NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15416.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15416.1 Public Mus musculus 1 Tnfsf4 19 105 81 CCDS HistoryNCBI Gene:22164Re-query CCDS DB by CCDS ID:15416.1Re-query CCDS DB by GeneID:22164See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15416.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000028024 ENSMUSP00000028024 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028024Link to Ensembl Protein Viewer:ENSMUSP00000028024Re-query CCDS DB by Nucleotide ID:ENSMUST00000028024Re-query CCDS DB by Protein ID:ENSMUSP00000028024
Original member Current member EBI,WTSI OTTMUST00000111962 OTTMUSP00000062822 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000111962Link to Vega Protein Viewer:OTTMUSP00000062822Re-query CCDS DB by Nucleotide ID:OTTMUST00000111962Re-query CCDS DB by Protein ID:OTTMUSP00000062822
Original member Current member NCBI NM_009452.2 NP_033478.1 Accepted alive Link to Nucleotide Sequence:NM_009452.2Link to Protein Sequence:NP_033478.1Re-query CCDS DB by Nucleotide ID:NM_009452Re-query CCDS DB by Protein ID:NP_033478Link to BLink:NP_033478.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033478.1 198 P43488 198 100% 0 0

Chromosomal Locations for CCDS 15416.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 161395582 161395743 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 161414968 161415010 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 161416947 161417338 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (597 nt):
ATGGAAGGGGAAGGGGTTCAACCCCTGGATGAGAATCTGGAAAACGGATCAAGGCCAAGATTCAAGTGGA
AG
AAGACGCTAAGGCTGGTGGTCTCTGGGATCAAGGGAGCAGGGATGCTTCTGTGCTTCATCTATGTCTG
C
CTGCAACTCTCTTCCTCTCCGGCAAAGGACCCTCCAATCCAAAGACTCAGAGGAGCAGTTACCAGATGT
GAG
GATGGGCAACTATTCATCAGCTCATACAAGAATGAGTATCAAACTATGGAGGTGCAGAACAATTCGG
TT
GTCATCAAGTGCGATGGGCTTTATATCATCTACCTGAAGGGCTCCTTTTTCCAGGAGGTCAAGATTGA
C
CTTCATTTCCGGGAGGATCATAATCCCATCTCTATTCCAATGCTGAACGATGGTCGAAGGATTGTCTTC
ACT
GTGGTGGCCTCTTTGGCTTTCAAAGATAAAGTTTACCTGACTGTAAATGCTCCTGATACTCTCTGCG
AA
CACCTCCAGATAAATGATGGGGAGCTGATTGTTGTCCAGCTAACGCCTGGATACTGTGCTCCTGAAGG
A
TCTTACCACAGCACTGTGAACCAAGTACCACTGTGA


Translation (198 aa):
MEGEGVQPLDENLENGSRPRFKWKKTLRLVVSGIKGAGMLLCFIYVCLQLSSSPAKDPPIQRLRGAVTRC
E
DGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVF
T
VVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser