NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS14907.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14907.1 Public Mus musculus 1 Rnf149 21 106 86 CCDS HistoryNCBI Gene:67702Re-query CCDS DB by CCDS ID:14907.1Re-query CCDS DB by GeneID:67702See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 14907.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000062525 ENSMUSP00000050388 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000062525Link to Ensembl Protein Viewer:ENSMUSP00000050388Re-query CCDS DB by Nucleotide ID:ENSMUST00000062525Re-query CCDS DB by Protein ID:ENSMUSP00000050388
Original member Current member EBI,WTSI OTTMUST00000051939 OTTMUSP00000024526 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000051939Link to Vega Protein Viewer:OTTMUSP00000024526Re-query CCDS DB by Nucleotide ID:OTTMUST00000051939Re-query CCDS DB by Protein ID:OTTMUSP00000024526
Original member Current member NCBI NM_001033135.3 NP_001028307.2 Accepted alive Link to Nucleotide Sequence:NM_001033135.3Link to Protein Sequence:NP_001028307.2Re-query CCDS DB by Nucleotide ID:NM_001033135Re-query CCDS DB by Protein ID:NP_001028307Link to BLAST:NP_001028307.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001028307.2 394 Q3U2C5-1 394 100% 0 0

Chromosomal Locations for CCDS 14907.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 39552472 39552515 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 39555478 39555670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 39558315 39558411 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 39560693 39560775 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 39564048 39564116 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 39565082 39565332 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 39576827 39577274 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1185 nt):
ATGGCGGCGCGGCGGCGGCCCGCGGCCGGCGTGGGAGCCCGGGACGCACTCGCGGTGCTGGCGCTGGCCT
TG
TGTACTCCCGGGGTGGGCGGCGGGGCGCTCGAGTGGTACTCGGCCATGGTGAGCATCGAATACGTGGA
C
CCGCAGTCGAACCTGACGGTGTGGAGCGTGTCGGAGAGCGGCCGCTTCGGAGAAAGCTCGCTCCGGGAG
GAG
AGGCAGGGCCTGGTGGGCGTCCCGCGCGCGCCCGCGCCCGCGGAGGGCTGCGCGCCCGACACGCGCT
TC
GTGGCGCCCGGCGCCCTCGGCAACGCGCCCTGGGTGGCGCTGGTGGCGCGAGGCGGCTGCACCTTCAA
G
GACAAGGTGCTGGCGGCGGCGCGGAGGAACGCCTCGGCCGTGGTGGTCTACAACCTGGAGAGCAACGGG
AAC
GCCACCGAGCCCATGTCTCACGCGGGAACAGGAAACATAGTCGTCATTATGATTAGCTACCCAAAAG
GA
CGGGAAATTTTTGATCTGGTGCAAAAAGGAATTCCAGTAAAAATGCGGATAGAGATTGGTACTCGTCA
T
ATGCAGGAGTTCATCAGCGGTCAGTCTGTGGTGTTTGTGGCCATCGCCTTCATCACCATGATGATCATC
TCA
TTAGCATGGCTGATATTCTATTATATACAGCGCTTCCTGTATACTGGCTCACAGTTTGGAAGTCAGA
AT
CATAGGAAGGAGACTAAGAAGGTTATTGGCCAGCTCCCTCTACACACTGTGAAGCATGGCGAGAAGGG
A
ATTGATGTCGATGCTGAGAATTGTGCAGTGTGTATTGAAAACTTTAAAGTCAAAGATGTTATCAGAATC
CTG
CCATGCAAGCATATTTTTCATAGAATATGCATTGACCCATGGCTTTTGGATCACCGAACGTGTCCAA
TG
TGTAAACTTGATGTCATCAAAGCCCTGGGATATTGGGGGGACCCTGAGGATACGCAGGAGCTACCCAC
C
CCAGAAGCTGCCCCAGGAAGGGTTTCTGTTGGGAATCTGAGTGTGACATCCCAAGATGAGGAGAGGAGT
GAA
AGCAACCTTCCATCATCTTCCTCGAGCGAGTCTGGGCCACACCGCCCCTGTCTTAAAGAAGATGCAG
GG
GAGGACACAGCATTACTAGGAGCCGGCAGGAGTGAGCCTCAGCATGGAGGATCCATATGCTAG


Translation (394 aa):
MAARRRPAAGVGARDALAVLALALCTPGVGGGALEWYSAMVSIEYVDPQSNLTVWSVSESGRFGESSLRE
E
RQGLVGVPRAPAPAEGCAPDTRFVAPGALGNAPWVALVARGGCTFKDKVLAAARRNASAVVVYNLESNG
N
ATEPMSHA
GTGNIVVIMISYPKGREIFDLVQKGIPVKMRIEIGTRHMQEFISGQSVVFVAIAFITMMII
S
LAWLIFYYIQRFLYTGSQFGSQ
NHRKETKKVIGQLPLHTVKHGEKGIDVDAENCAVCIENFKVKDVIRI
L
PC
KHIFHRICIDPWLLDHRTCPMCKLDVIKALGYWGDPEDTQELPTPEAAPGRVSVGNLSVTSQDEERS
E
SNLPSSSSSESGPHRPCLKEDAGEDTALL
GAGRSEPQHGGSIC



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser