NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15268.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15268.1 Public Mus musculus 1 Rassf5 21 106 86 CCDS HistoryNCBI Gene:54354Re-query CCDS DB by CCDS ID:15268.1Re-query CCDS DB by GeneID:54354See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15268.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000027688 ENSMUSP00000027688 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027688Link to Ensembl Protein Viewer:ENSMUSP00000027688Re-query CCDS DB by Nucleotide ID:ENSMUST00000027688Re-query CCDS DB by Protein ID:ENSMUSP00000027688
Original member Current member EBI,WTSI OTTMUST00000051125 OTTMUSP00000024015 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000051125Link to Vega Protein Viewer:OTTMUSP00000024015Re-query CCDS DB by Nucleotide ID:OTTMUST00000051125Re-query CCDS DB by Protein ID:OTTMUSP00000024015
Original member Current member NCBI NM_018750.4 NP_061220.2 Accepted alive Link to Nucleotide Sequence:NM_018750.4Link to Protein Sequence:NP_061220.2Re-query CCDS DB by Nucleotide ID:NM_018750Re-query CCDS DB by Protein ID:NP_061220Link to BLAST:NP_061220.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_061220.2 413 Q5EBH1-1 413 100% 0 0

Chromosomal Locations for CCDS 15268.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 131178525 131178677 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 131180553 131180668 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 131181154 131181451 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 131182144 131182254 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 131212257 131212378 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 131244689 131245130 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1242 nt):
ATGGCTTCCCCGGCCATCGGGCAACGTCCCTACCCGCTGCTCCTAGATCCCGAGCCGCCGCGGTATCTGC
AG
AGTCTGGGTGGCACCGAGCCGCCACCTCCCGCCCGGCCGCGCCGCTGCATCCCCACGGCCCTGATCCC
C
GCGGCCGGGGCGTCAGAGGATCGCGGTGGCAGGAGGAGTGGCCGGAGGGACCCCGAACCCACGCCCCGA
GAC
TGCCGACACGCTCGCCCTGTCCGGCCCGGTCTGCAGCCGAGACTGCGGCTGCGACCTGGGTCACACC
GA
CCCCGCGACGTGAGGAGCATCTTCGAGCAGCCGCAGGATCCCCGCGTCTTGGCCGAGAGAGGCGAGGG
G
CACCGTTTCGTGGAACTGGCGCTGCGGGGCGGTCCGGGCTGGTGTGACCTGTGCGGACGAGAGGTGCTG
CGG
CAGGCGCTGCGCTGCGCTAATTGTAAATTCACCTGCCACTCGGAGTGCCGCAGCCTGATCCAGCTGG
AC
TGCAGACAGAAGGGGGGCCCTGCCCTGGATAGACGCTCTCCAGAAAGCACCCTCACCCCAACCTTGAA
C
CAGAATGTCTGTAAGGCAGTGGAGGAGACACAGCACCCGCCCACGATACAGGAGATCAAGCAGAAGATT
GAC
AGCTATAACAGCAGGGAGAAGCACTGCCTGGGCATGAAGCTGAGTGAAGATGGCACCTACACAGGTT
TC
ATCAAAGTGCATTTGAAGCTCCGACGGCCAGTGACGGTGCCCGCTGGGATCCGGCCCCAGTCCATCTA
T
GATGCCATTAAGGAAGTGAACCCTGCAGCCACCACAGACAAGCGGACTTCCTTCTACCTGCCACTCGAT
GCC
ATCAAGCAGCTACATATCAGCAGCACCACCACGGTTAGTGAGGTCATCCAGGGGCTGCTCAAGAAGT
TC
ATGGTTGTGGACAACCCACAGAAGTTTGCACTTTTTAAGCGGATACACAAAGATGGACAAGTGCTCTT
C
CAGAAACTCTCCATTGCTGACTATCCTCTCTACCTTCGTCTGCTCGCTGGGCCTGACACCGATGTTCTC
AGC
TTTGTGCTAAAGGAGAATGAAACTGGAGAGGTGGAGTGGGATGCCTTTTCCATTCCTGAACTCCAGA
AC
TTTTTAACTATCCTGGAAAAAGAGGAGCAGGACAAGATCCATCAACTGCAAAAGAAGTACAACAAATT
C
CGTCAGAAACTGGAAGAGGCATTACGAGAGTCCCAAGGGAAGCCGGGGTAA


Translation (413 aa):
MASPAIGQRPYPLLLDPEPPRYLQSLGGTEPPPPARPRRCIPTALIPAAGASEDRGGRRSGRRDPEPTPR
D
CRHARPVRPGLQPRLRLRPGSHRPRDVRSIFEQPQDPRVLAERGEGHRFVELALRGGPGWCDLCGREVL
R
QALRCA
NCKFTCHSECRSLIQLDCRQKGGPALDRRSPESTLTPTLNQNVCKAVEETQHPPTIQEIKQKI
D
SYNSREKHCLGMKL
SEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNPAATTDKRTSFYLPLD
A
IKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQ
VLFQKLSIADYPLYLRLLAGPDTDVL
S
FVLKENETGEVE
WDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQKLEEALRESQGKPG



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser