Display Settings:

Format

Send to:

Choose Destination
HomoloGene:62161. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_065068.1          1   -----------------MDTESQYSGY----------SYKSG--------   15
XP_003954490.1       1   MASPRDLGAPSPTGGVEEDSPRRDCGLGQVQESRHSPAYRSGPECQPHRG   50
XP_001115459.2       1   -----------------MDTESQYSGY----------SYKSG--------   15
NP_001192804.1       1   -----------------MDTESQYSGY----------SYKSG--------   15
NP_277044.1          1   -----------------MDTESQYSGY----------SYKSG--------   15
NP_001099439.1       1   -----------------MDTESQYSGY----------SYKSG--------   15
XP_004948304.1       1   -----------------MDNESQYSGY----------SYKSG--------   15
NP_705960.1          1   -----------------MDNESQYSGY----------SYKSS--------   15
NP_001027481.1       1   -----------------MDNDSQYSGY----------SYKSG--------   15


NP_065068.1         16   ----------------------------HSRSSRKH-------RDRRDR-   29
XP_003954490.1      51   FPGSGRAAGHLKAQGWGSGDSGKSGAADNGRGGRRGGGSPGALRGKRQRS   100
XP_001115459.2      16   ----------------------------HSRSSRKH-------RDRRDR-   29
NP_001192804.1      16   ----------------------------HSRSSRKH-------RDRRDR-   29
NP_277044.1         16   ----------------------------HSRSSRKH-------RDRRDR-   29
NP_001099439.1      16   ----------------------------HSRSSRKH-------RDRRDR-   29
XP_004948304.1      16   ----------------------------HSRSSRKH-------RDRRDR-   29
NP_705960.1         16   ----------------------------HSRSSRKH-------RDRRDR-   29
NP_001027481.1      16   ----------------------------HSRSSRKH-------RDRRER-   29


NP_065068.1         30   -----------------HRSK--SRD-GGRGDKSVTIQA--------PGE   51
XP_003954490.1     101   GTEQGVTRLKNPPLNIPHRARCLSRS-AEFGATRSAADTKATGRAGRPRS   149
XP_001115459.2      30   -----------------HRSK--SRD-GSRGDKSVTIQA--------PGE   51
NP_001192804.1      30   -----------------HRSK--SRD-GSRGDKSVTIQA--------PGE   51
NP_277044.1         30   -----------------HRSK--SRD-GSRGDKSVTIQA--------PGE   51
NP_001099439.1      30   -----------------HRSK--SRD-GSRGDKSVTIQA--------PGE   51
XP_004948304.1      30   -----------------HRSK--SRD-GSRGDKSVTIQA--------PGE   51
NP_705960.1         30   -----------------HRSK--SRDSSSRGDKSVTIQA--------PGE   52
NP_001027481.1      30   -----------------HRSK--SRE-GSRGDKSVTIQA--------PGE   51


NP_065068.1         52   PLLDNESTRGD--------ERDDNWGETTTVVTGTSEHSISHDDLTRIAK   93
XP_003954490.1     150   PPGSSQRRVGNPVHDEILAAEDDNWGETTTVVTGTSEHSISHDDLTRIAK   199
XP_001115459.2      52   PLLDNESTRGD--------ERDDNWGETTTVVTGTSEHSISHDDLTRIAK   93
NP_001192804.1      52   PLLDNESTRGD--------ERDDNWGETTTVVTGTSEHSISHDDLTRIAK   93
NP_277044.1         52   PLLDNESTRGD--------ERDDNWGETTTVVTGTSEHSISHDDLTRIAK   93
NP_001099439.1      52   PLLDNESTRGD--------ERDDNWGETTTVVTGTSEHSISHDDLTRIAK   93
XP_004948304.1      52   PLLDNESTRGD--------ERDDNWGETTTVVTGTSEHSISHDDITRITK   93
NP_705960.1         53   PLLDAESTRGD--------DRDDNWGETTTVVTGTSEHSVSNEDLTRASK   94
NP_001027481.1      52   PLLDNESTRGE--------DRDDNWGETTTVVTGTSEHSISHDDITRITK   93


NP_065068.1         94   DMEDSVPLDCSRHLGVAAGATLALLSFLTPLAFLLLPPLLWREELEPCGT   143
XP_003954490.1     200   DMEDSVPLDCSRHLGVAAGATLALLSFLTPLAFLLLPPLLWREELEPCGT   249
XP_001115459.2      94   DMEDSVPLDCSRHLGVAAGATLALLSFLTPLAFLLLPPLLWREELEPCGT   143
NP_001192804.1      94   DMEDSVPLDCSRHLGVAAGATLALLSFLTPLAFLLLPPLLWREELEPCGT   143
NP_277044.1         94   DMEDSVPLDCSRHLGVAAGAILALLSFLTPLAFLLLPPLLWREELEPCGT   143
NP_001099439.1      94   DMEDSVPLDCSRHLGVAAGAILALLSFLTPLAFLLLPPLLWREELEPCGT   143
XP_004948304.1      94   DMEDSAHLDCSRHLGVALAGALALLAFLTPLAFMLLPQLLWREELEPCGT   143
NP_705960.1         95   ELEDSSPLECRRFAGPIVSGVLGLFALLTPLAFLLLPQLLWRDSLEPCGT   144
NP_001027481.1      94   DMEDSAKLDCSRHLGVVIGGALALLSFLTPIAFMLLPQILWREDLEQCGT   143


NP_065068.1        144   ACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFVLRALLMVLVFLLV   193
XP_003954490.1     250   ACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFVLRALLMVLVFLLV   299
XP_001115459.2     144   ACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFVLRALLMVLVFLLV   193
NP_001192804.1     144   ACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFVLRALLMVLVFLLV   193
NP_277044.1        144   ACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFVLRALLMVLVFLLV   193
NP_001099439.1     144   ACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFVLRALLMVLVFLLV   193
XP_004948304.1     144   PCEGLFISVAFKLLILLLGSWALFFRRPKAFFPRVFVFRALLMVLVFLLV   193
NP_705960.1        145   PCEGLYVSLAFKLLVLLISSWALFLRPSRSTLPRFFVFRCLLMALVFLFV   194
NP_001027481.1     144   ACEGLFISVAFKLLILLLGSWALFFRRPKAFFPRVFVFRALLMVLVFLLV   193


NP_065068.1        194   VSYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQ   243
XP_003954490.1     300   VSYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQ   349
XP_001115459.2     194   VSYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQ   243
NP_001192804.1     194   VSYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQ   243
NP_277044.1        194   ISYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQ   243
NP_001099439.1     194   ISYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQ   243
XP_004948304.1     194   VSYWLFYGVRILDSRDRNYQGIVQYAVSLVDALLFVHYLAVVLLELRQLQ   243
NP_705960.1        195   ASYWLFYGVRVLEPRERDYRGIVGYAVSLVDALLFIQYLALVLLEVRHLR   244
NP_001027481.1     194   VSYWLFYGVRILESRDKNYQGIVQYAVSLVDALLFVHYLAVVLLELRQLQ   243


NP_065068.1        244   PQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNL   293
XP_003954490.1     350   PQFTLKVVRSTDGASRFYNVGHLSIQRVAVWIWEKYYHDFPVYNPALLNL   399
XP_001115459.2     244   PQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNL   293
NP_001192804.1     244   PQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNL   293
NP_277044.1        244   PQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNL   293
NP_001099439.1     244   PQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNL   293
XP_004948304.1     244   PQFTLKAVRSTDGASRFYNVGHLSIQRAAIWILENYYHDFPVYNPALLNL   293
NP_705960.1        245   PAFCLKVVRTTDGASRFYNVGHLSIQRAAVWVLDHYYTDFPVYNPALLNL   294
NP_001027481.1     244   PQFTVKVVRSTDGASRFYNIGHLSIQRVAVWILENYYHDFPVYNPALLNL   293


NP_065068.1        294   PKSVLAKKVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYY   343
XP_003954490.1     400   PKSVLAKKVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYY   449
XP_001115459.2     294   PKSVLAKKVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYY   343
NP_001192804.1     294   PKSVLAKKVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYY   343
NP_277044.1        294   PKSVLAKKVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYY   343
NP_001099439.1     294   PKSVLAKKVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYY   343
XP_004948304.1     294   PKSVLSKKMSGFKVYSLGEENTTNNSTGQSRAVIAAAARRRDNSHNEYYY   343
NP_705960.1        295   PKSILSKKMSGFKVYSLGEENSTNNSTGQSRAMIAAAARRRDNSHNEYYY   344
NP_001027481.1     294   PKSILSKKMSGFKVYSLGEENTTNNSTGQSRAVIAAAARRRDNSHNEYYY   343


NP_065068.1        344   EEAEHERRVRKRRARLVVAVEEAFTHIKRLQEEE----QKNPREVMDPRE   389
XP_003954490.1     450   EEAEHERRVRKRRARLVVAVEEAFTHIKRLQEEE----QKNPREVMDPRE   495
XP_001115459.2     344   EEAEHERRVRKRRARLVVAVEEAFTHIKRLQEEE----QKNPREVMDPRE   389
NP_001192804.1     344   EEAEHERRVRKRRARLVVAVEEAFTHIKRLQEEE----QKNPREVMDPRE   389
NP_277044.1        344   EEAEHERRVRKRRARLVVAVEEAFTHIKRLQEEE----QKNPREVMDPRE   389
NP_001099439.1     344   EEAEHERRVRKRRARLVVAVEEAFTHIKRLQEEE----QKNPREVMDPRE   389
XP_004948304.1     344   EEAEHERRVRKRRARLVVAVEEAFTHIKRLQDED----QKNPREIMDPRE   389
NP_705960.1        345   EEAEMDRRVRKRKARLVVAVEEAFTHIKRLQDDEAAASPKHPREVMDPRE   394
NP_001027481.1     344   EEAEHERRVRKRKARLVVAVEEAFTHIKRLQDED----QKNPREIMDPRE   389


NP_065068.1        390   AAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLE   439
XP_003954490.1     496   AAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLE   545
XP_001115459.2     390   AAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLE   439
NP_001192804.1     390   AAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLE   439
NP_277044.1        390   AAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLE   439
NP_001099439.1     390   AAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLE   439
XP_004948304.1     390   AAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLE   439
NP_705960.1        395   AAQAIFAPMARAMQKYLRTTRQQPYHSMESIISHLQFCITHNMTPKAFLE   444
NP_001027481.1     390   AAQAIFASMARAMQKYLRTTKQQPYHTMESILHHLEFCITHDMTPKAFLE   439


NP_065068.1        440   RYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLLKRQDFSLVV   489
XP_003954490.1     546   RYLAAGPTIQYHKERWLGKQWTLVSEEPVTNGLXDGIFFLLKRQDFTLVV   595
XP_001115459.2     440   RYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLLKRQDFSLVV   489
NP_001192804.1     440   RYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLLKRQDFSLVV   489
NP_277044.1        440   RYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLLKRQDFSLVV   489
NP_001099439.1     440   RYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLLKRQDFSLVV   489
XP_004948304.1     440   RYLSAGPTIQYHKDRWLAKQWTLVSEEPVTNGLKDGVVFVLKRHDFSLVI   489
NP_705960.1        445   RYLTPGPTMQYQRENGRGRQWTLVSEEPVTAALRQGLVFSLRRLDFALVV   494
NP_001027481.1     440   RYLGPGPTIQYHKDRWLAKQWTLVSEEPVTNGLKDGVVFVLKRQDFSLVV   489


NP_065068.1        490   STKKVPFFKLSEEFVDPKSHKFVMRLQSETSV------------------   521
XP_003954490.1     596   STKKVPFFKLSEEFVDPKXHKFVMRLQSEPHIPMANPDDVTPAMRHRTLR   645
XP_001115459.2     490   STKKVPFFKLSEEFVDPKSHKFVMRLQSETSV------------------   521
NP_001192804.1     490   STKKVPFFKLSEEFVDPKSHKFVMRLQSETSV------------------   521
NP_277044.1        490   STKKVPFFKLSEEFVDPKSHKFVMRLQSETSV------------------   521
NP_001099439.1     490   STKKVPFFKLSEEFVDPKSHKFVMRLQSETSV------------------   521
XP_004948304.1     490   STKKIPFFKLSEEFVDPKSHKFVMRLQSETSV------------------   521
NP_705960.1        495   TVTPLPFLNLGEEFIDPKSHKFVMRLQSETSV------------------   526
NP_001027481.1     490   STKKIPFFKLSEEFVDPKSHKFVMRLQSETSV------------------   521


NP_065068.1              ----
XP_003954490.1     646   NFLI   649
XP_001115459.2           ----
NP_001192804.1           ----
NP_277044.1              ----
NP_001099439.1           ----
XP_004948304.1           ----
NP_705960.1              ----
NP_001027481.1           ----


Protein Acc. Gene Organism
NP_065068.1 VANGL2 H.sapiens
XP_003954490.1 VANGL2 P.troglodytes
XP_001115459.2 VANGL2 M.mulatta
NP_001192804.1 VANGL2 B.taurus
NP_277044.1 Vangl2 M.musculus
NP_001099439.1 Vangl2 R.norvegicus
XP_004948304.1 VANGL2 G.gallus
NP_705960.1 vangl2 D.rerio
NP_001027481.1 vangl2 X.tropicalis


Support Center