Format
Items per page
Sort by

Send to:

Choose Destination

Links from PubMed

Items: 7

1.
an image of a chemical structure SID 623365

MCP-3; Monocyte chemotactic protein 3; QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL

Source:
NIAID (059204)
Deposit Date:
2004-09-15
Available Date:
2005-03-27
Modify Date:
2015-01-21
SID:
623365
2.
an image of a chemical structure SID 623364

MCP-2; Monocyte chemotactic protein 2; QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

Source:
NIAID (059203)
Deposit Date:
2004-09-15
Available Date:
2005-03-27
Modify Date:
2015-01-21
SID:
623364
4.
an image of a chemical structure SID 621153

OKT4A; Monoclonal antibody directed against CD4 receptor

Source:
NIAID (052008)
Deposit Date:
2004-09-15
Available Date:
2005-03-27
Modify Date:
2010-12-02
SID:
621153
5.
6.
7.
an image of a chemical structure SID 621093

hRANTES; RANTES; RANTES (Human) ...

Source:
NIAID (051947)
Deposit Date:
2004-09-15
Available Date:
2005-03-27
Modify Date:
2015-01-21
SID:
621093
Format
Items per page
Sort by

Send to:

Choose Destination

Supplemental Content

Actions on your results

Find related data

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
Support Center