NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15345.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15345.1 Public Mus musculus 1 Trove2 21 106 86 CCDS HistoryNCBI Gene:20822Re-query CCDS DB by CCDS ID:15345.1Re-query CCDS DB by GeneID:20822See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15345.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000159879 ENSMUSP00000125623 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000159879Link to Ensembl Protein Viewer:ENSMUSP00000125623Re-query CCDS DB by Nucleotide ID:ENSMUST00000159879Re-query CCDS DB by Protein ID:ENSMUSP00000125623
Original member Current member EBI,WTSI OTTMUST00000051883 OTTMUSP00000024494 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000051883Link to Vega Protein Viewer:OTTMUSP00000024494Re-query CCDS DB by Nucleotide ID:OTTMUST00000051883Re-query CCDS DB by Protein ID:OTTMUSP00000024494
Original member Current member NCBI NM_013835.2 NP_038863.1 Accepted alive Link to Nucleotide Sequence:NM_013835.2Link to Protein Sequence:NP_038863.1Re-query CCDS DB by Nucleotide ID:NM_013835Re-query CCDS DB by Protein ID:NP_038863Link to BLAST:NP_038863.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038863.1 538 O08848 538 100% 0 0

Chromosomal Locations for CCDS 15345.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 143757742 143757894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143759943 143760089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143760353 143760466 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143761270 143761386 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143765433 143765570 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143765774 143765920 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143766590 143766810 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143770426 143771005 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1617 nt):
ATGGAAGGATCTGCAAACCAGTTGCAGCCACTGAGTGAGACTCAAGTAGTTAACTCAGAGGGCGGCTGTG
TA
TGGCAGGTCACCGACATGAACCGGCTGCGCCGCTTCTTGTGTTTTGGCTCTGAAGGTGGCACGTACTA
T
ATCAAAGAACAGAAGCTGGGCCTTGAGAATGCTGAAGCCTTAATTAGACTGATTGAAGACGGCAGAGGA
TGT
GAAGTGATCCAGGAAATCAAGTCCTTTAGTCAGGAAGGCAGGACTGCCAAACAAGAGCCACTGCTGT
TT
GCACTGGCCGTTTGTTCCCAGTGTGCGGACATAAACACAAAGCAAGCAGCCTTTAAAGCTGTCCCTGA
A
GTGTGTCGCATTCCGACCCACCTCTTCACTTTTATCCAGTTTAAGAAAGACCTGAAGGAGAGCATGAAG
TGT
GGCATGTGGGGTCGCGCCCTCCGGAAGGCAGTGGCAGACTGGTACAATGAAAAAGGCGGCATGGCCG
TG
GCGCTGGTGGTTACAAAGTATAAACAACGAAACGGCTGGTCTCACAAAGATCTCCTCCGACTGTCCCA
C
CTTAAGCCTTCCAGTGAAGGACTTGCTATTGTGACCAAGTATATCACAAAGGGCTGGAAAGAAGTCCAT
GAA
GAGTATAAAGAAAAGGCGCTTTCTGTGGAGGCTGAGAAGCTGCTCAAGTACCTGGAGGCTGTGGAGA
AA
GTGAAGCGCACGAAAGACGACCTGGAAGTCATTCATCTGATTGAAGAGCATCAGTTAGTTAGGGAACA
C
CTGCTGACAAATCACTTGAAGTCTAAAGAGGTATGGAAGGCTTTGTTACAGGAAATGCCCCTTACTGCG
CTC
CTGAGGAACCTGGGAAAGATGACTGCTAATTCAGTGCTTGAACCAGGAAACTCTGAAGTATCTTTAA
TA
TGTGAAAAACTGAGCAATGAAAAGCTGCTCAAAAAGGCTCGTATACATCCATTTCATGTTTTAATTGC
A
TTAGAGACCTACAGAGCAGGCCACGGGCTCAGAGGGAAACTGAAGTGGATTCCAGATAAAGACATCTTG
CAA
GCCTTAGATGCTGCTTTTTATACAACATTTAAGACTGTTGAACCAACTGGGAAGCGCTTCTTGCTCG
CT
GTTGACGTCAGTGCCTCTATGAACCAGAGAGCCTTGGGTAGTGTACTCAATGCTAGTACTGTTGCCGC
A
GCAATGTGCATGGTGGTTACACGGACAGAAAAAGAGTCTTCGGTGGTTGCTTTTGCCTGTGATATGGTT
CCG
TTTCCAGTGACTACAGACATGACATTACAGCAGGTTTTAACGGCTATGAATAAAGTTCCAGCAGGCA
AC
ACGGATTGCTCTCTCCCAATGATCTGGGCCCAGAAAACAGACACAGCCGCAGATGTCTTCGTTGTGTT
T
ACTGATAATGAGACCTTTGCAGGGCAGGTGCATCCTGCTGTTGCCCTGAGAGAGTACCGAAAGAAAATG
GAT
ATTCCTGCTAAATTGATTGTTTGTGGGATGACATCAAATGGCTTTACCATTGCAGACCCAGACGATA
GA
GGCATGTTGGATATGTGCGGCTTTGATACTGCAGCTCTGGATGTAATTCGGAATTTCACATTGGATGT
C
ATTTAA


Translation (538 aa):
MEGSANQLQPLSETQVVNSEGGCVWQVTDMNRLRRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRG
C
EVIQEIKSFSQEGRTAKQEPLLFALAVCSQCADINTKQAAFKAVPEVCRIPTHLFTFIQFKKDLKESMK
C
GMWGRALRKAVADWYNEKGGMAVALVVTKYKQRNGWSHKDLLRLSHLKPSSE
GLAIVTKYITKGWKEVH
E
EYKEKALSVEAEKLLKYLEAVEKVKRTKDDLEVIHLIEEHQLVREHLLTNHLKSKE
VWKALLQEMPLTA
L
LRNLGKMTANSVLEPGNSEVSLICEKLSNEKLLKK
ARIHPFHVLIALETYRAGHGLRGKLKWIPDKDIL
Q
ALDAAFYTTFK
TVEPTGKRFLLAVDVSASMNQRALGSVLNASTVAAAMCMVVTRTEKESSVVAFACDMV
P
FPVTTDMTLQQVLTAMNK
VPAGNTDCSLPMIWAQKTDTAADVFVVFTDNETFAGQVHPAVALREYRKKM
D
IPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTAALDVIRNFTLDVI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser