NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16478.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16478.1 Public Mus musculus 2 Cat 21 106 86 CCDS HistoryNCBI Gene:12359Re-query CCDS DB by CCDS ID:16478.1Re-query CCDS DB by GeneID:12359See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16478.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000028610 ENSMUSP00000028610 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028610Link to Ensembl Protein Viewer:ENSMUSP00000028610Re-query CCDS DB by Nucleotide ID:ENSMUST00000028610Re-query CCDS DB by Protein ID:ENSMUSP00000028610
Original member Current member EBI,WTSI OTTMUST00000035344 OTTMUSP00000015802 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000035344Link to Vega Protein Viewer:OTTMUSP00000015802Re-query CCDS DB by Nucleotide ID:OTTMUST00000035344Re-query CCDS DB by Protein ID:OTTMUSP00000015802
Original member Current member NCBI NM_009804.2 NP_033934.2 Accepted alive Link to Nucleotide Sequence:NM_009804.2Link to Protein Sequence:NP_033934.2Re-query CCDS DB by Nucleotide ID:NM_009804Re-query CCDS DB by Protein ID:NP_033934Link to BLink:NP_033934.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033934.2 527 P24270 527 100% 0 0

Chromosomal Locations for CCDS 16478.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 103454756 103454821 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 103455078 103455161 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 103456850 103456957 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 103460242 103460372 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 103463287 103463425 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 103467077 103467229 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 103467694 103467885 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 103470299 103470424 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 103471766 103471870 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 103472951 103473081 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 103474330 103474440 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 103476749 103476920 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 103484973 103485038 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1584 nt):
ATGTCGGACAGTCGGGACCCAGCCAGCGACCAGATGAAGCAGTGGAAGGAGCAGCGGGCCTCGCAGAGAC
CT
GATGTCCTGACCACCGGAGGCGGGAACCCAATAGGAGATAAACTTAATATCATGACCGCGGGGTCCCG
A
GGGCCCCTCCTCGTTCAGGATGTGGTTTTCACTGACGAGATGGCACACTTTGACAGAGAGCGGATTCCT
GAG
AGAGTGGTACACGCAAAAGGAGCAGGTGCTTTTGGATACTTTGAGGTCACCCACGATATCACCAGAT
AC
TCCAAGGCAAAGGTGTTTGAGCATATTGGAAAGAGGACCCCTATTGCCGTTCGATTCTCCACAGTCAC
T
GGAGAGTCAGGCTCAGCTGACACAGTTCGTGACCCTCGGGGGTTTGCAGTGAAATTTTACACTGAAGAT
GGT
AACTGGGATCTTGTGGGAAACAACACCCCTATTTTCTTCATCAGGGATGCCATATTGTTTCCATCCT
TT
ATCCATAGCCAGAAGAGAAACCCACAGACTCACCTGAAGGATCCTGACATGGTCTGGGACTTCTGGAG
T
CTTCGTCCCGAGTCTCTCCATCAGGTTTCTTTCTTGTTCAGTGACCGAGGGATTCCCGATGGTCACCGG
CAC
ATGAATGGCTATGGATCACACACCTTCAAGTTGGTTAATGCAGATGGAGAGGCAGTCTATTGCAAGT
TC
CATTACAAGACCGACCAGGGCATCAAAAACTTGCCTGTTGGAGAGGCAGGAAGGCTTGCTCAGGAAGA
T
CCGGATTATGGCCTCCGAGATCTTTTCAATGCCATCGCCAATGGCAATTACCCGTCCTGGACGTTTTAC
ATC
CAGGTCATGACTTTTAAGGAGGCAGAAACTTTCCCATTTAATCCATTTGATCTGACCAAGGTTTGGC
CT
CACAAGGACTACCCTCTTATACCAGTTGGCAAACTGGTTTTAAACAAAAATCCAGTTAATTACTTTGC
T
GAAGTTGAACAGATGGCTTTTGACCCAAGCAATATGCCCCCTGGCATCGAGCCCAGCCCTGACAAAATG
CTT
CAGGGCCGCCTTTTTGCCTACCCGGACACTCACCGCCACCGCCTGGGACCCAACTATCTGCAGATAC
CT
GTGAACTGTCCCTACCGCGCTCGAGTGGCCAACTACCAGCGTGATGGCCCCATGTGCATGCATGACAA
C
CAGGGTGGTGCCCCCAACTATTACCCCAACAGCTTCAGCGCACCAGAGCAGCAGCGCTCAGCCCTGGAG
CAC
AGCGTCCAGTGCGCTGTAGATGTGAAACGCTTCAACAGTGCTAATGAAGACAATGTCACTCAGGTGC
GG
ACATTCTACACAAAGGTGTTGAACGAGGAGGAGAGGAAACGCCTGTGTGAGAACATTGCCGGCCACCT
G
AAGGACGCTCAGCTTTTCATTCAGAAGAAAGCGGTCAAGAATTTCACTGACGTCCACCCTGACTATGGG
GCC
CGCATCCAGGCTCTTCTGGACAAGTACAACGCTGAGAAGCCTAAGAACGCAATTCACACCTACACGC
AG
GCCGGCTCTCACATGGCTGCGAAGGGAAAAGCTAACCTGTAA


Translation (527 aa):
MSDSRDPASDQMKQWKEQRASQRPDVLTTGGGNPIGDKLNIMTAGSRGPLLVQDVVFTDEMAHFDRERIP
E
RVVHAKGA
GAFGYFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVTGESGSADTVRDPRGFAVKFYTED
G
NWDLVGNNTPIFFIRDAIL
FPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHR
H
MNGYGSHTFKLVNADGEAVYCKFHYK
TDQGIKNLPVGEAGRLAQEDPDYGLRDLFNAIANGNYPSWTFY
I
QVMTFKEAETFPFNPFDLTK
VWPHKDYPLIPVGKLVLNKNPVNYFAEVEQMAFDPSNMPPGIEPSPDKM
L
Q
GRLFAYPDTHRHRLGPNYLQIPVNCPYRARVANYQRDGPMCMHDNQGGAPNYYPNSFSAPEQQRSALE
H
SVQCAVDVKRFNSANEDNVTQ
VRTFYTKVLNEEERKRLCENIAGHLKDAQLFIQKKAVKNFTDVHPDYG
A
RIQALLDKYNAEKPK
NAIHTYTQAGSHMAAKGKANL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser