Display Settings:

Format

Send to:

Choose Destination
HomoloGene:68050. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001001432.1       1   MSDIEE-VVEEYEEEE---------QE--EQEEAAEED----A----EAE   30
XP_001145598.1       1   MSDIEE-VVEEYEEEE---------QE--EQEEAAEED----A----EAE   30
XP_002802032.1       1   MSDTEE-VVEEYEEEN---------ED--EQEEAAEEDAEDGA----EAE   34
NP_001003012.1       1   MSDVEEEVAEEYEEEQ---------EE--QEEEAAEE-----A----GGE   30
NP_777196.1          1   MSDVEE-AVEEYEEQE------EAAEE--EHEEAVEEE----A----GGE   33
NP_001123650.1       1   MSDAEE-VVEEYEEEQ------EEAVE--EQEEAVEEEEAGGAEPEPEGE   41
NP_036808.1          1   MSDAEE-EVVEYEEEQEEEDWSEEEED--EQEEAVEEED-GEAEPDPEGE   46
NP_990780.1          1   MSDSEE-VVEEYEQEQEEEYVEEEEEEWLEEDDGQEDQVDEEEEETEETT   49
NP_690853.1          1   MSDNEE--VEEYEEQE------EEQVE--EEEEVQEEAQHDEEAQQEENA   40
XP_004919786.1       1   -----------------------------------------------MHT   3


NP_001001432.1      31   AETEETRAEEDEEEEEAKEAEDGPMEESKPKP-RSFM-PNLVPPKIPDGE   78
XP_001145598.1      31   AEIEETRAEEDEEEEEAKEAEDGPMEESKPKP-RSFM-PNLVPPKIPDGE   78
XP_002802032.1      35   AETEETRAEEDGEEEEAKEAEDGPMEESKPKP-RSFM-PNLVPPKIPDGE   82
NP_001003012.1      31   AATEETNAEGDGQEGEAKEAEDGPVEESKPKP-RPFM-PNLVPPKIPDGE   78
NP_777196.1         34   AEAGEP-CTADGEEEEGREAEDGPVEEFKPKP-RPFM-PNLVPPKIPDGE   80
NP_001123650.1      42   AETEEANVEEVGPDEEAKDAEEGPVEDTKPKPSRLFM-PNLVPPKIPDGE   90
NP_036808.1         47   AEAEEDKAEEVGPDEEARDAEDGPVEDSKPKPSRLFM-PNLVPPKIPDGE   95
NP_990780.1         50   AEEQEDETKAPGEGGEGDREQEPGEGESKPKP-KPFM-PNLVPPKIPDGE   97
NP_690853.1         41   GGDEETTQEHDGEE----ETEDGG-EEAKPKFLKPFMLPNLVPPKIPDGE   85
XP_004919786.1       4   GNEEEANEEKEGENEEQE-------EESRPKP-KLFM-PNLIPLKIPDGE   44


NP_001001432.1      79   RVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEELVSLKDRIERRRAE   128
XP_001145598.1      79   RVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEELVSLKDRIERRRAE   128
XP_002802032.1      83   RVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEELVSLKDRIERRRAE   132
NP_001003012.1      79   RVDFDDIHRKRMEKDLNELQTLIEAHFENRKKEEEELISLKDRIEKRRAE   128
NP_777196.1         81   RVDFDDIHRKRMEKDLNELQTLIEAHFENRKKEEEELVSLKDRIEKRRAE   130
NP_001123650.1      91   RVDFDDIHRKRVEKDLNELQTLIEAHFENRKKEEEELISLKDRIEKRRAE   140
NP_036808.1         96   RVDFDDIHRKRMEKDLNELQTLIEAHFENRKKEEEELISLKDRIEKRRAE   145
NP_990780.1         98   RLDFDDIHRKRMEKDLNELQALIEAHFESRKKEEEELISLKDRIEQRRAE   147
NP_690853.1         86   RVDFDDIHRKRMEKDLNELQTLIEAHFESRKKEEEEIISLKDRIEKRRSE   135
XP_004919786.1      45   KVDFDDIHRKRMEKDLTELQTLIEVHFESRKKEEEELQALTERMEKRRAE   94


NP_001001432.1     129   RAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSNMMH   178
XP_001145598.1     129   RAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSNMMH   178
XP_002802032.1     133   RAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSNMMH   182
NP_001003012.1     129   RAEQQRIRNEREKERQTRLAEERARREEEENRRKAEDEARKKKALSNMMH   178
NP_777196.1        131   RAEQQRIRAEREKERQTRLAEERARREEEESRRKAEDEARKKKALSNMMH   180
NP_001123650.1     141   RAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSNMMH   190
NP_036808.1        146   RAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSNMMH   195
NP_990780.1        148   RAEQQRIRSEREKERQARMAEERARKEEEEARKKAEKEARKKKAFSNMLH   197
NP_690853.1        136   RAEQQRIRSERERERQKRLEEERARKEEEEAKKRAEDDAKKKKTLTS-LH   184
XP_004919786.1      95   RAEQLRIRNEREKERQARVAEERARKEEEENRKRAEDDVRKKKAFSNMLH   144


NP_001001432.1     179   FGGYIQK-AQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKA   227
XP_001145598.1     179   FGGYIQK-AQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKA   227
XP_002802032.1     183   FGGYIQK-AQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKA   231
NP_001003012.1     179   FGGYIQK-AQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKA   227
NP_777196.1        181   FGGYIQK-AQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKA   229
NP_001123650.1     191   FGGYIQKQAQTERKSGKRQTEREKKKKILAERRKALAIDHLNEDQLREKA   240
NP_036808.1        196   FGGYIQK-AQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKA   244
NP_990780.1        198   FGGYMQK---SEKKGGKKQTEREKKKKILSERRKPLNIDHLSEDKLRDKA   244
NP_690853.1        185   FGGYMQK---IERRSGKKQTEREKKKKIFGDRRKPLDIDNANESALREKA   231
XP_004919786.1     145   FGGYLQK---TERKVGKKQTEREKKKMILTERKTPLNIGNMNEDKLRTEA   191


NP_001001432.1     228   KELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKV---SKT---   271
XP_001145598.1     228   KELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKV---SKT---   271
XP_002802032.1     232   KELWQSIHNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKV---SKT---   275
NP_001003012.1     228   KELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKV---SKT---   271
NP_777196.1        230   KELWQNIYDLEAEKFDLQEKFKQQKYEINVLRNRINDNQKV---SKT---   273
NP_001123650.1     241   KELWQSIHNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKV---SKT---   284
NP_036808.1        245   KELWQSIHNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKV---SKT---   288
NP_990780.1        245   KELWQTIRDLEAEKFDLQEKFKRQKYEINVLRNRVSDHQKV---KGSKAA   291
NP_690853.1        232   KELWSWMRELEAEKFELQYQFGKQKYEINVLRNRVSDHQKT---SKR---   275
XP_004919786.1     192   QHLFNRIYELEAEKYDHQATFKKQKYEINVLRNRVSDHQKLKSKSSKGPR   241


NP_001001432.1     272   RGKAKVTGRWK   282
XP_001145598.1     272   RGKAKVTGRWK   282
XP_002802032.1     276   RGKAKVTGRWK   286
NP_001003012.1     272   RGKAKVTGRWK   282
NP_777196.1        274   RGKAKVTGRWK   284
NP_001123650.1     285   RGKAKVTGRWK   295
NP_036808.1        289   RGKAKVTGRWK   299
NP_990780.1        292   RGKTMVGGRWK   302
NP_690853.1        276   TKR----GLRK   282
XP_004919786.1     242   SGKGIVGGRWK   252


Protein Acc. Gene Organism
NP_001001432.1 TNNT2 H.sapiens
XP_001145598.1 TNNT2 P.troglodytes
XP_002802032.1 TNNT2 M.mulatta
NP_001003012.1 TNNT2 C.lupus
NP_777196.1 TNNT2 B.taurus
NP_001123650.1 Tnnt2 M.musculus
NP_036808.1 Tnnt2 R.norvegicus
NP_990780.1 TNNT2 G.gallus
NP_690853.1 tnnt2a D.rerio
XP_004919786.1 LOC100493699 X.tropicalis


Support Center