NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15504.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15504.1 Public Mus musculus 1 Slamf6 21 106 86 CCDS HistoryNCBI Gene:30925Re-query CCDS DB by CCDS ID:15504.1Re-query CCDS DB by GeneID:30925See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 15504.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000171330 ENSMUSP00000130610 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000171330Link to Ensembl Protein Viewer:ENSMUSP00000130610Re-query CCDS DB by Nucleotide ID:ENSMUST00000171330Re-query CCDS DB by Protein ID:ENSMUSP00000130610
Original member Current member EBI,WTSI OTTMUST00000127386 OTTMUSP00000068737 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000127386Link to Vega Protein Viewer:OTTMUSP00000068737Re-query CCDS DB by Nucleotide ID:OTTMUST00000127386Re-query CCDS DB by Protein ID:OTTMUSP00000068737
Original member Current member NCBI NM_030710.2 NP_109635.1 Accepted alive Link to Nucleotide Sequence:NM_030710.2Link to Protein Sequence:NP_109635.1Re-query CCDS DB by Nucleotide ID:NM_030710Re-query CCDS DB by Protein ID:NP_109635Link to BLAST:NP_109635.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_109635.1 331 Q9ET39-2 331 100% 0 0

Chromosomal Locations for CCDS 15504.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 171917708 171917792 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 171934099 171934440 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 171936469 171936732 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 171938002 171938115 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 171938452 171938481 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 171939396 171939469 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 171941625 171941696 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 171942578 171942592 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (996 nt):
ATGGCTGTCTCAAGGGCTCCAGCACCCGACTCCGCCTGTCAGAGGATGGTCTGGCTCTTTCCACTTGTCT
TC
TGCCTCGGCTCAGGGAGTGAAGTTTCACAGAGCAGCTCAGACCCCCAGCTAATGAATGGCGTTCTAGG
A
GAGTCTGCAGTTCTTCCTCTAAAGCTTCCTGCAGGGAAGATAGCCAATATCATCATCTGGAATTATGAA
TGG
GAAGCGTCACAAGTCACTGCCCTCGTTATCAACCTAAGTAATCCTGAAAGTCCACAAATCATGAACA
CT
GATGTAAAGAAGAGACTGAACATCACCCAGTCCTACTCCCTGCAAATCAGCAACCTTACCATGGCAGA
C
ACAGGATCATACACTGCGCAGATAACCACAAAGGACTCTGAAGTGATCACCTTCAAATATATTCTGAGG
GTC
TTTGAACGACTGGGTAACTTAGAAACTACCAACTATACTCTCCTGCTAGAGAATGGGACCTGCCAGA
TA
CACCTGGCCTGTGTTTTGAAGAATCAAAGTCAAACTGTCTCAGTTGAGTGGCAAGCCACAGGAAACAT
C
TCTTTAGGAGGACCAAATGTCACTATCTTTTGGGACCCGAGGAATTCTGGTGACCAGACTTACGTCTGC
AGA
GCCAAGAATGCTGTCAGCAATTTGTCAGTCTCTGTTTCGACCCAGAGTCTCTGCAAAGGGGTTCTAA
CT
AATCCACCCTGGAATGCAGTATGGTTTATGACTACAATTTCAATAATCAGTGCTGTCATACTCATCTT
T
GTGTGCTGGAGCATACATGTTTGGAAGAGAAGAGGTTCTCTTCCTTTGACTAGCCAACATCCAGAGTCC
TCC
CAGAGCACAGATGGCCCAGGCTCTCCAGGGAACACTGTGTATGCACAAGTCACTCGTCCAATGCAGG
AA
ATGAAAATCCCAAAACCTATCAAAAATGACTCCATGACAATTTACTCCATAGTTAATCATTCCAGAGA
G
GCCGAATACTCTTAA


Translation (331 aa):
MAVSRAPAPDSACQRMVWLFPLVFCLGSGSEVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYE
W
EASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILR
V
F
ERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVC
R
AKNAVSNLSVSVSTQSLCK
GVLTNPPWNAVWFMTTISIISAVILIFVCWSIHVWKRRGSLPLTSQHPES
S
QSTDGPGSPGNTVYAQVTRPMQ
EMKIPKPIKNDSMTIYSIVNHSREAEYS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser