NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15727.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15727.1 Public Mus musculus 2 Mastl 21 106 86 CCDS HistoryNCBI Gene:67121Re-query CCDS DB by CCDS ID:15727.1Re-query CCDS DB by GeneID:67121See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15727.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000028119 ENSMUSP00000028119 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028119Link to Ensembl Protein Viewer:ENSMUSP00000028119Re-query CCDS DB by Nucleotide ID:ENSMUST00000028119Re-query CCDS DB by Protein ID:ENSMUSP00000028119
Original member Current member EBI,WTSI OTTMUST00000027217 OTTMUSP00000012380 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000027217Link to Vega Protein Viewer:OTTMUSP00000012380Re-query CCDS DB by Nucleotide ID:OTTMUST00000027217Re-query CCDS DB by Protein ID:OTTMUSP00000012380
Original member Current member NCBI NM_025979.4 NP_080255.3 Accepted alive Link to Nucleotide Sequence:NM_025979.4Link to Protein Sequence:NP_080255.3Re-query CCDS DB by Nucleotide ID:NM_025979Re-query CCDS DB by Protein ID:NP_080255Link to BLink:NP_080255.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080255.3 865 Q8C0P0-1 865 100% 0 0

Chromosomal Locations for CCDS 15727.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 23118435 23118592 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 23120457 23120558 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 23120893 23121006 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 23131680 23131818 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 23132625 23133731 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 23136871 23137043 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 23139908 23140055 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 23140499 23140605 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 23145364 23145452 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 23146042 23146181 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 23150988 23151125 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 23155679 23155861 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2598 nt):
ATGGAGTCCGCCTCGGCAAGTGAGGAGAATGAAGGAGGTGCGGCGATAGAGGAGTGCGTGAGTAGGATCC
CG
GTACCAAGACCACCCTCCATTGAGGAGTTCACCATAGTGAAGCCCATTAGCCGTGGTGCATTCGGGAA
A
GTGTACCTGGGACAGAAAGGCGGCAAGTTGTACGCAGTGAAGGTTGTCAAAAAGGCAGACATGATCAAT
AAA
AATATGACTCATCAGGTACAAGCTGAGAGAGATGCCCTGGCACTGAGCAAAAGCCCTTTTGTTGTGC
AT
CTCTATTACTCACTGCAGTCAGCAAGCAACATCTACTTGATAATGGAGTATCTTATTGGTGGAGATGT
C
AAGTCTCTCCTACATATATATGGTTATTTTGATGAAGAGATGGCTATAAAATATATTTCTGAAGTAGCA
TTG
GCTTTAGACTACCTGCACAGACATGGAATCATCCATAGGGATTTGAAACCGGACAATATGCTTATTT
CC
AATGAGGGTCATATTAAACTGACAGATTTTGGCCTTTCCAAAGTTACTTTGAATAGAGACATCAATAT
G
ATGGATATTCTCACAACACCATCAATGTCTAAACCTAAGCAAGATTATTCAAGAACTCCAGGACAAGTC
TTA
TCTCTCATCAGTTCTTTGGGATTTTTCACACCAGTTGGAGAAAAAGATCAAGACTCTGCAAACATGT
TT
TCAGCCCCTAAGTCTGCTGCACAACTTTCTCGAGGATTCATTTGTCCTATGTCTGTAGATCAGAAGGA
G
CCGACTTCTTATTCGAGCAAACTGCTAAAATCATGTTTTGAAACCCTTTCATCCAATCCAGAAATACCT
GTG
AAATGTCTGACTTCTAATCTACTCCAGTGTAGGAAAAGACTGGGTACCTCAAGTACTAGTAGCCAGT
CT
CATACCTTCGTATCCAGTGTGGAGTCAGAATGCCACAGCAATCCCAAATGGGAAAGAGACTGCCAGAG
T
ACCGAATCATCAGGCTGTGCAATGAGCTGGAATGCAGTTGAAATGCTGTATGCAAAATCTACAAGTGCC
ATC
AAGACAAAAACAGAACTGGAATTAGCACTTTCTCCCATTCATGACAGCAGTGCCATTCCTGCTGCTG
GA
AGCAACCAGGTGACCCTCCCTAGAAAATGCTTCAGGGAAATCTCTTGGGAAGCAAGGGACCCAGATAA
T
GAGAACATGACCATTGACAAGGGACAGTCTGGTTTCTGTCAGTCCAGTCAGAGGTCTGTAAATTCTAGT
GCT
ACATCTGAAGAACACCTTGGTAAAAGAAATTATAAAAGAAATTTCCACTTGGTTGACTCCAGTCCTT
GT
CAGGAAATTATGCAAAGTAAAAAAAACTGTACAGAGTATGAGGCCAATAAGGAAAGGCAAGGCTGCCG
T
GCAAATCAAAGTACAGGCTTGACAACCGAAGTCCAGAACCTGAAGCTATCAGGGTGTGAAAGTCAGCAA
CTT
GACTATGCCAATAAGGAGAACATTGTCACCTATTTAACTGACAGACAAACCCCAGAAAAACTGCATA
TA
CCAACGATAGCAAAGAACCTTATGTCTGAACTAGATGAAGACTGTGAGCTGAGCAGTAAAAAGGACTG
C
CTCAGTTCTAATTCTGTATGTTCTGATGAGGATAGAGCTCTTAAAACTACCTGTGTGGATTCGGATTCA
TCT
TTTCCTGGAGTGTCTATGATGGAGAGTTCACTGGAAATTCAGGCCTTAGAACCAGATAAAAGCATCA
GA
GACTACTCTTTTGAAGAACCAAACACTGAAGATCTATTTGTGTTACCAAAATGCCAAGAAAATTCCTT
G
CCACAAGATGACTGCCATGCTTGTATCCAAGACAGTAGCCAAGTGTCAGCTCATCCCTCAAAGGCGCCC
AAA
GCATTGACCTCTAAAATCAACGTCGTGGCTTTTCGAAGTTTTAACAGTCATATTAACGCATCTACTA
AT
TCGGAACCATCCAAAATCAGCATAACTTCTTTAGATGCTATGGACATTTCCTGTGATTACAGTGGTTC
A
TACCCCATGGCTGTGAGCCCTACTGAGAAAGGAAGGCACTACACGTCACATCAGACTCCAAATCAGGTC
AAG
TTGGGAACATCATACAGAACTCCAAAGAGTGTGAGAAGAGGGGCAGCCCCAGTAGATGACGGGCGAA
TT
CTAGGGACTCCAGATTACCTGGCACCTGAGCTCTTACTGGGTACAGCCCATGGTCCTGCAGTAGACTG
G
TGGGCTCTTGGAGTTTGCTTGTTCGAATTTCTGACAGGAATTCCCCCTTTCAATGATGAAACACCACAA
CAA
GTATTCCAGAATATTTTAAAAAGAGATATCCCATGGCCAGAAGGCGAAGAAAAGCTATCTGATAATG
CT
CAAAGTGCAATGGACATGCTTTTAACCATTGATGATTCAAAGAGAGCTGGAATGAGAGAACTAAAACA
G
CATCCTCTCTTCAGTGAAGTGGACTGGGAAAATCTGCAGCATCAGACTATGCCTTTCGTACCCCAACCA
GAC
GACGAAACAGATACATCCTATTTTGAAGCCAGAAATAATGCTCAACATCTGACCATATCTGGGTTTA
GT
CTGTAG


Translation (865 aa):
MESASASEENEGGAAIEECVSRIPVPRPPSIEEFTIVKPISRGAFGKVYLGQKGGKLYAVKVVKKADMIN
K
NMTHQVQAERDALALSKSPFVVHLYYSLQSASNIYL
IMEYLIGGDVKSLLHIYGYFDEEMAIKYISEVA
L
ALDYLHRHGIIH
RDLKPDNMLISNEGHIKLTDFGLSKVTLNRDINMMDILTTPSMSKPKQDYSRTPGQV
L
SLISSLGF
FTPVGEKDQDSANMFSAPKSAAQLSRGFICPMSVDQKEPTSYSSKLLKSCFETLSSNPEIP
V
KCLTSNLLQCRKRLGTSSTSSQSHTFVSSVESECHSNPKWERDCQ
STESSGCAMSWNAVEMLYAKSTSA
I
KTKTELELALSPIHDSSAIPAAGSNQVTLPRKCFREISWEARDPDNENMTIDKGQSGFCQSSQRSVNSS
A
TSEEHLGKRNYKRNFHLVDSSPCQEIMQSKKNCTEYEANKERQGCRANQSTGLTTEVQNLKLSGCESQQ
L
DYANKENIVTYLTDRQTPEKLHIPTIAKNLMSELDEDCELSSKKDCLSSNSVCSDEDRALKTTCVDSDS
S
FPGVSMMESSLEIQALEPDKSIRDYSFEEPNTEDLFVLPKCQENSLPQDDCHACIQDSSQVSAHPSKAP
K
ALTSKINVVAFRSFNSHINASTNSEPSKISITSLDAMDISCDYSGSYPMAVSPTEKGRHYTSHQ
TPNQV
K
LGTSYRTPKSVRRGAAPVDDGRILGTPDYLAPELLLGTAH
GPAVDWWALGVCLFEFLTGIPPFNDETPQ
Q
VFQNILKR
DIPWPEGEEKLSDNAQSAMDMLLTIDDSKRAGMRELKQHPLFSEVDWENLQHQTMPFVPQP
D
DETDTSYFEARNNAQHLTISGFSL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser