NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15341.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15341.1 Public Mus musculus 1 Cdc73 21 106 86 CCDS HistoryNCBI Gene:214498Re-query CCDS DB by CCDS ID:15341.1Re-query CCDS DB by GeneID:214498See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15341.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000018337 ENSMUSP00000018337 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000018337Link to Ensembl Protein Viewer:ENSMUSP00000018337Re-query CCDS DB by Nucleotide ID:ENSMUST00000018337Re-query CCDS DB by Protein ID:ENSMUSP00000018337
Original member Current member EBI,WTSI OTTMUST00000076702 OTTMUSP00000040421 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000076702Link to Vega Protein Viewer:OTTMUSP00000040421Re-query CCDS DB by Nucleotide ID:OTTMUST00000076702Re-query CCDS DB by Protein ID:OTTMUSP00000040421
Original member Current member NCBI NM_145991.2 NP_666103.1 Accepted alive Link to Nucleotide Sequence:NM_145991.2Link to Protein Sequence:NP_666103.1Re-query CCDS DB by Nucleotide ID:NM_145991Re-query CCDS DB by Protein ID:NP_666103Link to BLink:NP_666103.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_666103.1 531 Q8JZM7 531 100% 0 0

Chromosomal Locations for CCDS 15341.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 143608521 143608557 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143609370 143609511 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143615303 143615403 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143617279 143617440 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143627502 143627589 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143627846 143627881 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143635032 143635089 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143667625 143667689 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143669990 143670068 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143671330 143671428 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143677639 143677855 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143685923 143686011 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143691275 143691327 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143691414 143691476 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143695393 143695462 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143699217 143699322 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 143702494 143702624 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1596 nt):
ATGGCGGACGTGCTCAGCGTCCTGCGACAGTACAACATCCAGAAGAAGGAGATCGTGGTCAAGGGGGATG
AA
GTGATCTTCGGGGAGTTCTCCTGGCCCAAGAATGTGAAGACCAACTATGTAGTTTGGGGGACCGGAAA
G
GAAGGCCAACCCAGAGAGTACTACACATTGGATTCTATCTTATTTCTCCTTAATAATGTGCACCTTTCG
CAT
CCTGTTTATGTCCGGCGTGCAGCTACTGAAAATATTCCTGTGGTTAGAAGACCCGACCGAAAAGATC
TA
CTTGGATATCTCAATGGGGAAGCATCAACATCAGCAAGCATAGACAGGAGTGCCCCCTTGGAAATAGG
T
CTTCAGCGGTCTACTCAAGTCAAAAGAGCTGCAGATGAAGTTTTAGCAGAAGCAAAGAAACCACGGATT
GAG
GATGAAGAGTGTGTGCGCCTTGATAAAGAGAGATTGGCAGCTCGTTTGGAAGGCCATAAAGAAGGGA
TC
GTGCAGACTGAGCAGATTAGGTCTTTGTCTGAAGCCATGTCAGTGGAAAAAATTGCTGCAATCAAAGC
C
AAAATTATGGCTAAGAAAAGATCTACTATCAAGACTGATCTAGATGATGATATAACTGCCCTTAAACAG
AGG
AGTTTTGTGGATGCTGAGGTAGATGTGACCAGAGATATTGTCAGCAGAGAGAGAGTGTGGAGGACAA
GA
ACAACTATTTTACAGAGCACAGGAAAGAATTTTTCAAAGAATATTTTTGCAATTCTTCAATCTGTAAA
A
GCCAGAGAAGAAGGTCGTGCCCCTGAACAACGGCCAGCTCCAAATGCAGCCCCCGTGGATCCTACATTG
CGT
ACAAAACAGCCTATTCCAGCTGCTTACAACAGATATGACCAAGAAAGATTCAAAGGCAAAGAAGAAA
CG
GAAGGCTTTAAGATCGATACTATGGGCACCTACCATGGCATGACACTGAAATCTGTAACGGAAGGTGC
A
TCTGCTCGTAAGACTCAAACTCCTGCAGCCCAGCCTGTACCTAGACCAGTGTCTCAAGCCAGACCCCCC
CCA
AATCAGAAGAAAGGGTCACGGACACCCATTATTATTATTCCTGCAGCTACCACTTCTTTAATAACTA
TG
CTTAATGCAAAAGACCTTCTACAGGATCTGAAATTTGTCCCATCAGATGAGAAGAAGAAACAGGGTTG
T
CAACGAGAAAATGAAACACTAATACAGAGAAGAAAAGACCAGATGCAACCAGGGGGCACAGCAATTAGT
GTC
ACAGTACCTTACAGAGTAGTAGACCAGCCCCTGAAACTTATGCCTCAAGACTGGGATCGAGTTGTGG
CT
GTTTTTGTACAAGGTCCTGCTTGGCAATTCAAAGGTTGGCCATGGCTTCTCCCTGATGGATCACCAGT
T
GACATATTTGCGAAAATTAAAGCCTTCCATCTCAAGTATGATGAAGTTCGTCTAGATCCAAATGTTCAA
AAG
TGGGATGTAACAGTATTAGAACTCAGCTATCATAAACGTCACTTGGATAGACCAGTTTTCTTACGTT
TC
TGGGAAACATTGGATAGATACATGGTAAAGCATAAATCCCACTTGAGATTCTGA


Translation (531 aa):
MADVLSVLRQYNIQKKEIVVKGDEVIFGEFSWPKNVKTNYVVWGTGKEGQPREYYTLDSILFLLNNVHLS
H
PVYVRRAA
TENIPVVRRPDRKDLLGYLNGEASTSASIDRSAPLEIGLQRSTQVKRAADEVLAEAKKPRI
E
DEECVRLDKERLAARLEGHKEGIVQTEQIRSLSEAMSVEKIAAIKAKIMAKKRSTIKTDLDDDITALKQ
R
SFVDAEVDVTRDIVSRERVWRTRTTILQSTGK
NFSKNIFAILQSVKAREEGRAPEQRPAPNAAPVDPTL
R
TKQPIPAAYNRYDQERFKGKE
ETEGFKIDTMGTYHGMTLKSVTEGASARKTQTPAAQPVPRPVSQARPP
P
NQKK
GSRTPIIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRENETLIQRRKDQMQPGGTAIS
V
TVPYRVVDQPLKLMPQD
WDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKYDEVRLDPNVQ
K
WDVTVLELSYHKRHLDRPVFLRFWETLD
RYMVKHKSHLRF



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser