NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15254.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15254.1 Public Mus musculus 1 Cxcr4 21 106 86 CCDS HistoryNCBI Gene:12767Re-query CCDS DB by CCDS ID:15254.1Re-query CCDS DB by GeneID:12767See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15254.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000052172 ENSMUSP00000053489 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000052172Link to Ensembl Protein Viewer:ENSMUSP00000053489Re-query CCDS DB by Nucleotide ID:ENSMUST00000052172Re-query CCDS DB by Protein ID:ENSMUSP00000053489
Original member Current member EBI,WTSI OTTMUST00000049443 OTTMUSP00000022912 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000049443Link to Vega Protein Viewer:OTTMUSP00000022912Re-query CCDS DB by Nucleotide ID:OTTMUST00000049443Re-query CCDS DB by Protein ID:OTTMUSP00000022912
Original member Current member NCBI NM_009911.3 NP_034041.2 Accepted alive Link to Nucleotide Sequence:NM_009911.3Link to Protein Sequence:NP_034041.2Re-query CCDS DB by Nucleotide ID:NM_009911Re-query CCDS DB by Protein ID:NP_034041Link to BLink:NP_034041.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034041.2 359 P70658-1 359 99.7215% 0 1

Chromosomal Locations for CCDS 15254.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 128588843 128589901 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 128592189 128592209 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1080 nt):
ATGGAACCGATCAGTGTGAGTATATACACTTCTGATAACTACTCTGAAGAAGTGGGTTCTGGAGACTATG
AC
TCCAACAAGGAACCCTGCTTCCGGGATGAAAACGTCCATTTCAATAGGATCTTCCTGCCCACCATCTA
C
TTCATCATCTTCTTGACTGGCATAGTCGGCAATGGATTGGTGATCCTGGTCATGGGTTACCAGAAGAAG
CTA
AGGAGCATGACGGACAAGTACCGGCTGCACCTGTCAGTGGCTGACCTCCTCTTTGTCATCACACTCC
CC
TTCTGGGCAGTTGATGCCATGGCTGACTGGTACTTTGGGAAATTTTTGTGTAAGGCTGTCCATATCAT
C
TACACTGTCAACCTCTACAGCAGCGTTCTCATCCTGGCCTTCATCAGCCTGGACCGGTACCTCGCTATT
GTC
CACGCCACCAACAGTCAGAGGCCAAGGAAACTGCTGGCTGAAAAGGCAGTCTATGTGGGCGTCTGGA
TC
CCAGCCCTCCTCCTGACTATACCTGACTTCATCTTTGCCGACGTCAGCCAGGGGGACATCAGTCAGGG
G
GATGACAGGTACATCTGTGACCGCCTTTACCCCGATAGCCTGTGGATGGTGGTGTTTCAATTCCAGCAT
ATA
ATGGTGGGTCTCGTCCTGCCCGGCATCGTCATCCTCTCCTGTTACTGCATCATCATCTCTAAGCTGT
CA
CACTCCAAGGGCCACCAGAAGCGCAAGGCCCTCAAGACGACAGTCATCCTCATCCTAGCTTTCTTTGC
C
TGCTGGCTGCCATATTATGTGGGGATCAGCATCGACTCCTTCATCCTTTTGGGGGTCATCAAGCAAGGA
TGT
GACTTCGAGAGCATCGTGCACAAGTGGATCTCCATCACAGAGGCCCTCGCCTTCTTCCACTGTTGCC
TG
AACCCCATCCTCTATGCCTTCCTCGGGGCCAAGTTCAAAAGCTCTGCCCAGCATGCACTCAACTCCAT
G
AGCAGAGGCTCCAGCCTCAAGATCCTTTCCAAAGGAAAGCGGGGTGGACACTCTTCCGTCTCCACGGAG
TCA
GAATCCTCCAGTTTTCACTCCAGCTAA


Translation (359 aa):
MEPISVSIYTSDNYSEEVGSGDYDSNKEPCFRDENVHFNRIFLPTIYFIIFLTGIVGNGLVILVMGYQKK
L
RSMTDKYRLHLSVADLLFVITLPFWAVDAMADWYFGKFLCKAVHIIYTVNLYSSVLILAFISLDRYLAI
V
HATNSQRPRKLLAEKAVYVGVWIPALLLTIPDFIFADVSQGDISQGDDRYICDRLYPDSLWMVVFQFQH
I
MVGLVLPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYVGISIDSFILLGVIKQG
C
DFESIVHKWISITEALAFFHCCLNPILYAFLGAKFKSSAQHALNSMSRGSSLKILSKGKRGGHSSVSTE
S
ESSSFHSS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser