C
AGTGCCATGACATCTGATGCAGAAAACCATGGCATAAAAAGTGAAGGTGTGGCTTCACTGACCACAGAG
GTT
GTGTCCTGCAGCACTCACACCGTGGATAAGGAACAAGGGAGCCAGATCCCAGGAACACCCGAGAACC
TC
TCCGCCTCCCCATGTAATTCCACAGTTCTCCAGAAAGAGGCTGAGGTACAAGTGTCAGCAGCGACCAG
T
CCACACTCTGGCTTACTGCTAAACTTGAAGACCTCTCTAGAAGATGCGCAGGACAACAACCTTGTTAAA
TCT
GATGGACCTTTTGAAACTGAGAGCTTTGAGGACACTAGCCTGGATGCAGAGCTTCAAAAACCTGATC
TC
AATAATCAGCCCCCAGGCACGCTTCTTCCCGAACTAAGTAAACTTGGTTTTCCCGCCTCGCTCCAGAG
A
GATCTAAGCCGACACATCAGTTTGAAGTCCAAAACAGGAACACATCTCCCAGAGCCAAACCTCAATAGC
GCT
CGACGAATTCGCAATGTTAGTGGCCATAGAAAGAATGAAACAGAAAAGGAATCTGGGCTTAAGCCAA
CC
CTACGACAGATTCTAAATGCATCAAGGAGAAATGTCAACTGGGAACAGGTCATTCAGCAAGTAACCAA
G
AAAAAGCAAGAGCTGGGCAAAGGCTTACCCAGGTTTGGCATAGAAATGGTACCTTTGGTTCAAAATGAA
CAG
GAAGTCTTGGATTTAGATGAAGAGCCTGATCTGTCCAGTCTGGAAGGATTCCAGTGGGAAGGAGTTT
CC
ATTCCCTCATCCTCTGGCTTGGCAAGAAAGCGAAGTCTTTCTGAAAGCAGCGTGGTCATGGACAGGGC
T
CCTGTGTATAGCTTCTTTACTGGGGAGGGTACTGGTAAAGAAAATGAAGCCCAGCAGAGTCCTTCACCT
AAT
ACTGCCCTGAGTGCTGCCCAGAGTCAGAAGACAGCCATGTATCTTGAACAGGAAGTGGCCCCTCTGA
CT
CCCTCTGTCGGAACAGGTGAAAGGGTTGGAAACATTCCTACCCAGCGGCGACATAGTGCACAGTTACC
G
TCTGGTCACATAATGCCTGTCATGCATTCAGCCCGAGACCTGCACAGCCAGGAGAGGTCTACCCCACTG
TCA
GAGCGCCATGCCCAGGAGAGCACTGGAGAAGGAAACTCACTCACATCAAATGCATCTTCAGGTCATG
CA
GTCTCCAGCTTAGCAGATGCAGCCACTGACAGCAGCTGTACCTCTGGTGCTGAGCAAACCGATGGTCA
C
AGTATTAGAAAGAAGCGAAGAGCCACCGGGGATGGATCTTCCCCTGAACTACCAAGTCTTGAGAGAAAA
AAT
AAACGAAGGAAAATTAAAGGGAAGAAAGAACGTTCTCAGGTTGACCAGCTATTAACTATTTCCTTAA
GA
GAGGAAGAACTGAGCAAGTCTCTGCAGTGCATGGACAACAAGCTCCTGCAGGCGCGGGCAGCACTGCA
G
ACAGCGTACGTTGAAGTTCAGAGGCTACTCGTGCTTAAGCAGCAGATAACTGTGGAGATGAGTGCACTG
AGG
ACTCACAGAATACAGATTCTACAAGGATTGCAAGAAACATATGAACCTCCTGAGCACCCAGACCAGG
CT
CCCTGTAGCCTCATATCACGAGAACAAAGGAACAGCCGATCTCAGACATCTTTTGAGACAGCTCTGCT
G
CCTGCACCCTTTTTCCCGGGGTTTCTGGATCCACCTCCTTCCCATGCATCTCTACCATCCTCTGGAAAC
CCT
CTCCAAATAACCACGTGTACTTTACAAGCCCATGGCACTGCCCCTGATTCATCGGTTCAGATTAAAC
AA
GAGCCCATGTCTCCTGAACAAGAGGGGAATATGAATGCTTTGCCACAAGGCTGTGCTTCCAATGTGTC
C
AAGGAATTACTGCAAACTAATAGAGTGGTCGATGACGGCTCTTCAGTTTACCCAGCCATCCCTGCAGTG
ATA
GCATCAGAGTCAACAGAGAACTGCCAGGAGGTTAGCAAAGATCTGAATTTTTCTGTGGAGCAAGGAA
AT
TCCAGAAGCAAAGGAAACTCTCCCTCTTGCCAGTCTCCTGATCTTCCTGGCATAAACAGAGGTGAAGA
G
ACAGCCAAAGGCAGCAGTGGATCTGAAGCCTGCAGCAGTTCTTTTCTGAGATTGTCTTTCACTCCCGAA
ACG
CCTGCAGAGAAGGAAACTCAGTCTCCAGCTGACCAGCCTGAGCAGCAGGCAGAATCCACACTGGCAT
CA
GCTGAAACTAGAGGTAGCAAGAAGAAGAAGAAACTTCGGAAGAAGAAGACGCTTCGGGCCACTCATGT
T
CCTGAGAACAGTGACACAGAGCAGGATGTGTTCACGGCTAAGCCTGCAAGGAAGGTCAAAACTGCAAAG
GCA
GCTAAAGGGGCGAAAGTGACAACCAGCCAGACTGGTCAGGAGCAAGGAACTGCCAGAGATGAGCCAG
AC
AGCGATTCTTCTCTGGAAGTCCTGGAAGTCACAAATCCTCAGTTAGAAGTAGTTGCCATTGATACTTC
T
GAATCGGGAGACGAGAAACCTGACAGTCCATCGAAAAAAGATGCCTGGATCGCTGCAGAACAGAACCCC
ATA
GAAACTTCTCGTTCTGGTTGTGATGAGGTTAGCTCTACCAGTGAGCTTGGCACCCGCTACAAGGATG
GT
GTTCCTGTGAGTGTGGCGGAAACCCAGACGGTGATCTCCATCAAAGCATCTAAGCACTCTTCAGAAAT
A
TCTTCAGAGCCGGGAGATGATGAGGAGCCTACAGAAGGAAGCTTCGAAGGACACCAGGCTGCAGTGAAT
GCA
ATTCAGATATTTGGAAACTTCCTGTATACTTGTTCAGCAGACACAACTGTCCGGGTTTATAATCTGG
TG
AGTCGAAAGTGTGTTGGTGTCTTTGAGGGACACACTTCCAAAGTGAACTGCCTTCTTGTCACTCACAC
C
TCTGGGAAGAGTTCTGTCCTCTACACGGGTTCCAGTGACCACACCATCCGCTGCTACAATATTAAGACC
CGA
GAGTGTATGGAACAGTTACAGCTGGAAGACCGTGTCCTCTGCCTTCATAATAGATGGCGAACCCTCT
AT
GCTGGACTAGCAAATGGCACTGTGGTCACATTCGACATAAAGAACAACAAGCGACAGGAGATCTTTGA
A
TGCCATGGCCCTCGGGCAGTCAGCTGCCTCGCAACAGCTCAGGAAGGTGCCCGAAAACTGCTGGTTGTA
GGA
TCTTACGACTGCACCATTAGTGTTCGTGATGCACGGAACGGACTGCTGCTCCGAACCCTGGAGGGCC
AC
AGCAAGACTGTTCTGTGCATGAAGGTAGTGAATGACCTTGTGTTCAGTGGCTCCAGCGACCAGTCGGT
G
CATGCTCACAACATCCATACTGGGGAGCTTGTGCGCATCTATAAAGGCCACAACCATGCAGTCACTGTG
GTG
AATATTCTGGGGAAAGTGATGGTGACTGCTTGCCTGGACAAGTTTGTTCGTGTCTATGAGTTACAGT
CC
CATGATCGACTGCAAGTTTATGGAGGGCACAAAGACATGATTATGTGTATGACCATCCATAAGAGTGT
G
ATTTACACTGGCTGTTATGATGGCAGCATCCAGGCTGTGAGGCTCAATCTGATGCAGAATTACCGCTGT
TGG
TGGTATGGCTGTACTCTGATATTTGGCGTTGTGGATCACTTGAAACAACACTTGCTGACTGACCACA
CC
AATCCCAACTTCCAGACGCTGAAGTGTCGATGGAGGAACTGCGATGCCTTTTTTACAGCCAGGAAAGG
A
TCCAAGCAGGACGTTGCAGGACATATTGAACGCCACGCTGAAGATGACAGCAAAATAGATTCATGA


Translation (1888 aa):
