Display Settings:

Format

Send to:

Choose Destination
HomoloGene:7865. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_077719.2          1   ---MPALRPALLWALLALWLCCAAPAHALQCRDGYEPCVNEGM--CVTYH   45
XP_513697.3          1   --------------------------------SNFSSVLESLL--CMELR   16
XP_001114248.1       1   ---MPALRPALLWALLALWLCRAAPARALQCRDGYEPCVNEGM--CVTYH   45
XP_005630745.1       1   ---MPGLSPARLWALLALGLSCAAPARALQCRDSYEPCVNEGV--CVTYH   45
XP_002686160.2       1   ---MPALRPAPLWALLALWLCRAAPARALQCRDGYEPCVNEGI--CVTYH   45
NP_035058.2          1   ---MPALRPAALRALLWLWLCGAGPAHALQCRGGQEPCVNEGT--CVTYH   45
NP_077334.1          1   ---MPALRPAALRALLWLWLCGAGPAHALQCRGGQEPCVNEGT--CVTYH   45
NP_001238962.1       1   MARGAGPAFAALFGLVLAVLSRAEPAAALQCMDDSKPCVNEGK--CIPYQ   48
NP_001108566.1       1   ----MAEAAAAPRHRFFCHCCKGEIDPKLP---SCDPALKTDLYFCI---   40
XP_002939126.2       1   ----MGAQYVLGLCVLLLGMPGCD---GLQCRGASEPCLNEGK--CITND   41


NP_077719.2         46   NGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQ--AMLGKATCRCA   93
XP_513697.3         17   ---------------FCRTEVP----------------------------   23
XP_001114248.1      46   NGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQ--AMLGKATCRCA   93
XP_005630745.1      46   NGTGYCKCPEGFLGEYCQHRDPCERNRCQNGGTCVAQ--AMLGKATCRCA   93
XP_002686160.2      46   NGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQ--AMLGKATCRCA   93
NP_035058.2         46   NGTGFCRCPEGFLGEYCQHRDPCEKNRCQNGGTCVPQ--GMLGKATCRCA   93
NP_077334.1         46   NGTGYCRCPEGFLGEYCQHRDPCEKNRCQNGGTCVTQ--AMLGKATCRCA   93
NP_001238962.1      49   NGTGYCKCREGYLGDYCQYRNPCESNTCKNGGTCETT--SLIGKATCKCA   96
NP_001108566.1      41   ECTSMVRCAPGFLGEYCHHSDPCNLLYCKNGGECKVSVAGVPGSPSCVCP   90
XP_002939126.2      42   DGSAYCKCTDAFVGKYCQLQNPCQETICLNGGTCKVS--SDLSKGVCTCA   89


NP_077719.2         94   SGFTGEDCQYSTSHPCFVSRPCLNG-GTCHMLSRDTYECTCQVGFTGKEC   142
XP_513697.3         24   -GMICSDTERDET-------PELRGLGDC---------------------   44
XP_001114248.1      94   SGFTGEDCQYSTSHPCFVSRPCLNG-GTCHMLSRDTYECTCQVGFTGKEC   142
XP_005630745.1      94   LGFTGDDCQYSTTHPCFVSHPCLNG-GTCHMHSRDDYECTCQVGFTGKLC   142
XP_002686160.2      94   PGFTGEDCQHSTTHPCFVSHPCLNG-GTCHVLSRDTYECTCQVGFTGKLC   142
NP_035058.2         94   PGFTGEDCQYSTSHPCFVSRPCQNG-GTCHMLSRDTYECTCQVGFTGKQC   142
NP_077334.1         94   PGFTGEDCQYSTSHPCFVSRPCQNG-GTCHMLSWDTYECTCQVGFTGKQC   142
NP_001238962.1      97   PGFTGEDCQYSESHICYVSQPCLNG-GTCHPHSQETYECVCPPGYTGKDC   145
NP_001108566.1      91   LGFAGEHCEIQKNSTCYPNNPCTNG-GKCLLLPNDQYKCQCALGWTGQHC   139
XP_002939126.2      90   PGFGGENCKQPVANVCSLTQPCMNG-GTCRLLTLELYDCICPFGWRGNDC   138


NP_077719.2        143   QWTDACLSHPCANGSTCTTVANQ-FSCKCLTGFTGQKCETDVNECDIPGH   191
XP_513697.3         45   -WLERAL------------IKSN-FPLK----------------------   58
XP_001114248.1     143   QWTDACLSHPCANGSTCTTVANQ-FSCKCLTGFTGQKCETDVNECDIPGH   191
XP_005630745.1     143   QWTDACLSHPCANGSTCTTVANQ-FSCKCLTGFTGQKCEIDVNECDIPGQ   191
XP_002686160.2     143   QWTDACLSHPCANGSTCTTMANQ-FSCTCLAGFTGQKCETDVNECDIPGQ   191
NP_035058.2        143   QWTDACLSHPCENGSTCTSVASQ-FSCKCPAGLTGQKCEADINECDIPGR   191
NP_077334.1        143   QWTDVCLSHPCENGSTCSSVANQ-FSCRCPAGITGQKCDADINECDIPGR   191
NP_001238962.1     146   QWIDACTSQPCANGSTCTVSGHK-FSCICQSGYTGQKCEIDVNECATSGL   194
NP_001108566.1     140   EQEDACLSSPCANKGICNALPNREYSCTCAPGFHGSRCLNDTDECVDPLV   189
XP_002939126.2     139   KFIDACASQPCANGSTCIPNENQ-YTCSCQAGYTGLKCEVDVNECGPPGM   187


NP_077719.2        192   CQHGGTCLNLPGSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGD   241
XP_513697.3              --------------------------------------------------
XP_001114248.1     192   CQHGGTCLNLPGSYQCQCPQGFTGQHCDSLYVPCAPSPCVNGGTCRQTGD   241
XP_005630745.1     192   CQHGGTCLNLPGSYQCQCPQGFTGKHCDSPYVPCAPSPCVNGGTCRQTGD   241
XP_002686160.2     192   CQHGGTCLNLPGSYQCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTGD   241
NP_035058.2        192   CQHGGTCLNLPGSYRCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTGD   241
NP_077334.1        192   CQHGGTCLNLPGSYRCQCPQRFTGQHCDSPYVPCAPSPCVNGGTCRQTGD   241
NP_001238962.1     195   CHHGGTCINLPGSFRCQCKPGYTGHRCESNYVPCSPSPCMNGGTCHQTSD   244
NP_001108566.1     190   CKNKGVCVNTIGSYRCNCQPGFTGLDCGSPYFPCSPSPCQNGGTCRQTTE   239
XP_002939126.2     188   CKNGGTCENLPGSYRCQCHPGYTGQRCESPFIPCSPSPCMNGGTCRQTSE   237


NP_077719.2        242   FTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWT   291
XP_513697.3              --------------------------------------------------
XP_001114248.1     242   FTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWT   291
XP_005630745.1     242   FTFECNCLPGFEGITCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWT   291
XP_002686160.2     242   FTFECSCLPGFEGVTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWT   291
NP_035058.2        242   FTFECNCLPGFEGSTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWT   291
NP_077334.1        242   FTSECHCLPGFEGSNCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWT   291
NP_001238962.1     245   FTFECNCLPGFKGSICEKNVDDCPNHNCQNGGICVDGVNTYNCRCPPQWT   294
NP_001108566.1     240   TTYVCHCLPGFNGTNCEVNIDDCPDHRCQNGATCMDGVNTYNCQCPPEWT   289
XP_002939126.2     238   FAYECNCLPGFDGKNCETNIDDCPSHKCQNGGTCVDGVNTYNCRCPPQWT   287


NP_077719.2        292   GQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDD   341
XP_513697.3         59   GQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDD   108
XP_001114248.1     292   GQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDD   341
XP_005630745.1     292   GQFCTEDVDECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDD   341
XP_002686160.2     292   GQFCTEDVDECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDD   341
NP_035058.2        292   GQFCTEDVDECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDD   341
NP_077334.1        292   GQFCTEDVDECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDD   341
NP_001238962.1     295   GQFCTEDVDECQLQPNACQNGGTCTNHNGGYACVCVNGWSGDDCSKNIDD   344
NP_001108566.1     290   GQFCTDDVDECRLQPNACQNGGTCSNTRNGYNCVCVNGWSGLDCSENIDD   339
XP_002939126.2     288   GQFCTEDVDECQLQPNACQNGGTCTNSNGGYNCVCVNGWSGDDCSQNIDD   337


NP_077719.2        342   CAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCD   391
XP_513697.3        109   CAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCD   158
XP_001114248.1     342   CAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCD   391
XP_005630745.1     342   CAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCD   391
XP_002686160.2     342   CAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCD   391
NP_035058.2        342   CAYASCTPGSTCIDRVASFSCLCPEGKAGLLCHLDDACISNPCHKGALCD   391
NP_077334.1        342   CAFASCTPGSTCIDRVASFSCLCPEGKAGLLCHLDDACISNPCHKGALCD   391
NP_001238962.1     345   CFTASCANGSTCIDRVASFSCICPEGKAGLLCHLDDACVSNPCQKGALCD   394
NP_001108566.1     340   CAAEPCTAGSTCIDRVASFVCSCPPGKTGLLCHIDDACISNPCKMGAHCD   389
XP_002939126.2     338   CATAACANGSTCIDRVASFICVCPEGKIGLLCHKNDACFSNPCHMGSLCD   387


NP_077719.2        392   TNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFH   441
XP_513697.3        159   TNPLNGQYICTCPQGYKGADCTEDVDECSMANSNPCEHAGKCVNTDGAFH   208
XP_001114248.1     392   TNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFH   441
XP_005630745.1     392   TNPLNGQYICTCPQGFKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFH   441
XP_002686160.2     392   TNPLNGQYICTCPQGYKGSDCTEDVDECAMANSNPCEHAGKCVNTDGAFH   441
NP_035058.2        392   TNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFH   441
NP_077334.1        392   TNPLNGQYICTCPQAYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFH   441
NP_001238962.1     395   TNPVNGHYICTCPQGHKGADCTEDVDECAMANSNPCEHAGKCVNTEGSFH   444
NP_001108566.1     390   TNPVNGKFSCNCPSGYKGSTCAEDIDEC-VIGPNPCEHGGSCKNTEGSFT   438
XP_002939126.2     388   TNPLTGQAICTCPSGYKGTACTEDIDECSLVNSNPCEHAGKCVNTEGSFY   437


NP_077719.2        442   CECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHC   491
XP_513697.3        209   CECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHC   258
XP_001114248.1     442   CECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHC   491
XP_005630745.1     442   CECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHC   491
XP_002686160.2     442   CECLKGYAGPRCEMDINECHSDPCKNDATCLDKIGGFTCLCMPGFKGVHC   491
NP_035058.2        442   CECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHC   491
NP_077334.1        442   CECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHC   491
NP_001238962.1     445   CECLKGYTGPRCEMDINECHSNPCQNDATCLDKIGGFTCLCMPGFKGVHC   494
NP_001108566.1     439   CNCAPGYTGPRCEQDINECGSNPCQNDATCLDQIGDYTCICMPGFDGTHC   488
XP_002939126.2     438   CECSKGFTGPRCEMDINECLSEPCQNDATCLDKIGGFTCLCMPGYKGIHC   487


NP_077719.2        492   ELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPC   541
XP_513697.3        259   ELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPC   308
XP_001114248.1     492   ELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPC   541
XP_005630745.1     492   ELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPC   541
XP_002686160.2     492   ELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPC   541
NP_035058.2        492   ELEVNECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPC   541
NP_077334.1        492   ELEVNECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPC   541
NP_001238962.1     495   EEDIDECLSNPCVNNGECLDKVNRFLCVCPPGFSGAVCQIDIDDCSSTPC   544
NP_001108566.1     489   ENDINECLSSPCLNNGRCLDQVSRFVCECPQGFTGETCQVDIDECASTPC   538
XP_002939126.2     488   EIEINECLSNPCVNNGECVDKVNRFVCICPPGFTGSVCQIDIDDCSSTPC   537


NP_077719.2        542   LNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSY   591
XP_513697.3        309   LNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSY   358
XP_001114248.1     542   LNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSY   591
XP_005630745.1     542   LNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSY   591
XP_002686160.2     542   LNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSY   591
NP_035058.2        542   LNGAKCIDHPNGYECQCATGFTGILCDENIDNCDPDPCHHGQCQDGIDSY   591
NP_077334.1        542   LNGAKCIDHPNGYECQCATGFTGTLCDENIDNCDPDPCHHGQCQDGIDSY   591
NP_001238962.1     545   LNGAKCIDHPNGYECQCATGFTGVLCEENINNCDPDPCHHGECQDGIDSY   594
NP_001108566.1     539   HNGAKCLDRPNGYECECAEGFTGPLCMENINDCEPQPCHHGKCIDGIATF   588
XP_002939126.2     538   QNGAKCVDHPSGYDCICATGFTGVLCEENINNCEPPPCHYGTCQDGIDSY   587


NP_077719.2        592   TCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVN   641
XP_513697.3        359   TCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVN   408
XP_001114248.1     592   TCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVN   641
XP_005630745.1     592   TCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVN   641
XP_002686160.2     592   TCICNPGYMGAICSDQIDECYSSPCLNEGRCIDLVNGYQCNCQPGTSGVN   641
NP_035058.2        592   TCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGLN   641
NP_077334.1        592   TCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGLN   641
NP_001238962.1     595   TCICNPGYMGAICSEQINECHSNPCLHQGRCIDLVNGYQCNCLPGTSGVN   644
NP_001108566.1     589   HCDCLPGYMGPICSEQIRECQSDPCQNGGRCVDMVNRYQCNCQPGTAGEN   638
XP_002939126.2     588   TCICEPGYMGAICSDQIDECLSNPCLNEGRCVDLVNGYQCNCLPGTSGPR   637


NP_077719.2        642   CEINFDDCASNPCIHGICMDGINRYSCVCSPGFTGQRCNIDIDECASNPC   691
XP_513697.3        409   CEINFDDCASNPCIHGNCMDGINRYSCVCSPGFTGQRCNIDIDECASNPC   458
XP_001114248.1     642   CEINFDDCASNPCIHGICMDGINRYSCVCSPGFTGQRCNIDIDECASNPC   691
XP_005630745.1     642   CEINFDDCASNPCVHGVCMDGINRYSCVCSPGFTGQRCNIDIDECASNPC   691
XP_002686160.2     642   CEINFDDCASNPCVHGVCMDGVNRYSCVCSPGFTGQRCNIDIDECASNPC   691
NP_035058.2        642   CEINFDDCASNPCMHGVCVDGINRYSCVCSPGFTGQRCNIDIDECASNPC   691
NP_077334.1        642   CEINFDDCASNPCLHGACVDGINRYSCVCSPGFTGQRCNIDIDECASNPC   691
NP_001238962.1     645   CENNFDDCASNPCVHGDCIDGINRYNCACKPGFTGPRCNVDIDECASSPC   694
NP_001108566.1     639   CQINYDDCASNPCQHGTCEDGINEYKCVCEPGYTGERCADEINECSSNPC   688
XP_002939126.2     638   CEKNVDDCASNPCTYGNCVDGINRYDCVCSPGFTGPQCKDDIDECASNPC   687


NP_077719.2        692   RKGATCINGVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGY   741
XP_513697.3        459   RKGATCINGVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGY   508
XP_001114248.1     692   RKGATCINGVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGY   741
XP_005630745.1     692   RKGATCINDVNGFRCLCPEGPHRPSCYSQVNECLSSPCIHGNCTGGPSGY   741
XP_002686160.2     692   RKGATCINDVNGFRCICPEGPHHPSCYSQVNECLSNPCVHGNCTGGLTGY   741
NP_035058.2        692   RKGATCINDVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGY   741
NP_077334.1        692   RKDATCINDVNGFRCMCPEGPHHPSCYSQVNECLSSPCIHGNCTGGLSGY   741
NP_001238962.1     695   NNGGTCINEVNGFRCVCPEGYHHPHCQSQADGCLSNPCVHGNCTHIVSGY   744
NP_001108566.1     689   QSGGTCEDKVNGFKCKCPVGTYGPLCLSGADRCIRMPCRHGECIGKQEGY   738
XP_002939126.2     688   HNGGTCVNEQNRFRCICPEGFRQPSCFSQVDECVNNPCIHGNCTDDVNGY   737


NP_077719.2        742   KCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYN   791
XP_513697.3        509   KCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYN   558
XP_001114248.1     742   KCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYN   791
XP_005630745.1     742   KCLCDAGWIGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYN   791
XP_002686160.2     742   KCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYN   791
NP_035058.2        742   KCLCDAGWVGVNCEVDKNECLSNPCQNGGTCNNLVNGYRCTCKKGFKGYN   791
NP_077334.1        742   KCLCDAGWVGINCEVDKNECLSNPCQNGGTCNNLVNGYRCTCKKGFKGYN   791
NP_001238962.1     745   KCVCDPGWIGDYCSTEGNECKSNPCQNGGTCEDLLNGYRCTCRKGFKGVN   794
NP_001108566.1     739   LCQCEPGWEGTNCDQEKNECLSNPCQNGGTCNDRLNDYTCVCARGFAGFN   788
XP_002939126.2     738   KCLCQPGWTGKKCEVDKNECLSNPCQNGGTCDNLVNGYRCSCKKGFKGYN   787


NP_077719.2        792   CQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNP   841
XP_513697.3        559   CQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNP   608
XP_001114248.1     792   CQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNP   841
XP_005630745.1     792   CQVNIDECASNPCLNQGTCFDNISGYTCHCVLPYTGKNCQTVLAPCSPNP   841
XP_002686160.2     792   CQVNIDECASNPCLNQGTCLDDVSGYTCHCVLPYTGKNCQTVLAPCSPNP   841
NP_035058.2        792   CQVNIDECASNPCLNQGTCFDDVSGYTCHCMLPYTGKNCQTVLAPCSPNP   841
NP_077334.1        792   CQVNIDECASNPCLNQGTCLDDVSGYTCHCMLPYTGKNCQTVLAPCSPNP   841
NP_001238962.1     795   CQV--------------------------------------VVAPCSPDP   806
NP_001108566.1     789   CEININECESNPCMNQGTCVDGVNSYVCHCKPPYTGKHCLEKLIPCASQP   838
XP_002939126.2     788   CQIDIDECASNPCLNHGTCRDGINGYTCHCGLPYTGTNCQNILTPCSPEP   837


NP_077719.2        842   CENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNT   891
XP_513697.3        609   CENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNT   658
XP_001114248.1     842   CENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNT   891
XP_005630745.1     842   CENAAVCKEAPDFESYTCLCAPGWQGQRCTIDIDECVSKPCMNHGLCHNT   891
XP_002686160.2     842   CENAGVCKEAPNFESYSCLCAPGWQGQRCTIDIDECVSKPCMNHGLCHNT   891
NP_035058.2        842   CENAAVCKEAPNFESFSCLCAPGWQGKRCTVDVDECISKPCMNNGVCHNT   891
NP_077334.1        842   CENAAVCKEAPNFESFTCLCAPGWQGQRCTVDVDECVSKPCMNNGICHNT   891
NP_001238962.1     807   CENSGICQESPDSEGYTCQCAPGWEGERCTVDIDECLSKPCKNHALCHNI   856
NP_001108566.1     839   CQRRGVCQPSLDYTSYTCKCHSGWEGAQCTEDKDECKKSPCQNGARCVNI   888
XP_002939126.2     838   CHNGGICQESEDFKSFSCLCATGWHGQRCTIDIDECITNPCKNYGRCQNT   887


NP_077719.2        892   QGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGF   941
XP_513697.3        659   QGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCVDGVNTFSCLCLPGF   708
XP_001114248.1     892   QGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCVDGVNTFSCLCLPGF   941
XP_005630745.1     892   QGSYMCECPPGFSGMDCEDDIDDCLANPCQNGGSCVDGVNTFSCLCHPGF   941
XP_002686160.2     892   QGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCVDGVNTFSCLCLPGF   941
NP_035058.2        892   QGSYVCECPPGFSGMDCEEDINDCLANPCQNGGSCVDHVNTFSCQCHPGF   941
NP_077334.1        892   QGSYMCECPPGFSGMDCEEDINDCLANPCQNGGSCVDKVNTFSCLCLPGF   941
NP_001238962.1     857   QGSYLCECRPGFTGGDCDSNIDDCLSNPCQNGASCVDGINSFSCICLPGF   906
NP_001108566.1     889   VGSYRCECPPGYSGDNCQTNIDDCSSNPCRNGGTCVDKVGRYLCECRAGF   938
XP_002939126.2     888   KGGYICHCFEGFNGVNCENNIDDCLSNPCQNGASCVDGINTFSCNCLAGF   937


NP_077719.2        942   TGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNINEC   991
XP_513697.3        709   TGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNINEC   758
XP_001114248.1     942   TGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNIDEC   991
XP_005630745.1     942   IGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNIDEC   991
XP_002686160.2     942   TGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCPAGFDGVHCENNIDEC   991
NP_035058.2        942   IGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCTCPAGFHGVHCENNIDEC   991
NP_077334.1        942   VGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCTCPAGFHGVHCENNIDEC   991
NP_001238962.1     907   HGDKCQTDTNECLSEPCRNGGTCTHYVNSYTCKCQPGFEGTNCENNIDEC   956
NP_001108566.1     939   YGERCEEEVDECASNPCWNGGHCTDYVNSYTCQCPPGYDGINCERDIPDC   988
XP_002939126.2     938   HGDKCQKDVDECASNPCKNGGSCTDYVNSYTCKCQPGFDGIHCDNNIDEC   987


NP_077719.2        992   TESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCV   1041
XP_513697.3        759   TESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCV   808
XP_001114248.1     992   TESSCFNGGTCVDGINSFSCLCPVGFTGLFCLHEINECSSHPCLNEGTCV   1041
XP_005630745.1     992   TESSCFNGGTCVDGINSFSCLCPLGFTGPFCLHEINECNSHPCLNEGICV   1041
XP_002686160.2     992   TESSCFNGGTCIDGINSFSCLCPVGFTGSFCLHEINECNSHPCLNEGVCV   1041
NP_035058.2        992   TESSCFNGGTCVDGINSFSCLCPVGFTGPFCLHDINECSSNPCLNAGTCV   1041
NP_077334.1        992   TESSCFNGGTCVDGINSFSCLCPVGFTGPFCLHDINECSSNPCLNSGTCV   1041
NP_001238962.1     957   TESSCFNGGTCVDGINSFTCQCPVGFTGPFCLMEINECDSHPCLNKGSCV   1006
NP_001108566.1     989   TETSCLNNGTCVDGINHFSCRCRQGFSGQYCQFELNECDSHPCKNGGTCI   1038
XP_002939126.2     988   TDTSCFNGATCVDGINSFTCQCPQGFTGQFCLFEINECGSHPCINGGTCV   1037


NP_077719.2       1042   DGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPS   1091
XP_513697.3        809   DGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPS   858
XP_001114248.1    1042   DGLGTYHCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCIQDKAESRCRCPS   1091
XP_005630745.1    1042   DGLGTYRCTCPLGYTGKNCQTLVNLCSRSPCKNKGTCIQEKAESRCLCPS   1091
XP_002686160.2    1042   DGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCIQDKAESRCLCPS   1091
NP_035058.2       1042   DGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCVQEKARPHCLCPP   1091
NP_077334.1       1042   DGLGTYRCTCPLGYTGKNCQTLVNLCSPSPCKNKGTCAQEKARPRCLCPP   1091
NP_001238962.1    1007   DSLGKYRCICPLGYTGKNCQTPMDLCSKSPCKNKGTCFQSGAQTRCDCPS   1056
NP_001108566.1    1039   DGLGTFHCNCPLMYNGKTCESMVNLCSQIKCQNGGTCIQKEINWRCSCQP   1088
XP_002939126.2    1038   DGMGTYHCTCPVGYRGKNCEELVDLCSGFPCKNRGICKQVKTEPKCICPT   1087


NP_077719.2       1092   GWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLGY   1141
XP_513697.3        859   GWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLGY   908
XP_001114248.1    1092   GWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLGY   1141
XP_005630745.1    1092   GWAGAYCDVPNVSCEVAALHRGVSTDHLCQHSGICINAGNSHHCQCPLGY   1141
XP_002686160.2    1092   GWAGAYCDVPSVSCEVAASHRGVPVDRLCQHSGVCISAGNSHHCQCPLGY   1141
NP_035058.2       1092   GWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGICINAGNTHHCQCPLGY   1141
NP_077334.1       1092   GWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGICINAGNTHHCQCPLGY   1141
NP_001238962.1    1057   GWTGAYCDVPNVSCQVAASQRGITVDQLCQHSGHCLNVGNTHRCQCRVGY   1106
NP_001108566.1    1089   GWTGLYCDIPSMSCHAVALNKGVAENMVCKHAGHCKNIGNTHQCECQKGY   1138
XP_002939126.2    1088   GWTGIYCDIPDVSCEVAASQRGVAVQDLCQHAGICINTGFSHRCQCRQGY   1137


NP_077719.2       1142   TGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDEC   1191
XP_513697.3        909   TGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDEC   958
XP_001114248.1    1142   TGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDEC   1191
XP_005630745.1    1142   TGSYCEEQLDECSSNPCQHGATCRDFIGGYRCECVPGYQGVNCEYEVDEC   1191
XP_002686160.2    1142   TGSYCEDQLDECSSNPCQHGATCRDFIGGYRCECVPGYQGVNCEYEVDEC   1191
NP_035058.2       1142   TGSYCEEQLDECASNPCQHGATCNDFIGGYRCECVPGYQGVNCEYEVDEC   1191
NP_077334.1       1142   TGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDEC   1191
NP_001238962.1    1107   TGSYCEEQLDECDSSPCQNGATCRDHLGGYQCECVPGYQGVNCEYEVDEC   1156
NP_001108566.1    1139   TGSYCETEIDECLSSPCRNGGTCVDYQGGYDCKCKAGFQGVNCEYNVNEC   1188
XP_002939126.2    1138   IGSYCEGELDECASNPCQNSATCVDRHGGYECKCLPGYQGVNCEYEIDEC   1187


NP_077719.2       1192   QNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDDC---ARGPHCLNG   1238
XP_513697.3        959   QNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDDC---ARGPHCLNG   1005
XP_001114248.1    1192   QNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDDC---ARGPHCLNG   1238
XP_005630745.1    1192   QNQPCQNGGTCVDLVNHFKCSCPPGTRGLLCEENIDDC---VGGPHCLNG   1238
XP_002686160.2    1192   QNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENVDDC---ARGPHCLNG   1238
NP_035058.2       1192   QNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDEC---AGGPHCLNG   1238
NP_077334.1       1192   QNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDDC---AGAPHCLNG   1238
NP_001238962.1    1157   QFQPCQNGGTCIDLVNHFRCSCPPGTRGRLCEENVDDCISESGGPRCFNG   1206
NP_001108566.1    1189   QSNPCRNGGTCIDLINHFSCSCPPGTKGLQCEVDVDECAP-EFGPRCKNG   1237
XP_002939126.2    1188   QIQPCHNGGTCVDLVNQFRCSCPPGTRGPLCEENIDDCAPSSEGPHCFNG   1237


NP_077719.2       1239   GQCMDRIGGYSCRCLPGFAGERCEGDINECLSNPCSSEGSLDCIQLTNDY   1288
XP_513697.3       1006   GQCMDRIGGYSCRCLPGFAGERCEGDINECLSNPCSSEGSLDCIQLTNDY   1055
XP_001114248.1    1239   GQCVDRIGGYSCRCLPGFAGERCEGDINECLSNPCSSEGSLDCIQLTNDY   1288
XP_005630745.1    1239   GQCVDRIGGYSCRCLPGFAGERCEGDINECLSNPCSSEGSLDCIQLTNDY   1288
XP_002686160.2    1239   GQCVDRIGGYSCRCLPGFAGERCEGDINECLSNPCSSEGSLDCIQLTNDY   1288
NP_035058.2       1239   GQCVDRIGGYTCRCLPGFAGERCEGDINECLSNPCSSEGSLDCVQLKNNY   1288
NP_077334.1       1239   GQCVDRIGGYSCRCLPGFAGERCEGDINECLSNPCSSEGSLDCIQLKNNY   1288
NP_001238962.1    1207   GQCIDQIGGYSCLCLPGFAGERCEGDINECLSNPCNPRGSLDCIQLINDY   1256
NP_001108566.1    1238   GQCVDGVGRYTCNCPPGFAGEHCEGDVNECRSGPCYSPGTIDCVPLINSY   1287
XP_002939126.2    1238   GRCLDKIGGYSCECLPGFAGERCEGDVNECLSNPCSAKGSLDCIQLDNNY   1287


NP_077719.2       1289   LCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNMPDGFICRCPPGFS   1338
XP_513697.3       1056   LCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNMPDGFICRCPPGFS   1105
XP_001114248.1    1289   LCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNMPDGFICRCPPGFS   1338
XP_005630745.1    1289   LCVCRSAFTGRHCETFIDVCPQMPCLNGGTCAVASNMPDGFICRCPPGFS   1338
XP_002686160.2    1289   LCVCRSTFTGRHCETFVDVCPQMPCLNGGTCAVASNMPDGFICRCPPGFS   1338
NP_035058.2       1289   NCICRSAFTGRHCETFLDVCPQKPCLNGGTCAVASNMPDGFICRCPPGFS   1338
NP_077334.1       1289   QCVCRSAFTGRHCETFLDVCPQKPCLNGGTCAVASNVPDGFICRCPPGFS   1338
NP_001238962.1    1257   TCICRSAFTGRHCESVIDVCPRKPCQNGGTCAVASNMPDGFICQCPPGYS   1306
NP_001108566.1    1288   QCRCRLGYTGQRCESMVDLCQSKPCHNNGRCTTNSSSVHGYICTCPPGFS   1337
XP_002939126.2    1288   LCKCKPGFTGRHCETIQDLCPTRPCLNGGTCAVAVNMPEGFTCQCPPGFS   1337


NP_077719.2       1339   GARCQ----SSCGQVKCRKGEQCVHTASGPRCFCPS---PRDCE--SGCA   1379
XP_513697.3       1106   GARCQ----SSCGQVKCRKGEQCVHTASGPRCFCPS---PRDCE--SGCA   1146
XP_001114248.1    1339   GARCQ----SSCGQVKCRKGEQCVHTASGPRCFCPN---PRDCE--SGCA   1379
XP_005630745.1    1339   GAKCQ----SSCGQVKCRRGEQCVHTASGPRCFCPN---PQDCE--SGCA   1379
XP_002686160.2    1339   GARCQ----SSCGQVKCRRGEQCVHTASGPRCFCPN---PQDCD--SGCA   1379
NP_035058.2       1339   GARCQ----SSCGQVKCRRGEQCIHTDSGPRCFCLN---PKDCE--SGCA   1379
NP_077334.1       1339   GARCQ----SSCGQVKCRRGEQCVHTASGPHCFCPN---HKDCE--SGCA   1379
NP_001238962.1    1307   GAKCEFSSHSTCGQVKCKKGEQCIHTSSGPRCYCPRLAVGEECQTNTGCA   1356
NP_001108566.1    1338   GFNCGNYEMFPCASLRCLNGGQCVEIKSRPQCHCPVGFTGTHCE--MLTN   1385
XP_002939126.2    1338   GSKCQYSN-NTCGHYKCKVGENCIKTPLGPRCYCPTGPAGNACQSKLGCT   1386


NP_077719.2       1380   SSPCQHGGSCHPQRQPPYYSCQCAPPFSGSRCELYTAPPSTPPATCLSQY   1429
XP_513697.3       1147   SSPCQHGGSCHPQRQPPYYSCQCAPPFSGSRCELYTAPPSTPPATCLSQY   1196
XP_001114248.1    1380   SSPCQHGGSCHPQRQPPYYSCQCAPPFWGSRCELYTAPPSTPPATCLSQY   1429
XP_005630745.1    1380   SSPCQHGGSCYPQRQPPYYSCQCSPPFWGSHCELYMAPTSTPPATCLSQY   1429
XP_002686160.2    1380   SSPCQHGGSCYPQRQPPYYSCQCAPPFRGSHCELYTAPTSTPPATCLSQY   1429
NP_035058.2       1380   SNPCQHGGTCYPQRQPPHYSCRCPPSFGGSHCELYTAPTSTPPATCQSQY   1429
NP_077334.1       1380   SNPCQHGGTCYPQRQPPYYSCRCSPPFWGSHCESYTAPTSTPPATCLSQY   1429
NP_001238962.1    1357   SAPCQNGGSCHPRSQPPYYYCQCPAHAQGSQCEQLVHP-SQEPLGCLDSQ   1405
NP_001108566.1    1386   HCVCQNGGTCMP-DESNKFSCRCPPGFSGETCQ-------ETPPSCPYPD   1427
XP_002939126.2    1387   SQPCKNNGVCQRKDQPPYYTCNCPNGIVGLQCEILLID------GCHLHH   1430


NP_077719.2       1430   CADKARDGVCDEACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYI-NN   1478
XP_513697.3       1197   CADKARDGVCDEACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYI-NN   1245
XP_001114248.1    1430   CADKARDGVCDEACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYI-NN   1478
XP_005630745.1    1430   CADKARDGVCDEACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYI-NN   1478
XP_002686160.2    1430   CADKARDGICDDVCNSHACQWDGGDCSLTMEDPWANCSSPLPCWEYI-NN   1478
NP_035058.2       1430   CADKARDGICDEACNSHACQWDGGDCSLTMEDPWANCTSTLRCWEYI-NN   1478
NP_077334.1       1430   CADKARDGICDEACNSHACQWDGGDCSLTMEDPWANCTSSLRCWEYI-NN   1478
NP_001238962.1    1406   CAEKARDGYCDEDCNTHACQWDGGDCSLTMEDPWANCSSSLRCWMLF-NG   1454
NP_001108566.1    1428   CEQRAGDKVCDLRCKNPECDWDGSDCTLHWDKPWKNCKASVSCPDLFHNG   1477
XP_002939126.2    1431   CPDKARDGYCDQECNTHECLWDGGDCSLTMEDPWANCSSSLKCWEYF-NG   1479


NP_077719.2       1479   QCDELCNTVECLFDNFECQGNSK--TCKYDKYCADHFKDNHCDQGCNSEE   1526
XP_513697.3       1246   QCDELCNTVECLFDNFECQGNSK--TCKYDKYCADHFKDNHCDQGCNSEE   1293
XP_001114248.1    1479   QCDELCNTAECLFDNFECQGNSK--TCKYDKYCADHFKDNHCDQGCNSEE   1526
XP_005630745.1    1479   QCDELCNTAECLFDNFECQGNSK--TCKYDKYCADHFKDNHCDQGCNSEE   1526
XP_002686160.2    1479   QCDELCNTAECLFDNFECQKSSK--TCKYDKYCADHYEDNHCDQGCNSEE   1526
NP_035058.2       1479   QCDEQCNTAECLFDNFECQRNSK--TCKYDKYCADHFKDNHCDQGCNSEE   1526
NP_077334.1       1479   QCDELCNTAECLFDNFECQRNSK--TCKYDKYCADHFKDNHCDKGCNNEE   1526
NP_001238962.1    1455   QCDEFCNTPECLFDNFECQQNSR--MCKYDKYCADHYGDGRCDQGCNSEE   1502
NP_001108566.1    1478   RCDPECNNAGCLFDSFECDKHSSVGICKYDKYCADHYANGHCNQGCNTEA   1527
XP_002939126.2    1480   QCDELCNTPECLFDNFECQEKES--ICKYDKYCEDHYANGHCDKSCNTKE   1527


NP_077719.2       1527   CGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTN   1576
XP_513697.3       1294   CGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTN   1343
XP_001114248.1    1527   CGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTN   1576
XP_005630745.1    1527   CGWDGLDCAADRPENLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTN   1576
XP_002686160.2    1527   CGWDGLDCAADRPENLAEGTLVIVVLMPPEQLLQDARRFLRALGTLLHTN   1576
NP_035058.2       1527   CGWDGLDCASDQPENLAEGTLIIVVLLPPEQLLQDSRSFLRALGTLLHTN   1576
NP_077334.1       1527   CGWDGLDCAADQPENLAEGILVIVVLLPPEQLLQDSRSFLRALGTLLHTN   1576
NP_001238962.1    1503   CGWDGLDCAGDKAERLAEGTLIIVVLMRPDELLRDVRSFLRTLGTLLHTN   1552
NP_001108566.1    1528   CGWDGLDCARDTPPKLANGTLVIVVLLQPKELLADLKGFLRSLGTLLHTN   1577
XP_002939126.2    1528   CGWDGLDCSTDKPENLAEGTLVIVVLMPPKELLKNSRNFLRELGSILRTN   1577


NP_077719.2       1577   LRIKRDSQGELMVYPYYGEKSAA-MKKQRMTRRSLPG--EQEQEVAGSKV   1623
XP_513697.3       1344   LRIKRDSQGELMVYPYYGEKSAA-MKKQRMTRRSLPG--EQEQEVAGSKV   1390
XP_001114248.1    1577   LRIKRDSQGELMVYPYYGEKSAA-MKKQRMTRRSIPG--EQEQEVAGSKV   1623
XP_005630745.1    1577   LHIKRDSQGALMVYPYYGEKSAA-TKKQRMTRRSLPG--DQEQEVAGSKV   1623
XP_002686160.2    1577   LRIKRSAQGELMVYPYYGGKSAA-MKKQRLTRRSLPG--DEEQEVAGSQV   1623
NP_035058.2       1577   LRIKQDSQGALMVYPYFGEKSAA-MKKQKMTRRSLPEEQEQEQEVIGSKI   1625
NP_077334.1       1577   LRIKQDSQGALMVYPYYGEKSAA-MKKQKVARRSLPD--EQEQEIIGSKV   1623
NP_001238962.1    1553   LRIKLDSQGNPMVFPYYGEKSAA-RSRRSVVVVRKHR--ELEQEVIGTRV   1599
NP_001108566.1    1578   LQVKLDEHNKLMVYPFYRNEQNEIQNEIAAMKQRGKR--ELENEIIGSRV   1625
XP_002939126.2    1578   LRIKRNPDGSPMVFPYFREKSSAQRSRRSLLELRVVR--ELEEQPIGSKV   1625


NP_077719.2       1624   FLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTP   1673
XP_513697.3       1391   FLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTP   1440
XP_001114248.1    1624   FLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTP   1673
XP_005630745.1    1624   FLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLNP   1673
XP_002686160.2    1624   FLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTP   1673
NP_035058.2       1626   FLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVFSELESP   1675
NP_077334.1       1624   FLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVVSESEDP   1673
NP_001238962.1    1600   FLEIDNRQCAEDSEQCFHNTEAAAALLAAQAIKGMLPYPFVSVQSEPLLP   1649
NP_001108566.1    1626   HLEIDNRLCTQNSDECISSADQAAAFIAAEYLKSDLPYPIYSITTKPPKE   1675
XP_002939126.2    1626   SLEIDNQQCVLDSDQCFKTTDSAAAMLAAHAVQGTLNYPLVSVGVEKAPP   1675


NP_077719.2       1674   ERTQLLYLLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASN   1723
XP_513697.3       1441   ERTQLLYLLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASN   1490
XP_001114248.1    1674   ERTQLLYLLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASN   1723
XP_005630745.1    1674   KPTQLLYLLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDSSN   1723
XP_002686160.2    1674   KPTQLLYLLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDSSN   1723
NP_035058.2       1676   RNAQLLYLLAVAVVIILFFILLGVIMAKRKRKHGFLWLPEGFTLRRDSSN   1725
NP_077334.1       1674   RNTPLLYLLAVAVVIILFLILLGVIMAKRKRKHGFLWLPEGFTLRRDSSN   1723
NP_001238962.1    1650   PKTQLLYLLAVAALIILLILLLGVMMAKRKRKHGSLWLPEGFILRRDPSN   1699
NP_001108566.1    1676   TGFNFLYLVAVAAAIILLILVLGVLAAKRKRKHGTLWLPDGFLPNKES--   1723
XP_002939126.2    1676   SSQTLMYILPVILAIIIVILLLVVVLAKKKRKHGTLWFPEGFLLHRDTSN   1725


NP_077719.2       1724   HKRREPVGQDAVGLKNLSVQVSEANLIGTGTSEHWVDDEGPQPKKVKAE-   1772
XP_513697.3       1491   HKRREPVGQDAVGLKNLSVQVSEANLIGSGTSEHWVDDEGPQPKKVKAE-   1539
XP_001114248.1    1724   HKRREPVGQDAVGLKNLSVQVSEANLIGSGTSEHWVDDEGPQPKKVKAE-   1772
XP_005630745.1    1724   HKRREPVGQDAVGLKNLSVQVSEANLIGSGTSEHWVDDEGPQPKKAKAE-   1772
XP_002686160.2    1724   HKRREPVGQDAVGLKNLSVQVSEANLIGSGTSEHWVDDEGPQPKKAKAE-   1772
NP_035058.2       1726   HKRREPVGQDAVGLKNLSVQVSEANLIGSGTSEHWVDDEGPQPKKAKAE-   1774
NP_077334.1       1724   HKRREPVGQDAVGLKNLSVQVSEANLIGSTTSEHWGDDEGPQPKKAKAED   1773
NP_001238962.1    1700   HKRREPVGEDAVGLKNLSVQIPEGNMADSGPTEHWAGDGGPQPKRVKTE-   1748
NP_001108566.1    1724   -KRREPVGQDDFGMKSMQKP-QDGGLLDCSSNHHWSEED-HLPKKPRME-   1769
XP_002939126.2    1726   QKRREPVGQDAVGMKNLSVPIVDGNLLDSNQNDHWSDDRGPQPKKSKSE-   1774


NP_077719.2       1773   DEALLSEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVLDVN   1822
XP_513697.3       1540   DEALLSEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVLDVN   1589
XP_001114248.1    1773   DEALLSEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVLDVN   1822
XP_005630745.1    1773   DEALLSEEDDAIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVLDVN   1822
XP_002686160.2    1773   DEALLSEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVLDVN   1822
NP_035058.2       1775   DEALLS-EDDPIDRRPWTQQHLEAADIRHTPSLALTPPQAEQEVDVLDVN   1823
NP_077334.1       1774   DEALLS-EDDPVDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVLDVN   1822
NP_001238962.1    1749   DQALLPEADEQIDQRQWTQQHLEAADVCGSTSLALTPPQADQEVDVLDVN   1798
NP_001108566.1    1770   DKPLLPVGVDGVDRREWTLQHHKAADI------TLTPPQADNDMESLDVN   1813
XP_002939126.2    1775   GQALLSGGDDQVDSRQWTQQHLVAADIRMTPSLALTPPQAEQDMDVIDVN   1824


NP_077719.2       1823   VRGPDGCTPLMLASLRGGSSD-----LSDEDED--AEDSSANIITDLVYQ   1865
XP_513697.3       1590   VRGPDGCTPLMLASLRGGSSD-----LSDEDED--AEDSSANIITDLVYQ   1632
XP_001114248.1    1823   VRGPDGCTPLMLASLRGGSSD-----LSDEDED--AEDSSANIITDLVYQ   1865
XP_005630745.1    1823   VRGPDGCTPLMLASLRGGSSD-----MSDEDED--GEDSSANIITDLVYQ   1865
XP_002686160.2    1823   VRGPDGCTPLMLASLRGGSSD-----MSDEDED--AEDSSANIITDLVYQ   1865
NP_035058.2       1824   VRGPDGCTPLMLASLRGGSSD-----LSDEDED--AEDSSANIITDLVYQ   1866
NP_077334.1       1823   VRGPDGCTPLMLASLRGGSSD-----LSDEDED--AEDSSANIITDLVYQ   1865
NP_001238962.1    1799   VRGPDGCTPLMLASLRVGGSD-----ISEDDED--GEDSSANIITDLIYQ   1841
NP_001108566.1    1814   VKGPDGFTPLMLASLRNGSSPDCGSMLGEEEEESGADEPGTNVITDLIGQ   1863
XP_002939126.2    1825   VRGPDGCTPLMLASLRMGSPH-----IEEDDEE--AEDPSANVITDLIYQ   1867


NP_077719.2       1866   GASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLH   1915
XP_513697.3       1633   GASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLH   1682
XP_001114248.1    1866   GASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLH   1915
XP_005630745.1    1866   GASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLH   1915
XP_002686160.2    1866   GASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLH   1915
NP_035058.2       1867   GASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLH   1916
NP_077334.1       1866   GASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLH   1915
NP_001238962.1    1842   GANLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANARDNMGRTPLH   1891
NP_001108566.1    1864   GASLNAQTDRTGETALHLAARYARADAAKRLLDAGADANAHDNMGRTPLH   1913
XP_002939126.2    1868   GACLQAQTDRTGETALHLAARYSRADAAKRLLDAGADANSQDSMGRTPLH   1917


NP_077719.2       1916   AAVAADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELIN   1965
XP_513697.3       1683   AAVAADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELIN   1732
XP_001114248.1    1916   AAVAADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELIN   1965
XP_005630745.1    1916   AAVAADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELIN   1965
XP_002686160.2    1916   AAVAADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELIN   1965
NP_035058.2       1917   AAVAADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELIN   1966
NP_077334.1       1916   AAVAADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELIN   1965
NP_001238962.1    1892   AAVAADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELIN   1941
NP_001108566.1    1914   AAVAADAQGVFQILIRNRATDLDARMNDGTTPLILSARLAVEGMVEELVH   1963
XP_002939126.2    1918   AAVSADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVADLIN   1967


NP_077719.2       1966   CQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLF   2015
XP_513697.3       1733   CQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLF   1782
XP_001114248.1    1966   CQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLF   2015
XP_005630745.1    1966   CQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLF   2015
XP_002686160.2    1966   CQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLF   2015
NP_035058.2       1967   CQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLF   2016
NP_077334.1       1966   CQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLF   2015
NP_001238962.1    1942   CQADVNAVDDHGKSALHWAAAVNNVEATLVLLKNGANRDMQDNKEETPLF   1991
NP_001108566.1    1964   CHADVNAVDDHGKSALHWAAAVNNVDATLVLLKNGANRDMQDNKEETPLF   2013
XP_002939126.2    1968   CQADVNAVDDHGKSALHWAAAVNNVEATIVLLKNGANRDMQDNKEETPLF   2017


NP_077719.2       2016   LAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEY   2065
XP_513697.3       1783   LAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEY   1832
XP_001114248.1    2016   LAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEY   2065
XP_005630745.1    2016   LAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEY   2065
XP_002686160.2    2016   LAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEY   2065
NP_035058.2       2017   LAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEY   2066
NP_077334.1       2016   LAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEY   2065
NP_001238962.1    1992   LAAREGSFEAAKILLDHFANRDITDHMDRLPRDVAQDRMHHDIVQLLNEY   2041
NP_001108566.1    2014   LAAREGSFEAAQILLDHYSNRDITDHLDRLPRDTAQERMHHDIVRLLDEY   2063
XP_002939126.2    2018   LAAREGSFEAAKMLLDYFANREITDHMDRLPRDIAKDRMHHDIVRLLDEY   2067


NP_077719.2       2066   NVTPSP---PGTVLT-SALSPVICGPNRS--FLSLKHTPMGKKSRRPSAK   2109
XP_513697.3       1833   NVTPSP---PGTVLT-SALSPVICGPNRS--FLSLKHTPMGKKSRRPSAK   1876
XP_001114248.1    2066   NVTPSP---PGTVLT-SALSPVICGPNRS--FLSLKHTPMGKKSRRPSAK   2109
XP_005630745.1    2066   NVTPSP---PGTVLT-SALSPVICGPNRS--FLSLKHTPMGKKPRRPNTK   2109
XP_002686160.2    2066   NVTPSP---PGTVLT-SALSPVICGPNRP--FLSLKHTPMGKKSRRPNTK   2109
NP_035058.2       2067   NVTPSP---PGTVLT-SALSPVLCGPNRS--FLSLKHTPMGKKARRPNTK   2110
NP_077334.1       2066   NVTPSP---PGTVLT-SALSPVLCGPNRS--FLSLKHTPMGKKARRPNTK   2109
NP_001238962.1    2042   NVAHSPTGHPGAMLN-SALSPVICGPNRS--FLNLKHASLSKKSRKPNAK   2088
NP_001108566.1    2064   NLVHSPHSGPNHVGNGGGHSSMVCGTNGTGYILGMRPGPQGKKNRRAGGK   2113
XP_002939126.2    2068   NLVHSPQGQPGTMLS-NSLSPAVCGSNRS--FLNLKHAAQTKKARRPSAK   2114


NP_077719.2       2110   STMPTSLPNLAKEAKDAKGSRRKK-----------------SLSE-KVQL   2141
XP_513697.3       1877   STMPTSLPNLAKEAKDAKGSRRKK-----------------SLSE-KVQL   1908
XP_001114248.1    2110   NTMPTSLPNLAKEAKDAKGSRRKK-----------------SLSE-KVQL   2141
XP_005630745.1    2110   STMPTSLPNLAKEAKDAKGSRRKK-----------------SLSD-KGQL   2141
XP_002686160.2    2110   STVPTSLPNLAKEAKDAKGNRRKK-----------------SLSD-KGQL   2141
NP_035058.2       2111   STMPTSLPNLAKEAKDAKGSRRKK-----------------CLNE-KVQL   2142
NP_077334.1       2110   STMPTSLPNLAKEAKDVKGSRRKK-----------------CLNE-KVQL   2141
NP_001238962.1    2089   GIMPT---NLTKDAK----RRRKK-----------------SLSESKGQF   2114
NP_001108566.1    2114   ANGVAA--GTAKDLKEMKAKRRKKPTGGEGPSVVPVTTAGGNVSRAAGGL   2161
XP_002939126.2    2115   SVAPRSLPNLAKEPKDTKNRRRKK-----------------SDTDSKAQL   2147


NP_077719.2       2142   SESSVTLSPVDSLESPHTYVSDTTSSPMITSPGILQASPNPMLATAAPPA   2191
XP_513697.3       1909   SESSVTLSPVDSLESPHTYVSDTTSSPMITSPGILQASPNPMLATAAPPA   1958
XP_001114248.1    2142   SESSVTLSPVDSLESPHTYVSDTTSSPMITSPGILQASPNPMLATAAPPA   2191
XP_005630745.1    2142   SESSVTLSPVDSLESPHTYVSDTTSSPMITSPGILQASPNPMLATAAPPA   2191
XP_002686160.2    2142   SESSVTLSPVDSLESPHTYVSDTTSSPMITSPGILQASPNPMLATAAPTA   2191
NP_035058.2       2143   SESSVTLSPVDSLESPHTYVSDATSSPMITSPGILQASPTPLLAAAAPAA   2192
NP_077334.1       2142   SESSVTLSPVDSLESPHTYVSDATSSPMITSPGILQASPTPLL-AAAPAA   2190
NP_001238962.1    2115   SESSVTLSPVDSLESPHAFASEPTSSPVMPSPGVLHSSPSSLLTAPS---   2161
NP_001108566.1    2162   SESSVTMSPVDSLESPHSYAGEPVATSS-------TANSPPLLSSQS---   2201
XP_002939126.2    2148   SESSVTLSPVDSLESPHA-----TSSPTITSPGALHTSPGQMIAASTLQP   2192


NP_077719.2       2192   PVHAQHALSFSNLHEMQPLAHGASTVLPSVSQLLSHHHIVSPGSGSAGSL   2241
XP_513697.3       1959   PVHAQHALSFSNLHEMQPLAHGASTVLPSVSQLLSHHHIVSPGSGSAGSL   2008
XP_001114248.1    2192   SVHAQHALSFSNLHEMQPLAHGASTVLPSVSQLLSHHHIVPPSSGSAGSL   2241
XP_005630745.1    2192   PAHAQHALSFSNLHEMQPLAHGASTVLPSVSQLLSHHHIAPPGNGSAGSL   2241
XP_002686160.2    2192   PVHAQHALSFSNLHEMQPLAHGANTVLPSVSQLLSHRHIVPPGSSTAGSL   2241
NP_035058.2       2193   PVHTQHALSFSNLHDMQPLAPGASTVLPSVSQLLSHHHIAPPGSSSAGSL   2242
NP_077334.1       2191   PVHAQHALSFSNLHEMQPLRPGASTVLPSVSQLLSHHHIVPPGSGSAGSL   2240
NP_001238962.1    2162   -VQAAHSMSFSNLHEMQPLGRGSSTVLPSVSQLLSQHRTTPPSSG----L   2206
NP_001108566.1    2202   ----------------------ARPMLPPVSHMLGQQQ------------   2217
XP_002939126.2    2193   P---RTTMSLTNL---QPVGCAANNMLPSVGQLLSH-------SAQNNVL   2229


NP_077719.2       2242   SRLHPVPVPADWMNRMEVNETQYN-EMFGMVLAPAEGT-HPGI-APQSR-   2287
XP_513697.3       2009   SRLHPVPVPADWMNRMEVNETQYN-EMFGMVLAPAEGT-HPGI-APQSR-   2054
XP_001114248.1    2242   SRLHPVPVPADWMNRMEVNETQYN-EMFGMVLAPAEGT-HPSI-APQSR-   2287
XP_005630745.1    2242   GRLHPVTVSADWMNRMEMNETQYN-EMFGMVLAPAEST-HPGI-PPQSR-   2287
XP_002686160.2    2242   GRLHSVTVPADWMNRVEMNESQYN-EMFGMVLAPAEGT-HPGI-APQSR-   2287
NP_035058.2       2243   GRLHPVPVPADWMNRVEMNETQYS-EMFGMVLAPAEGA-HPGIAAPQSR-   2289
NP_077334.1       2241   GRLHSVPVPSDWMNRVEMSETQYS-EMFGMVLAPAEGT-HPGMAAPQSR-   2287
NP_001238962.1    2207   GRLRPANVSTEWMNRMEMNESQYN-EMFGMV-PPVMHS-HPSV-SQQSGL   2252
NP_001108566.1    2218   ----------SWVG---LSKHSYNGHMFSLMPHHQMSAGHSGM--QQHH-   2251
XP_002939126.2    2230   TAQRQLTMSSDWLSRMERNDTQYN-EMFGIV-HHDTNN-HSCI-PQQNGI   2275


NP_077719.2       2288   -PPEGK---HITTPREPLPPIVTFQLIPKG-----------SIAQPAGAP   2322
XP_513697.3       2055   -PPEGK---HITTPREPLPPIVTFQLIPKG-----------SIAQPAGAP   2089
XP_001114248.1    2288   -PPEGK---HITTPREPLPPIVTFQLIPKG-----------SIAQPAGAP   2322
XP_005630745.1    2288   -PPEGK---HITTPREPLPPIVTFQLIPKG-----------SIAQPAGTP   2322
XP_002686160.2    2288   -PPEGK---HLTTPREPLPPIVTFQLIPKG-----------SIAQPTGAA   2322
NP_035058.2       2290   -PPEGK---HMSTQREPLPPIVTFQLIPKG-----------SIAQAAGAP   2324
NP_077334.1       2288   -APEGK---PIPTQREPLPPIVTFQLIPKG-----------SLAQAAGAP   2322
NP_001238962.1    2253   VQADAK---HLGVSRESLPPIMTFQLVPKG-----------GINQQALPQ   2288
NP_001108566.1    2252   -SPGMSAPMNVTMSREQLPPIVTFQMMPTGSGQSLLKQPQQGQMQAQGQN   2300
XP_002939126.2    2276   IQADIKPTLHMGVARDALPPIMTFQLIPKS-----------GMNQQSGI-   2313


NP_077719.2       2323   QPQSTCPPAVAGP-LPTMYQIPEMA---------RLPSVAFPTAMMPQ-Q   2361
XP_513697.3       2090   QPQSTCPPAVAGP-LPTMYQIPEMA---------RLPSVAFPTAMMPQ-Q   2128
XP_001114248.1    2323   QPQSTCPPAVTGP-LPTMYQIPEMA---------RLPSVAFPTAMMPQ-Q   2361
XP_005630745.1    2323   QPQSNCPPPVAGP-MPTMYQIPEMA---------RLPSMAFPTAMVPQ-Q   2361
XP_002686160.2    2323   QPPSNCPPAVAGT-LPTMYQIPEMA---------RLPSMAFPTAMMPQ-Q   2361
NP_035058.2       2325   QTQSSCPPAVAGP-LPSMYQIPEMP---------RLPSVAFPPTMMPQ-Q   2363
NP_077334.1       2323   QTQSGCPPAVAGP-LPSMYQIPEMA---------RLPSVAFPPTMMPQ-Q   2361
NP_001238962.1    2289   QAQSNCAQNMAGP-LSSMYQISDLA---------QLPSASFSMAAIPQ-Q   2327
NP_001108566.1    2301   QPQAQHLHCSQGM----MYPIPDVSMQHSLSHALQHPSHAHNHTLQHGLP   2346
XP_002939126.2    2314   --QTLVQQASHGQNVAAMYQIPDRA---------RITGSSVPIAMMHQ-H   2351


NP_077719.2       2362   DGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAERTPSHSGHLQGE   2411
XP_513697.3       2129   DGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAERTPSHSGHLQGE   2178
XP_001114248.1    2362   DGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAERTPSHSGHLQGE   2411
XP_005630745.1    2362   DGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAERTPSHSGHLQGE   2411
XP_002686160.2    2362   DGQVAQTILPAYHAFPASVGKYPTPPSQHSYASSNAAERTPSHSGHLQGE   2411
NP_035058.2       2364   EGQVAQTIVPTYHPFPASVGKYPTPPSQHSYASSNAAERTPSHGGHLQGE   2413
NP_077334.1       2362   EGQVAQTIVPTYHPFPASVGKYPTPPSQHSYASSNAAERTPNHGGHLQGE   2411
NP_001238962.1    2328   DGQVPQTILPAYHQFQSSMGKYPTPPSQHS-CYSSATERTPSHNRHLQGE   2376
NP_001108566.1    2347   DGQARQVV--SYQPRQSPVDKYPTPPSQHSYATAGSEGTTPGHPAQKPSE   2394
XP_002939126.2    2352   DGQLSQTMLTAYHPLQNPMGKYPTPPSQHSYTS---TDKTPNHNGHLPGE   2398


NP_077719.2       2412   HPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGP-GTHMS   2460
XP_513697.3       2179   HPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGP-GTHMS   2227
XP_001114248.1    2412   HPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGP-GTHMS   2460
XP_005630745.1    2412   HPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGP-GTHMS   2460
XP_002686160.2    2412   HPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGP-GTHMS   2460
NP_035058.2       2414   HPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGGGGGQRGP-GTHMS   2462
NP_077334.1       2412   HPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGGGGGQRGP-GTHMS   2460
NP_001238962.1    2377   HPYLTPSPESPDQWSSSSPHSASDWSDVATSP-----GNNQRGPAAAHVP   2421
NP_001108566.1    2395   HPYLTPSPESPDPWSSSSPHSNSDWSDVTTSPTP--LGNPHTMPPSCHTH   2442
XP_002939126.2    2399   HPYLTPSPESPDQWSSSSPNSASDWSDVTTSPTP---NGNQRMP-ATHMP   2444


NP_077719.2       2461   EPPHNNMQ------------------VYA   2471
XP_513697.3       2228   EPPHNNMQ------------------VYA   2238
XP_001114248.1    2461   EPPHNNMQ------------------VYA   2471
XP_005630745.1    2461   EPPRSNMQ------------------VYA   2471
XP_002686160.2    2461   EPPRSNMQ------------------VYA   2471
NP_035058.2       2463   EPPHSNMQ------------------VYA   2473
NP_077334.1       2461   EPPHSNMQ------------------VYA   2471
NP_001238962.1    2422   EQQRNNMQ------------------VYA   2432
NP_001108566.1    2443   IPEQAQLQPPSQAAQPTQSQQSQRSSVYA   2471
XP_002939126.2    2445   EQSHNGMQ------------------IYA   2455


Protein Acc. Gene Organism
NP_077719.2 NOTCH2 H.sapiens
XP_513697.3 NOTCH2 P.troglodytes
XP_001114248.1 NOTCH2 M.mulatta
XP_005630745.1 NOTCH2 C.lupus
XP_002686160.2 NOTCH2 B.taurus
NP_035058.2 Notch2 M.musculus
NP_077334.1 Notch2 R.norvegicus
NP_001238962.1 NOTCH2 G.gallus
NP_001108566.1 notch2 D.rerio
XP_002939126.2 LOC100486344 X.tropicalis


Support Center