NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16113.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16113.1 Public Mus musculus 2 Slc25a12 21 106 86 CCDS HistoryNCBI Gene:78830Re-query CCDS DB by CCDS ID:16113.1Re-query CCDS DB by GeneID:78830See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 16113.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000151937 ENSMUSP00000122103 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000151937Link to Ensembl Protein Viewer:ENSMUSP00000122103Re-query CCDS DB by Nucleotide ID:ENSMUST00000151937Re-query CCDS DB by Protein ID:ENSMUSP00000122103
Original member Current member EBI,WTSI OTTMUST00000031854 OTTMUSP00000014191 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000031854Link to Vega Protein Viewer:OTTMUSP00000014191Re-query CCDS DB by Nucleotide ID:OTTMUST00000031854Re-query CCDS DB by Protein ID:OTTMUSP00000014191
Original member Current member NCBI NM_172436.3 NP_766024.1 Accepted alive Link to Nucleotide Sequence:NM_172436.3Link to Protein Sequence:NP_766024.1Re-query CCDS DB by Nucleotide ID:NM_172436Re-query CCDS DB by Protein ID:NP_766024Link to BLink:NP_766024.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_766024.1 677 Q8BH59 677 100% 0 0

Chromosomal Locations for CCDS 16113.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 71275155 71275353 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71276432 71276522 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71276641 71276799 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71279516 71279654 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71282470 71282610 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71293360 71293440 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71293672 71293724 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71296665 71296823 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71298570 71298651 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71308056 71308140 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71311463 71311556 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71312425 71312563 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71314983 71315129 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71323976 71324115 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71333605 71333720 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71343890 71344032 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71366527 71366580 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 71367513 71367524 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2034 nt):
ATGGCGGTCAAGGTGCATACAACCAAACGAGGTGATCCTCATGAGCTGAGAAACATATTCCTCCAGTATG
CC
AGCACTGAGGTGGACGGGGAGCATTACATGACTCCAGAAGACTTCGTTCAACGCTATCTTGGCCTGTA
C
AACGATCCAAACAGCAACCCAAAGATTGTGCAGCTCTTGGCAGGAGTAGCTGATCAAACCAAGGATGGG
TTG
ATCTCCTATCAAGAGTTTTTGGCATTTGAATCTGTTCTATGTGCTCCAGATTCCATGTTCATAGTGG
CT
TTCCAACTGTTTGACAAGAGCGGAAATGGAGAGGTGACATTTGAAAATGTCAAGGAGATTTTTGGGCA
G
ACTATTATCCATCACCACATCCCTTTTAACTGGGACTGCGAGTTCATCCGGCTGCACTTTGGGCACAAC
CGC
AAGAAGCACCTGAACTATGTGGAATTCACTCAGTTCCTCCAGGAATTGCAATTGGAACACGCAAGGC
AA
GCCTTTGCACTGAAAGACAAGAGCAAAAGCGGCATGATCTCGGGTCTGGATTTCAGTGACGTCATGGT
C
ACCATCCGGTCCCACATGCTCACTCCTTTTGTGGAGGAGAACCTGGTCTCAGCTGCCGGAGGGGGTACC
TCA
CACCAAGTTAGCTTCTCCTACTTCAACGCATTTAACTCCTTACTCAACAACATGGAGCTTGTTCGAA
AG
ATCTATAGCACTTTAGCAGGCACGAGGAAAGATATTGAAGTCACCAAGGAGGAATTTGCCCAGAGCGC
C
ATACGCTATGGACAGGTCACTCCACTAGAAATTGATATCTTGTACCAGCTTGCAGACCTATATAATGCC
TCA
GGGCGCTTGACTCTGGCAGACATCGAGAGAATAGCTCCGCTGGCCGAGGGGGCCTTACCTTACAACC
TG
GCAGAGCTTCAGAGGCAGCAATCTCCTGGCTTGGGCAGACCTATCTGGCTCCAGATTGCCGAGTCTGC
A
TACAGGTTCACTCTGGGCTCAGTTGCTGGAGCTGTGGGGGCCACTGCGGTGTACCCCATAGACCTGGTG
AAG
ACCCGGATGCAAAACCAGCGTGGTACGGGCTCTGTGGTCGGGGAGCTGATGTATAAAAACAGCTTCG
AC
TGTTTTAAGAAAGTGTTGCGCTACGAGGGTTTCTTTGGACTGTACCGAGGTCTGATCCCACAGCTGAT
A
GGGGTTGCACCAGAAAAAGCCATTAAGCTAACAGTTAATGATTTTGTCCGGGACAAATTTACCAAAAGA
GAT
GGCTCTATCCCACTGCCGGCGGAAATCCTTGCTGGAGGTTGCGCTGGAGGCTCGCAGGTCATCTTTA
CC
AACCCTCTGGAGATAGTGAAGATCCGCCTGCAGGTAGCCGGAGAGATCACCACAGGACCGAGAGTCAG
T
GCTCTGAATGTGCTTCAGGACCTGGGACTTTTCGGGCTGTACAAGGGTGCCAAAGCCTGTTTCCTCCGA
GAC
ATTCCCTTCTCCGCAATCTATTTTCCCGTGTACGCTCACTGCAAACTCCTCCTGGCTGATGAGAACG
GA
CGCGTGGGAGGCATCAATCTCCTGACAGCGGGAGCCTTGGCAGGCGTACCTGCTGCTTCTCTGGTGAC
C
CCTGCTGATGTCATCAAGACAAGACTGCAAGTGGCCGCCAGGGCCGGCCAGACAACATACAGCGGGGTC
GTC
GACTGTTTCCGAAAGATTCTCCGGGAAGAAGGGCCCTCGGCATTTTGGAAAGGGACTGCAGCTCGGG
TG
TTTCGATCCTCACCTCAGTTTGGTGTCACTCTGGTTACCTACGAGCTTCTGCAGCGGTGGTTTTACAT
A
GATTTTGGAGGCCTCAAACCTTCTGGCTCAGAACCAACGCCAAAGTCCCGCATCGCAGACCTCCCTCCT
GCC
AACCCCGATCACATCGGTGGCTACAGACTTGCCACGGCCACTTTCGCTGGCATTGAAAACAAGTTTG
GC
CTTTACCTCCCCAAGTTTAAGTCTCCTAGCGTAGCTGTGGCTCAGCCCAAGGCGGCAGCAGCAGCCCA
A
TGA


Translation (677 aa):
MAVKVHTTKRGDPHELRNIFLQYASTEVDGEHYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVADQTKDG
L
ISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTF
ENVKEIFGQTIIHHHIPFNWDCEFIRLHFGHN
R
KKHLNYVEFTQFLQ
ELQLEHARQAFALKDKSKSGMISGLDFSDVMVTIRSHMLTPFVEENLVSAAGGGT
S
HQVSFSYFNAFNSLLNNMELVRKIYSTLAGTRKDIEVTK
EEFAQSAIRYGQVTPLEIDILYQLADLYNA
S
GRLTLADIERIAPLAEGALPYNLAELQRQQSPGLGRPIWLQIAESAYRFTLGSVAGAVGATAVYPIDLV
K
TRMQNQRGTGSVVGELMYKNSFDCFKKVLRYEGFFGLYR
GLIPQLIGVAPEKAIKLTVNDFVRDKFTKR
D
GSIPLPAEILAGGC
AGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVLQDLGLFGLYKGAKACFLR
D
IPFSAIYFPVYAHCKLLLADENGRVGGINLLTAGALA
GVPAASLVTPADVIKTRLQVAARAGQTTYSGV
V
DCFRKILREEGPSAFWKGTA
ARVFRSSPQFGVTLVTYELLQRWFYIDFGGLKPSGSEPTPKSRIADLPP
A
NPDHIGGYRLATATFAGIENKFGLYLPKFKSPSVAVAQPKAAAAAQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser