NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15933.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15933.1 Public Mus musculus 2 Stxbp1 21 106 86 CCDS HistoryNCBI Gene:20910Re-query CCDS DB by CCDS ID:15933.1Re-query CCDS DB by GeneID:20910See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15933.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000050000 ENSMUSP00000052440 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000050000Link to Ensembl Protein Viewer:ENSMUSP00000052440Re-query CCDS DB by Nucleotide ID:ENSMUST00000050000Re-query CCDS DB by Protein ID:ENSMUSP00000052440
Original member Current member EBI,WTSI OTTMUST00000029781 OTTMUSP00000013393 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000029781Link to Vega Protein Viewer:OTTMUSP00000013393Re-query CCDS DB by Nucleotide ID:OTTMUST00000029781Re-query CCDS DB by Protein ID:OTTMUSP00000013393
Original member Current member NCBI NM_009295.2 NP_033321.2 Accepted alive Link to Nucleotide Sequence:NM_009295.2Link to Protein Sequence:NP_033321.2Re-query CCDS DB by Nucleotide ID:NM_009295Re-query CCDS DB by Protein ID:NP_033321Link to BLAST:NP_033321.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033321.2 594 O08599-1 594 100% 0 0

Chromosomal Locations for CCDS 15933.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 32789555 32789637 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32796016 32796170 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32798105 32798190 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32800580 32800681 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32801820 32801929 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32802754 32802892 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32806069 32806149 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32806721 32806786 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32808002 32808062 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32809101 32809208 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32811105 32811235 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32812021 32812105 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32814879 32815027 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32817286 32817389 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32818427 32818505 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32819834 32819910 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32821835 32821916 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32823536 32823585 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32847055 32847091 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1785 nt):
ATGGCCCCCATTGGCCTCAAGGCGGTGGTCGGAGAGAAGATCATGCATGATGTGATCAAGAAGGTGAAGA
AG
AAGGGCGAGTGGAAGGTGCTGGTGGTGGACCAGTTAAGCATGAGGATGCTGTCCTCCTGCTGCAAGAT
G
ACAGACATCATGACCGAGGGCATCACAATTGTGGAGGATATCAACAAGCGCCGAGAGCCACTCCCCAGC
CTG
GAGGCCGTGTACCTCATCACCCCATCTGAGAAGTCTGTCCACTCTCTGATCAGTGATTTTAAGGACC
CG
CCGACTGCTAAATATCGGGCTGCGCATGTGTTCTTCACAGACTCGTGTCCAGATGCCCTATTTAACGA
G
CTGGTAAAATCCCGAGCAGCCAAAGTCATCAAGACGCTGACGGAAATCAACATTGCGTTTCTCCCCTAT
GAG
TCCCAGGTGTATTCCCTGGACTCCGCTGACTCTTTCCAAAGCTTCTACAGCCCTCACAAGGCGCAGA
TG
AAGAATCCGATACTGGAACGCCTGGCAGAGCAGATCGCAACCCTGTGTGCCACCCTGAAGGAGTATCC
A
GCTGTGCGGTATCGGGGGGAGTACAAGGACAATGCCTTGCTGGCTCAGCTGATCCAGGACAAGCTGGAT
GCC
TATAAAGCCGACGATCCAACAATGGGGGAGGGTCCCGACAAGGCACGGTCCCAGCTCCTGATCCTGG
AT
CGTGGCTTTGACCCCAGCTCCCCTGTGCTCCATGAACTGACATTCCAGGCTATGAGTTATGACCTGCT
G
CCTATCGAAAATGATGTTTACAAGTATGAGACCAGCGGCATTGGAGAGGCGCGGGTGAAGGAGGTGCTA
CTG
GATGAGGACGATGACCTGTGGATTGCGCTGCGACACAAGCACATCGCAGAGGTGTCCCAGGAAGTCA
CC
CGGTCTCTGAAGGACTTTTCCTCTAGCAAGAGGATGAACACTGGCGAGAAGACCACCATGCGGGACCT
G
TCCCAGATGCTGAAGAAAATGCCCCAGTACCAGAAGGAGCTCAGCAAGTATTCGACTCACCTGCACCTT
GCT
GAAGACTGCATGAAGCATTACCAAGGCACTGTAGACAAACTCTGCCGCGTGGAGCAGGACCTGGCAA
TG
GGCACAGATGCTGAGGGGGAAAAAATCAAGGACCCCATGAGAGCCATTGTCCCCATCCTGCTGGATGC
G
AACGTCAGCACTTACGACAAAATCCGTATCATCCTTCTCTACATCTTCCTGAAGAACGGTATCACTGAG
GAG
AACCTAAACAAACTCATCCAGCACGCTCAGATACCCCCAGAGGACAGCGAGATCATCACCAACATGG
CT
CACCTCGGCGTGCCCATCGTCACGGATTCCACACTACGCCGCCGAAGCAAACCGGAGCGGAAGGAGCG
T
ATCAGTGAGCAGACCTACCAGCTCTCACGATGGACCCCGATCATTAAAGACATTATGGAGGACACTATC
GAA
GACAAGCTGGATACAAAGCACTACCCATACATCTCTACCCGCTCGTCCGCGTCCTTCAGCACCACTG
CT
GTGAGTGCCCGCTATGGACATTGGCACAAGAATAAGGCCCCCGGGGAGTACCGCAGCGGTCCCCGCCT
C
ATTATTTTCATCCTTGGGGGTGTGAGCCTGAATGAGATGCGCTGTGCTTACGAAGTGACCCAGGCCAAC
GGC
AAGTGGGAAGTGCTGATAGGATCCACGCACATTCTCACCCCACAGAAACTGCTGGACACGCTGAAGA
AG
CTGAATAAAACAGATGAAGAAATAAGCAGTTAA


Translation (594 aa):
MAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPLPS
L
EAVYLITPSEK
SVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPY
E
SQ
VYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLD
A
YKADDPTMGE
GPDKARSQLLILDRGFDPSSPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVL
L
DEDDDLWIALRHKHIAEVS
QEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHLHL
A
EDCMKHYQGTVDKLCRVEQ
DLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGITE
E
NLNKLIQHAQIPPEDSEIITNMAHLGVPIVTD
STLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTI
E
DKLDTKHYPYISTRSSASFSTTAV
SARYGHWHKNKAPGEYRSGPRLIIFILGGVSLNEMRCAYEVTQAN
G
KWEVLI
GSTHILTPQKLLDTLKKLNKTDEEISS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser