Display Settings:

Format

Send to:

Choose Destination
HomoloGene:69382. Gene conserved in Eukaryota Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_078941.2          1   --MSISSDEVNFLVY----------RYLQESGFSHSAFTFGIESHISQSN   38
XP_526387.2          1   --MSISSDEVNFLVY----------RYLQESGFSHSAFTFGIESHISQSN   38
XP_001101823.2       1   MTETVLHQQQQLVIGGDRIFSCTSPHQCTANGFSHSAFTFGIESHISQSN   50
XP_005639997.1       1   --MSISSDEVNFLVY----------RYLQESGFSHSAFTFGIESHISQSN   38
NP_001179958.1       1   --MSISSDEVNFLVY----------RYLQESGFSHSAFTFGIESHISQSN   38
NP_109657.2          1   --MSISSDEVNFLVY----------RYLQESGFSHSAFTFGIESHISQSN   38
NP_001102411.1       1   --MSISSDEVNFLVY----------RYLQESGFSHSAFTFGIESHISQSN   38
NP_001026540.1       1   --MSISSDEVNFLVY----------RYLQESGFSHSAFTFGIESHISQSN   38
NP_201533.1          1   -MSSLTSVELNFLVF----------RYLQESGFTHAAFTLGYEAGINKSN   39
NP_001059429.1       1   -MGAITSAELNFLIF----------RYLQESGFIHAAFTLGYEAGIHKGG   39
NP_001017274.1       1   --MSISSDEVNFLVY----------RYLQESGFSHSAFTFGIESHISQSN   38


NP_078941.2         39   INGALVPPAALISIIQKGLQYVE-------AEVSINEDGTLFDGRPIESL   81
XP_526387.2         39   INGALVPPAALISIIQKGLQYVE-------AEVSINEDGTLFDGRPIESL   81
XP_001101823.2      51   INGALVPPAALISIIQKGLQYVE-------AEVSINEDGTLFDGRPIESL   93
XP_005639997.1      39   INGALVPPAALISIIQKGLQYVE-------AEVSINEDGTLFDGRPIESL   81
NP_001179958.1      39   INGALVPPAALISIIQKGLQYVE-------AEVSINEDGTLFDGRPIESL   81
NP_109657.2         39   INGALVPPAALISIIQKGLQYVE-------AEVSINEDGTLFDGRPIESL   81
NP_001102411.1      39   INGALVPPAALISIIQKGLQYVE-------AEVSINEDGTLFDGRPIESL   81
NP_001026540.1      39   INGALVPPAALISIIQKGLQYVE-------AEVSINEDGTLFDGRPIESL   81
NP_201533.1         40   IDGNMVPPGALIKFVQKGLQYMEMEANLSNSEVDIDEDFSFFQ--PLDLI   87
NP_001059429.1      40   IDGNLVPPGALITIVQKGLQYIELEANTDENDEDLAKDFALLE--PLEII   87
NP_001017274.1      39   INGALVPPAALISIIQKGLQYVE-------AEVSINEDGTLFDGRPIESL   81


NP_078941.2         82   SLIDAVMPDVVQTRQQAYRDKLAQQQAAAAAAAAAAA----------SQQ   121
XP_526387.2         82   SLIDAVMPDVVQTRQQAYRDKLAQQQAAAAAAAAAAA----------SQQ   121
XP_001101823.2      94   SLIDAVMPDVVQTRQQAYRDKLAQQQAAAAAAAAAAA----------SQQ   133
XP_005639997.1      82   SLIDAVMPDVVQTRQQAYRDKLAQQQAAAAATSTAAT----------NQQ   121
NP_001179958.1      82   SLIDAVMPDVVQTRQQAYRDKLAQQQAAAAAAAAAAT----------NQQ   121
NP_109657.2         82   SLIDAVMPDVVQTRQQAYRDKLAQQHAAAAAAAAAAT----------NQQ   121
NP_001102411.1      82   SLIDAVMPDVVQTRQQAYRDKLAQQHAAAAAAAAAAT----------NQQ   121
NP_001026540.1      82   SLIDAVMPDVVQTRQQAYRDKLAQQQAAAAA-AAAAT----------NQQ   120
NP_201533.1         88   SKDVKELQDMLREKKRKERDMEKERDRSKENDKGVER----------EHE   127
NP_001059429.1      88   TKNVEELQQIVKKRKREKTQSDRDKDKGKEKER--ME----------EHE   125
NP_001017274.1      82   SLIDAVMPDVVQTRQQAYRDKLAQQQAAAAAAAAAAAAAAAAAATSNNQQ   131


NP_078941.2        122   GSAKNGENTANGEENGAHTIANN---------------------------   144
XP_526387.2        122   GSAKNGENTANGEENGAHTIANN---------------------------   144
XP_001101823.2     134   GSAKNGENTANGEENGAHTIANN---------------------------   156
XP_005639997.1     122   GSAKNGENTANGEENGAHTIANN---------------------------   144
NP_001179958.1     122   GSAKNGENTANGEENGAHTIANN---------------------------   144
NP_109657.2        122   GSAKNGENTANGEENGAHTIANN---------------------------   144
NP_001102411.1     122   GSAKNGENTANGEENGAHTIANN---------------------------   144
NP_001026540.1     121   GSAKNGENTANGEENGAHTIANN---------------------------   143
NP_201533.1        128   GDRNRAKEKDRHEKQKEREREREKLEREKEREREKIEREKEREREKMERE   177
NP_001059429.1     126   RRPGGERERERHDQEKELEKEKDRAER---------DRDQDKEKEKL---   163
NP_001017274.1     132   PPAKNGENTANGEENGGHALANN---------------------------   154


NP_078941.2        145   ---------------------HTDMMEV----------------------   151
XP_526387.2        145   ---------------------HTDMMEV----------------------   151
XP_001101823.2     157   ---------------------HTDMMEV----------------------   163
XP_005639997.1     145   ---------------------HTDMMEV----------------------   151
NP_001179958.1     145   ---------------------HTDMMEV----------------------   151
NP_109657.2        145   ---------------------HTDMMEV----------------------   151
NP_001102411.1     145   ---------------------HTDMMEV----------------------   151
NP_001026540.1     144   ---------------------HTDMMEV----------------------   150
NP_201533.1        178   IFEREKDRLKLEKEREIEREREREKIEREKSHEKQLGDADREMVIDQTDK   227
NP_001059429.1     164   ---------------------HTERIDKVKAEEDSL--------------   178
NP_001017274.1     155   ---------------------HTDMMEV----------------------   161


NP_078941.2        152   ----DGDV----------------EIPPNKAVVLRGHESEVFICAWNPVS   181
XP_526387.2        152   ----DGDV----------------EIPPNKAVVLRGHESEVFICAWNPVS   181
XP_001101823.2     164   ----DGDV----------------EIPPNKAVVLRGHESEVFICAWNPVS   193
XP_005639997.1     152   ----DGDV----------------EIPPNKAVVLRGHESEVFICAWNPVS   181
NP_001179958.1     152   ----DGDV----------------EIPPNKAVVLRGHESEVFICAWNPVS   181
NP_109657.2        152   ----DGDV----------------EIPSNKAVVLRGHESEVFICAWNPVS   181
NP_001102411.1     152   ----DGDV----------------EIPPNKAVVLRGHESEVFICAWNPVS   181
NP_001026540.1     151   ----DGDV----------------EIPPNKAVVLRGHESEVFICAWNPVS   180
NP_201533.1        228   EIAGDGSTGAEPMDIVMTPTSQTSHIPNSDVRILEGHTSEVCACAWSPSA   277
NP_001059429.1     179   --AGGGPT---PMDV----STTAHEISSADVTVLEGHSSEVFACAWSPAG   219
NP_001017274.1     162   ----DGDV----------------EIPSSKAVVLRGHESEVFICAWNPVS   191


NP_078941.2        182   DLLASGSGDSTARIWNLSENSTSGSTQ------LVLRHCIREGGQDVPSN   225
XP_526387.2        182   DLLASGSGDSTARIWNLSENSTSGSTQ------LVLRHCIREGGQDVPSN   225
XP_001101823.2     194   DLLASGSGDSTARIWNLSENSTSGSTQ------LVLRHCIREGGQDVPSN   237
XP_005639997.1     182   DLLASGSGDSTARIWNLSENSTSGSTQ------LVLRHCIREGGQDVPSN   225
NP_001179958.1     182   DLLASGSGDSTARIWNLSENSTSGSTQ------LVLRHCIREGGQDVPSN   225
NP_109657.2        182   DLLASGSGDSTARIWNLSENSTSGPTQ------LVLRHCIREGGQDVPSN   225
NP_001102411.1     182   DLLASGSGDSTARIWNLSENSTSGPTQ------LVLRHCIREGGQDVPSN   225
NP_001026540.1     181   DLLASGSGDSTARIWNLSENSTSGSTQ------LVLRHCIREGGQDVPSN   224
NP_201533.1        278   SLLASGSGDATARIWSIPEGSFKAVHTGRNINALILKHA---KGKSNEKS   324
NP_001059429.1     220   SLLASGSGDSTARIWTIPDGPCGSITQSSPPGVHVLKHF---KGRTNEKS   266
NP_001017274.1     192   DLLASGSGDSTARIWNLSENSTSGSTQ------LVLRHCIREGGQDVPSN   235


NP_078941.2        226   KDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWN   275
XP_526387.2        226   KDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWN   275
XP_001101823.2     238   KDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWN   287
XP_005639997.1     226   KDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWN   275
NP_001179958.1     226   KDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWN   275
NP_109657.2        226   KDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWN   275
NP_001102411.1     226   KDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWN   275
NP_001026540.1     225   KDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWN   274
NP_201533.1        325   KDVTTLDWNGEGTLLATGSCDGQARIWTLNGELISTLSKHKGPIFSLKWN   374
NP_001059429.1     267   KDVTTLDWNGEGTLLATGSYDGQARIWNSDGELKQTLFKHKGPIFSLKWN   316
NP_001017274.1     236   KDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWN   285


NP_078941.2        276   KKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASC   325
XP_526387.2        276   KKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASC   325
XP_001101823.2     288   KKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASC   337
XP_005639997.1     276   KKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASC   325
NP_001179958.1     276   KKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASC   325
NP_109657.2        276   KKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASC   325
NP_001102411.1     276   KKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASC   325
NP_001026540.1     275   KKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASC   324
NP_201533.1        375   KKGDYLLTGSVDRTAVVWDVKAEEWKQQFEFHSGPTLDVDWRNNVSFATS   424
NP_001059429.1     317   KKGDFLLSGSVDKTAIVWDTKTWECKQQFEFHSAPTLDVDWRNNNSFATC   366
NP_001017274.1     286   KKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASC   335


NP_078941.2        326   STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKI   375
XP_526387.2        326   STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKI   375
XP_001101823.2     338   STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKI   387
XP_005639997.1     326   STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKI   375
NP_001179958.1     326   STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKI   375
NP_109657.2        326   STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKI   375
NP_001102411.1     326   STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKI   375
NP_001026540.1     325   STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKI   374
NP_201533.1        425   STDSMIYLCKIGETRPAKTFTGHQGEVNCVKWDPTGSLLASCSDDSTAKI   474
NP_001059429.1     367   STDNMIYVCKIGDQRPVKSFSGHQSEVNAIKWDPTGSLLASCSDDWTAKI   416
NP_001017274.1     336   STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKI   385


NP_078941.2        376   WSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVR   425
XP_526387.2        376   WSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVR   425
XP_001101823.2     388   WSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVR   437
XP_005639997.1     376   WSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVR   425
NP_001179958.1     376   WSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTSNPNANLMLASASFDSTVR   425
NP_109657.2        376   WSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVR   425
NP_001102411.1     376   WSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVR   425
NP_001026540.1     375   WSMKQDSCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVR   424
NP_201533.1        475   WNIKQSTFVHDLREHTKEIYTIRWSPTGPGTNNPNKQLTLASASFDSTVK   524
NP_001059429.1     417   WSMKQDKCVYDFKEHTKEIYTIRWSPTGPGTNNPNQQLLLASASFDSTIK   466
NP_001017274.1     386   WSMKHDTCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVR   435


NP_078941.2        426   LWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGA   475
XP_526387.2        426   LWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGA   475
XP_001101823.2     438   LWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGA   487
XP_005639997.1     426   LWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGA   475
NP_001179958.1     426   LWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGA   475
NP_109657.2        426   LWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGA   475
NP_001102411.1     426   LWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGA   475
NP_001026540.1     425   LWGVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQVP-   473
NP_201533.1        525   LWDAELGKMLCSFNGHREPVYSLAFSPNGEYIASGSLDKSIHIWSIKEGK   574
NP_001059429.1     467   LWEVEQGRLLYSLAGHRQPVYSVAFSPGGEYLASGSLDQCLHIWSVKEGR   516
NP_001017274.1     436   LWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGA   485


NP_078941.2        476   LVHSYRGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK   514
XP_526387.2        476   LVHSYRGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK   514
XP_001101823.2     488   LVHSYRGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK   526
XP_005639997.1     476   LVHSYRGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK   514
NP_001179958.1     476   LVHSYRGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK   514
NP_109657.2        476   LVHSYRGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK   514
NP_001102411.1     476   LVHSYRGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK   514
NP_001026540.1           ---------------------------------------
NP_201533.1        575   IVKTYTGNGGIFEVCWNKEGNKIAACFADNSVCVLDFRM   613
NP_001059429.1     517   ILKTYRGSGGIFEVCWNKEGSKIAACFSNNTVCLMDFRM   555
NP_001017274.1     486   LVHSYRGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK   524


Protein Acc. Gene Organism
NP_078941.2 TBL1XR1 H.sapiens
XP_526387.2 TBL1XR1 P.troglodytes
XP_001101823.2 TBL1XR1 M.mulatta
XP_005639997.1 TBL1XR1 C.lupus
NP_001179958.1 TBL1XR1 B.taurus
NP_109657.2 Tbl1xr1 M.musculus
NP_001102411.1 Tbl1xr1 R.norvegicus
NP_001026540.1 TBL1XR1 G.gallus
NP_201533.1 HOS15 A.thaliana
NP_001059429.1 Os07g0405100 O.sativa
NP_001017274.1 tbl1xr1 X.tropicalis


Support Center