MVRERKCILCHIVYGSKKEMDEHMRSMLHHRELENLKGRDISHECRVCRVTEVGLSAYAKHISGQLHKDN
V
DAQEREDDGKEEEEEEYFDKELVQLIQERKEQS
RQDEPPSNSQEVNSDDRQPQWRREDRIPYQDRESYS
Q
PPRHHRGPPQRDWKWEKDGFNSTRKNSFPHSLRNSGGPRGSSVWHKGATRGSSTWFLNHSNSGGGWHSN
N
GMVDWNYNGTGRNSSWHSEGTGGFPSWHMNNSNGNWKSSVRSTNSWNYNGPGDKFQQGRNRNPNYQMED
M
TKMWNKKSNKPSKYSQERCKWQRQDRDKAAKYRSPPEGYASDTFPSEGLLEFNFEQRESQTTKQTDTAA
S
KINGKNGTKARDKFRRWTPYPSQKTLDLQSALKEVIGSKSDTLEKPLFNFSLITAGLRKPVDKTSNPPV
I
KTQKAGPPGSPSHKAISDGTAFCEVPRACPITEQSEPHQKSNKIPLLKSPLLPLPTPKSGPHKQNLKNR
S
KNKETKSFPSGDHSHLLNTSTLEGSHGSSYTSKSRGLCPRVLKENKTVSGTQKEPDEKLNSTSQKAQDT
V
LQCPKTLQNPLPTTPKRTENDAKESSVEESAKDSLSIESQPHSAGNSAMTSDAENHGIKSEGVASLTTE
V
VSCSTHTVDKEQGSQIPGTPENLSASPCNSTVLQKEAEVQVSAATSPHSGLLLNLKTSLEDAQDNNLVK
S
DGPFETESFEDTSLDAELQKPDLNNQPPGTLLPELSKLGFPASLQRDLSRHISLKSKTGTHLPEPNLNS
A
RRIRNVSGHRKNETEKESGLKPTLRQILNASRRNVNWEQVIQQVTKKKQELGKGLP
RFGIEMVPLVQNE
Q
EVLDLDEEPDLSSLEGFQWEGVSIPSSSGLARKRSLSESSVVMDRAPVYSFFTGEGTGKENEAQQSPSP
N
TALSAAQSQKTAMYLEQEVAPLTPSVGTGERVGNIPTQRRHSAQLPSGHIMPVMHSARDLHSQERSTPL
S
ERHAQESTGEGNSLTSNASSGHAVSSLADAATDSSCTSGAEQTDGHSIRKKRRATG
DGSSPELPSLERK
N
KRRKIKGKK
ERSQVDQLLTISLREEELSKSLQCMDNKLLQARAALQTAYVEVQRLLVLKQQITVEMSAL
R
THRIQILQGLQ
ETYEPPEHPDQAPCSLISREQRNSRSQTSFETALLPAPFFPGFLDPPPSHASLPSSGN
P
LQITTCTLQAHGTAPDSSVQIKQEPMSPEQEGNMNALPQGCASNVSKELLQTN
RVVDDGSSVYPAIPAV
I
ASESTENCQEVSKDLNFSVEQGNSRSKGNSPSCQSPDLPGINRGEETAKGSSGSEACSSSFLRLSFTPE
T
PAEKETQSPADQPEQQAESTLASAETRGSKKKKKLRKKKTLRATHVPENSDTEQDVFTAKPARKVKTAK
A
AKGAKVTTSQTGQEQGTARDEPDSDSSLEVLEVTNPQLEVVAIDTSESGDEKPDSPSKKDAWIAAEQNP
I
ETSRSGCDEVSSTSELGTRYKDGVPV
SVAETQTVISIKASKHSSEISSEPGDDEEPTEGSFEGHQAAVN
A
IQIFGNFLYTCSADTTVRVYNLV
SRKCVGVFEGHTSKVNCLLVTHTSGKSSVLYTGSSDHTIRCYNIKT
R
ECMEQLQLEDRVLCLHNRWRTLYAGLANGTVVTFDIK
NNKRQEIFECHGPRAVSCLATAQEGARKLLVV
G
SYDCTISVRDARNGLLLRTLEGHSKTVLCMK
VVNDLVFSGSSDQSVHAHNIHTGELVRIYKGHNHAVTV
V
NILGKVMVTACLDKFVRVYELQ
SHDRLQVYGGHKDMIMCMTIHKSVIYTGCYDGSIQAVRLNLMQNYRC
W
WYGCTLIFGVVDHLKQHLLTDHTNPNFQTLKCRWRNCDAFFTARKGSKQDVAGHIERHAEDDSKIDS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser