NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15560.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15560.1 Public Mus musculus 1 Smyd3 21 106 86 CCDS HistoryNCBI Gene:69726Re-query CCDS DB by CCDS ID:15560.1Re-query CCDS DB by GeneID:69726See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15560.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000128302 ENSMUSP00000117410 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000128302Link to Ensembl Protein Viewer:ENSMUSP00000117410Re-query CCDS DB by Nucleotide ID:ENSMUST00000128302Re-query CCDS DB by Protein ID:ENSMUSP00000117410
Original member Current member EBI,WTSI OTTMUST00000041394 OTTMUSP00000018573 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000041394Link to Vega Protein Viewer:OTTMUSP00000018573Re-query CCDS DB by Nucleotide ID:OTTMUST00000041394Re-query CCDS DB by Protein ID:OTTMUSP00000018573
Original member NCBI NM_027188.3 NP_081464.1 Updated not alive Link to Nucleotide Sequence:NM_027188.3Link to Protein Sequence:NP_081464.1Re-query CCDS DB by Nucleotide ID:NM_027188Re-query CCDS DB by Protein ID:NP_081464
Current member NCBI NM_027188.4 NP_081464.1 Accepted alive Link to Nucleotide Sequence:NM_027188.4Link to Protein Sequence:NP_081464.1Re-query CCDS DB by Nucleotide ID:NM_027188Re-query CCDS DB by Protein ID:NP_081464Link to BLAST:NP_081464.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_081464.1 428 Q9CWR2 428 100% 0 0

Chromosomal Locations for CCDS 15560.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 178957461 178957562 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 178972188 178972296 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 179043737 179043911 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 179050291 179050378 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 179086324 179086434 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 179092866 179092968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 179094335 179094402 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 179405283 179405419 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 179410407 179410464 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 179411678 179411785 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 179423355 179423418 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 179517788 179517951 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1287 nt):
ATGGAGGCACTGAAGGTGGAAAAGTTCACGACTGCCAACCGGGGAAACGGGCTGCGTGCTGTGGCTCCAC
TG
CGCCCCGGGGAGCTGCTCTTCCGCTCCGACCCCTTGGCTTACACTGTGTGCAAGGGGAGTCGTGGCGT
A
GTCTGTGATCGCTGCCTACTGGGGAAGGAGAAGCTGATGCGTTGTTCTCAATGCCGAATTGCCAAATAC
TGC
AGTGCCAAGTGTCAGAAAAAAGCCTGGCCGGACCACAGACGGGAATGCAGTTGTCTTAAAAGCTGCA
AG
CCCAGATATCCGCCCGACTCCGTGAGACTTCTGGGCAGGGTTATCGTCAAGCTGATGGATGAAAAGCC
C
TCAGAGTCAGAGAAACTTTATTCATTTTATGATCTGGAGTCCAATATTAGCAAACTCACTGAAGATAAG
AAA
GAGGGCCTGAGGCAACTTGCAATGACTTTTCAACATTTCATGAGAGAGGAGATCCAGGATGCGTCTC
AG
CTGCCGCCTTCTTTTGACCTTTTTGAAGCCTTTGCAAAAGTGATCTGCAATTCGTTCACTATCTGCAA
C
GCGGAGATGCAGGAGGTCGGCGTTGGCCTGTACCCCAGTATGTCTTTGCTGAATCACAGCTGTGACCCC
AAC
TGCTCCATCGTATTCAACGGGCCCCACCTCTTACTGCGTGCAGTGCGGGAAATTGAAGCAGGAGAGG
AG
CTCACCATCTGCTACCTGGACATGCTGATGACCAGCGAGGAACGCCGGAAGCAGCTGAGGGACCAGTA
C
TGCTTTGAGTGTGACTGCATCCGATGCCAAACCCAGGACAAGGATGCTGACATGCTAACGGGTGACGAG
CAA
ATATGGAAGGAGGTTCAAGAGTCGCTGAAGAAAATCGAAGAGCTGAAGGCGCACTGGAAGTGGGAGC
AG
GTTCTGGCGCTGTGCCAGGCGATCATAAACAGCAATTCCAACCGGCTTCCCGACATCAACATCTACCA
G
CTGAAGGTGCTCGACTGTGCCATGGATGCCTGCATCAACCTGGGGATGCTGGAGGAGGCGTTGTTCTAC
GCC
ATGCGCACCATGGAGCCGTACCGGATTTTTTTCCCTGGAAGCCATCCCGTCAGAGGTGTGCAAGTGA
TG
AAAGTTGGCAAGCTGCAGCTCCATCAAGGCATGTTTCCTCAAGCCATGAAGAACCTGAGGCTGGCCTT
T
GACATTATGAAAGTGACCCACGGCCGAGAGCACAGCCTGATTGAAGATTTGATTCTTCTCCTGGAAGAA
TGT
GATGCCAACATACGAGCCTCCTAA


Translation (428 aa):
MEALKVEKFTTANRGNGLRAVAPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRIAKY
C
SAKCQ
KKAWPDHRRECSCLKSCKPRYPPDSVRLLGRVIVKLMDEKPSESEKLYSFYDLESNISKLTEDK
K
EGLRQLAMTFQHFMREEIQDASQLPPSFDLFEAFAK
VICNSFTICNAEMQEVGVGLYPSMSLLNHSCDP
N
CSIVFNGPHLLLRAVREIEAGEE
LTICYLDMLMTSEERRKQLRDQYCFECDCIRCQTQDKDADMLTGDE
Q
IWKEVQESLKKIEELKAHW
KWEQVLALCQAIINSNSNRLPDINIYQLKVLDCAMDACINLGMLEEALFY
A
MRTMEPY
RIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMKVTHGREHSLIEDLILLLEE
C
DANIRAS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser