Display Settings:

Format

Send to:

Choose Destination
HomoloGene:57030. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_064576.1              --------------------------------------------------
XP_001157957.1           --------------------------------------------------
XP_001113756.2       1   --------------------------------MNAARTGRDSEIPPSHLR   18
XP_005634558.1           --------------------------------------------------
NP_001039784.1           --------------------------------------------------
NP_079761.1              --------------------------------------------------
NP_001070998.1           --------------------------------------------------
XP_422638.3          1   MLKPGSLCSAPLAGLQLQPGRTTGKILQTLKFLTREAYSRHERQRPLTDL   50
XP_003200059.1           --------------------------------------------------
NP_001092205.1           --------------------------------------------------
NP_524537.1              --------------------------------------------------
XP_001237070.2           --------------------------------------------------
NP_496281.1              --------------------------------------------------
XP_002933390.1       1   -------------------------------MAARMGW------------   7


NP_064576.1          1   -------MAPLGT-------------------TVLLWSLLRSSPGVER--   22
XP_001157957.1       1   -------MAPLRT-------------------TVLLWSLLRSSPGVER--   22
XP_001113756.2      19   RKWPLIIMAPLRT-------------------TVSLWNLLRGSPGMKR--   47
XP_005634558.1       1   -------MAALRT-------------------SVALWSLLTGSRNSER--   22
NP_001039784.1       1   -------MATLRV-------------------SLSLWNLHAGSRGAGR--   22
NP_079761.1          1   -------MAAVRT-------------------PLSLWRFQLGSRRARR--   22
NP_001070998.1       1   -------MAAVRS-------------------PLSLWRFQLSTRRARR--   22
XP_422638.3         51   RRRMHCAVPLLRQQHSWYPLDSFQFTGRTENLPSRLYFQSPHKRRIIRES   100
XP_003200059.1       1   ----MAALSVTRC-------------------LVRSYFCVQSAHKNVQ--   25
NP_001092205.1       1   ----MAALSVTRC-------------------LVRSYFCVKSAHKNVQ--   25
NP_524537.1          1   -------MHLLRS--------------------LRQLNGLQGVRQAIR--   21
XP_001237070.2       1   ------MWKLFKD--------------------LRLIGGLARRSSTVP--   22
NP_496281.1          1   -------MLQLKP----------------------RVSALTRLSAEVR--   19
XP_002933390.1       8   ---------LLRQ---------------------RLWKETVTARRTLR--   25


NP_064576.1              --------------------------------------------------
XP_001157957.1           --------------------------------------------------
XP_001113756.2           --------------------------------------------------
XP_005634558.1           --------------------------------------------------
NP_001039784.1           --------------------------------------------------
NP_079761.1              --------------------------------------------------
NP_001070998.1           --------------------------------------------------
XP_422638.3        101   HRTVFVLGKLPQRYSFCQVLPAASWLTGGKQRLGGENAQRVLSPDFCLLR   150
XP_003200059.1           --------------------------------------------------
NP_001092205.1           --------------------------------------------------
NP_524537.1              --------------------------------------------------
XP_001237070.2           --------------------------------------------------
NP_496281.1              --------------------------------------------------
XP_002933390.1           --------------------------------------------------


NP_064576.1         23   -VCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSE---------------   56
XP_001157957.1      23   -VRFRARIQPWHSGLLQPLPCSFEMGLPRRRFSSE---------------   56
XP_001113756.2      48   -VCFRARIQPWHGGLLQPLPCSFEVGLPRCRFSSE---------------   81
XP_005634558.1      23   -GCFRARIRPQLGALLQPPPVPCGVGPPCRRLASE---------------   56
NP_001039784.1      23   -VYFRARARPRPGDLFQPLPGVCGAGTPCRGLCSE---------------   56
NP_079761.1         23   -VCTRATAQRHPDALLATRPQPFEVGQPRRLLSSE---------------   56
NP_001070998.1      23   -VCTRVAAQRHSNALLATWSQPFEVGQPRRPFSSE---------------   56
XP_422638.3        151   PAAEQTPAGPQPRSATFPPNVPALTGTPARTSTSARAPASAAFTRTHWER   200
XP_003200059.1      26   -TCLQTSTR--------------IFSVSTTRNNSE---------------   45
NP_001092205.1      26   -TCLQTTTR--------------IFSVSTTRNNSE---------------   45
NP_524537.1         22   ----------------------QVSSAPTKPAA-----------------   32
XP_001237070.2      23   ----------------------HTNPTLCRSLSST---------------   35
NP_496281.1         20   -----------------------SASQWIKASNSK---------------   31
XP_002933390.1      26   ------------------------VGVPCSSASSL---------------   36


NP_064576.1              --------------------------------------------------
XP_001157957.1           --------------------------------------------------
XP_001113756.2           --------------------------------------------------
XP_005634558.1           --------------------------------------------------
NP_001039784.1           --------------------------------------------------
NP_079761.1              --------------------------------------------------
NP_001070998.1           --------------------------------------------------
XP_422638.3        201   LSDRGRFSARAAPLGKTAHSISRRASGATRFLRRWRGVRKMAALAAKGAA   250
XP_003200059.1           --------------------------------------------------
NP_001092205.1           --------------------------------------------------
NP_524537.1              --------------------------------------------------
XP_001237070.2           --------------------------------------------------
NP_496281.1              --------------------------------------------------
XP_002933390.1           --------------------------------------------------


NP_064576.1         57   ------------------------------AAESGSPETKKPTFMDEEVQ   76
XP_001157957.1      57   ------------------------------AAESGSPETKKPTFMDEEVQ   76
XP_001113756.2      82   ------------------------------AAESGSPETKKPTFMDEEVQ   101
XP_005634558.1      57   -------------------------------AESGSSEIKKPTFMDEEVQ   75
NP_001039784.1      57   -------------------------------AESGSPKIKKPTFMDEEVQ   75
NP_079761.1         57   -------------------------------AESGSSEVKKPAFMDEEVQ   75
NP_001070998.1      57   -------------------------------AESGSSEVKKPTFMDEEVQ   75
XP_422638.3        251   LLPVRLSRVARALWGWRVQRGLGQDAGPAGGAGAGEKRDAKPAFTDEAVQ   300
XP_003200059.1      46   -------------------------------------NVLKAQFTDKEVQ   58
NP_001092205.1      46   -------------------------------------NVLKAQFTDKEVQ   58
NP_524537.1         33   ---------------------------------LQYERDPQPLFTDAETQ   49
XP_001237070.2      36   -------------------------AKSNSEPFLSYEKDPAPAFLRDDVQ   60
NP_496281.1         32   ---------------------------------TPDDINVEKLFVEKEVQ   48
XP_002933390.1      37   -----------------------------------------PQFTDPEVQ   45


NP_064576.1         77   SILTKMTGLNLQ-KTFKPAIQELKP-PTYKLMTQAQLEEATRQAVEAAKV   124
XP_001157957.1      77   SILTKMTGLNLQ-KTFKPAIQELKP-PTYKLMTQAQLEEATRQAVEAAKV   124
XP_001113756.2     102   SILTKMTGLNLQ-KTFKPAVQELKP-PTYKLMTQAQLEEATRQAVEAAKV   149
XP_005634558.1      76   NLLIKMTGLNLQ-KVFKPAIQELKP-PTYKLMTQAQLEEATRKAIEAAKV   123
NP_001039784.1      76   SILIKMTGLDLL-KIFKPAVQETKP-PTYKLMTQAQLEEATRQAIEAAKV   123
NP_079761.1         76   RILTKITGLDLQ-KTFRPAIQPLKP-PTYKLMTQAQLEEATRLAVEAAKV   123
NP_001070998.1      76   SILTKMTGLDLQ-KTFKPAVQPLKP-PTYKLMTQAQLEEATRLAVEAAKI   123
XP_422638.3        301   DLLYRMTGLNLQ-KVFRPVRQELKP-PKYQLLTEAQLQEATRKAVVEAKE   348
XP_003200059.1      59   DILTKITGLKLD-KVFRPIIQQLTP-PKYKLLTDTELEEAVHKAEEHAKH   106
NP_001092205.1      59   DILTKITGLNLD-KVFRPTIQKLTP-PKYKLLTDTELEEAVHKAEEHAKH   106
NP_524537.1         50   RLLQSMTQLNLD-KVYRKRTVPDNS-SETKFMSNEQLDNEFQNLVVRAQQ   97
XP_001237070.2      61   QLLKSITRLELD-KVFRKRSVKDNT-VEYRFMTDEQLRRELLHSIEQAQQ   108
NP_496281.1         49   KLLTDLTEIDLEHKVFRPRRTSIQQRSHFALMTEERLEKTRERMREEARR   98
XP_002933390.1      46   SLLKKMTGLNLE-KVFPPIKQKLKP-PSYKLLTEEQYQETVQKAALAAEK   93


NP_064576.1        125   RLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVV   174
XP_001157957.1     125   RLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVV   174
XP_001113756.2     150   RLKMPPVLEERVPINDVLAEDTILEGTETTKYVFTDISYSIPHRERFIVV   199
XP_005634558.1     124   RLKMPPVLEERVPINDVLAEDKILEGTETAKYVFTDISYSIPHRERFIVV   173
NP_001039784.1     124   RLKMPPVLEERTPINDVLAEDKILEGTETGKYVFTDISYSIPHRERFIVV   173
NP_079761.1        124   RLKMPPVLEERKPINDVLAEDKILEGTETNKYVFTDISYNIPHRERFIVV   173
NP_001070998.1     124   RLKMPPVLEERKPINDVLAEDKILEGTETNKYVFTDISYNIPHRERFIVV   173
XP_422638.3        349   KLRMPPVLDEREPIDDVLADDKVLEGTETAKYVFTDLTYATPHRERFIVV   398
XP_003200059.1     107   LLEMPPILPERKPIDDVLAEDRILEGMDTAKYVFTDINFNIPHRERFIVV   156
NP_001092205.1     107   LLEMPPILPERKPIDDVLAEDRILEGMDTAKYVFTDINFNIPHRERFIVV   156
NP_524537.1         98   ILQMPPIVQIKKDVERVIAKDTALKDFANSKFVFTDITFGRRQSERKVIV   147
XP_001237070.2     109   MLQMPPVVQEQQDSCRVISKDGALKSLSTSKFVFTDITYGLKNSQRSIVV   158
NP_496281.1         99   FLQFVPVKEPREESVQILAKDLELKDFDTSKFVFTDITFDATDQDRTVVV   148
XP_002933390.1      94   CLKMPPVLNERKPIDSILAEDTILCDVETAKYVFTDITYSTPHRERFIVV   143


NP_064576.1        175   REPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFK-EENLRTMYSQDR   223
XP_001157957.1     175   REPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFK-EENLRTMYSQDR   223
XP_001113756.2     200   REPSGTLRKASWEERDRMIQIYFPKEGRKVLTPIIFK-EENLRTMYSRDR   248
XP_005634558.1     174   REPSGTLRKASWEERDRMIQIYFPKEGRRVLTPVIFK-EENLRNMYSQDR   222
NP_001039784.1     174   REPSGTLRKASWEERDRMIQIYFPKEGRRVLTPVIFR-EENLQTMYSQDR   222
NP_079761.1        174   REPSGTLRKASWEERDRVIQIYFPKEGRRVLPPVIFK-DENLKTMYSQDR   222
NP_001070998.1     174   REPSGTLRKASWEERDRVIQIYFPKEGRRVLPPVIFK-DENLKTMYSQDR   222
XP_422638.3        399   REPNGVLRKATWEERDRMIQIFFPKEGRRVIPPVLFK-DEHLGTVFQQDR   447
XP_003200059.1     157   REPSGTLRKASWNERDRIIQIYFPKEGRKVTPPPVFK-EENLRLVFEQDR   205
NP_001092205.1     157   REPSGTLRKASWNERDRIIQIYFPKEGRKVTPPPVFK-EGNLRLVFEQDR   205
NP_524537.1        148   RDMDGTLAYATLDTTKRMNQLYFPLEGRQSYTPRMFALEELLAKCLAEHK   197
XP_001237070.2     159   RHPDGTLQEAPYEMRKRLNQIYFPLTGRSIHQPPMFE-DEHLQRLLEEGK   207
NP_496281.1        149   REPDGTLRTANPEEHDRMNRTYYQKPNRSVNPPPLFS-DPNLQNALDKND   197
XP_002933390.1     144   REPNGVLRKATWEERDRMIQVYFPHEGRKLVPPPVFQ-AENMQILFKQDR   192


NP_064576.1        224   HVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVW   273
XP_001157957.1     224   HVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVW   273
XP_001113756.2     249   HVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKHGKYDLLRSTRYFGGMVW   298
XP_005634558.1     223   HVDVLNLCVAQFEPDSAEYIKIHHQTYEDIDKHGKYDLLRSTRHFGGMAW   272
NP_001039784.1     223   HVDVLNLCVAQFEPDSADYIKVHHQTYEDIDKYGKYDLLRSTRHFGGMAW   272
NP_079761.1        223   HADVLNLCVAQFEPDSAEYIKVHHQTYEDIDRHGKYELLRSTRHFGGMAW   272
NP_001070998.1     223   HADVLNLCVAQFEPDSTEYIKVHHQTYEDIDRHGKYEILRSTRHFGGMAW   272
XP_422638.3        448   HEDILNMCIAQFEPDSADYIRVHHRTYDDIEKHAKYDLLRSTRHFGGMVW   497
XP_003200059.1     206   HEDVLNQCVVQFEPDSAEFNKVFMLTYEDIDKHGKYDLLRSTRFFGGLAW   255
NP_001092205.1     206   HEDVLNQCVVQFEPDSAEFNKVFMLTYEDIDKHGKYDLLRSTRFFGGLAW   255
NP_524537.1        198   YEFILDRLLVQYEPHEPEFHNISARVFEHLNESKEFDLLRSTRHFGPMAF   247
XP_001237070.2     208   YEFVLDRACVQFEPYEKDYHHITAKVYQHINESRSFDALRSTRHFGPFVF   257
NP_496281.1        198   HEFVLDWACWFYEPDDPAYVRLSQLVFDRINESGKFHVVTSTRHFGPFTF   247
XP_002933390.1     193   HEELLNRCLVQFDPDSAEYIRVHHHTYEDVELHGKYDLLRSTRHFGGMAW   242


NP_064576.1        274   YFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLH---------------   308
XP_001157957.1     274   YFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHLLH---------------   308
XP_001113756.2     299   YFVNNKKIDGLLIDQIQRDLIDDATSLVQLYHILH---------------   333
XP_005634558.1     273   YFVNKKKIDGLLIDQIQRDLVDDATSLVQLYHILH---------------   307
NP_001039784.1     273   YFVNKKKIDGLLIDQIQRDLVDDAASLVQLYHILH---------------   307
NP_079761.1        273   YFVNKKKIDGLLIDQIQRDLVDDATSLVQLYHMLH---------------   307
NP_001070998.1     273   YLVNNKKIDGLLIDQIQRDLVDDATSLVQLYHMLH---------------   307
XP_422638.3        498   YLVNRKRTDGLLIDMISRDLLDDATCLITLYHMLH---------------   532
XP_003200059.1     256   HMVNERRIDGLLVEMLQRDLMQDAVKLVRLFNLVH---------------   290
NP_001092205.1     256   HMVNERRIDGLLVEMLQRDLMQDAVKLVRLFNLVH---------------   290
NP_524537.1        248   FYAWHRCIDDLLYDMIRRDYLHNAVELIALSYKLH---NIPVEYQATLTE   294
XP_001237070.2     258   FLAWHKLIDDLLLDMIKQDYLRNGIELIVLYSTLH---GMPIDEGVKQIA   304
NP_496281.1        248   YLALNDNIQKLLNYFGGLGRLSDCANLVRLQKAVRPDWRVTIAQGDSDEK   297
XP_002933390.1     243   YLCCRKKIDGLLIDMIQRDMLDDAINLVRLYHMLH---------------   277


NP_064576.1        309   ----------------------------------PDGQSAQGAKDQAAEG   324
XP_001157957.1     309   ----------------------------------PEGQSAQGAKDQAAEG   324
XP_001113756.2     334   ----------------------------------PDGQSAQEAKDQAAEG   349
XP_005634558.1     308   ----------------------------------PDGQSAQEAKEQAAEG   323
NP_001039784.1     308   ----------------------------------PDGQSAQEAKEQAAEG   323
NP_079761.1        308   ----------------------------------PDGQSAQEAKEQAAEG   323
NP_001070998.1     308   ----------------------------------PEGQSAQEAKEQAAEG   323
XP_422638.3        533   ----------------------------------PECQSAKEAEEGKLHG   548
XP_003200059.1     291   ----------------------------------PQSESAEHAQRQQAAD   306
NP_001092205.1     291   ----------------------------------PQSESAQHAQRQQAAD   306
NP_524537.1        295   LGKLHATPAESALAELRSVFRRHDNKQNIEQEIHTAIGKTEHDFAADEIS   344
XP_001237070.2     305   LQ-----------TQMPSLF--------------DAAEKSVDELKQDEQY   329
NP_496281.1        298   IVKDFAKQNARFRDEIQDLLNFINNGKLK-----SDQEQTEHVRERFGVR   342
XP_002933390.1     278   ----------------------------------PDSECAKESRGAD--G   291


NP_064576.1        325   INLIKVFAKTE-AQKGAYIELTLQTYQEA------------LSRHSAAS-   360
XP_001157957.1     325   INLIKVYAKTE-AQKGAYIELTLQTYQEA------------LSRHSAAS-   360
XP_001113756.2     350   INLIKVFAKTE-AQKGAYIELTLQTYQEA------------LSRHSAAS-   385
XP_005634558.1     324   LHLIKVFAKTE-AQKGAYIELTLQAYQET------------VISHSAAS-   359
NP_001039784.1     324   LQLIKVFAKTE-AQKGAYIELTLQAYQEA------------FISSSAAS-   359
NP_079761.1        324   VDLIKVFAKTE-AQRGAYIELALQTYQEI------------VTSHSAAS-   359
NP_001070998.1     324   VNLIKVFAKTE-AQRGAYIELALQTYQEI------------VISHSATS-   359
XP_422638.3        549   IDLIKVFVKTE-SQKEGYIQLALQAYQEA------------MATSTAS--   583
XP_003200059.1     307   LDLLKIYAQYE-SSRAGFIELAVQTYEQT------------KALGSF---   340
NP_001092205.1     307   LDLLKIYTQYE-SSRAGFIELAVQTYEQT------------KALGSF---   340
NP_524537.1        345   LKFIEQYIASEHALKKVQLELAVQTLKEVNREKLMLFQGLKKAHGVQAS-   393
XP_001237070.2     330   LSIIEQFVNGQ-ATKKVQLNLAVQAYREMAAEKLRLAQGIRRMHGES---   375
NP_496281.1        343   VDKRKARITSA-NIRGADGPLGDLSSEYSVKVVKSEGSGREGGGGEENKK   391
XP_002933390.1     292   VELIKIYVKME-SQKPGYIELALQAYQQS------------LSGAASS--   326


NP_064576.1              ---------------------------
XP_001157957.1           ---------------------------
XP_001113756.2           ---------------------------
XP_005634558.1           ---------------------------
NP_001039784.1           ---------------------------
NP_079761.1              ---------------------------
NP_001070998.1           ---------------------------
XP_422638.3              ---------------------------
XP_003200059.1           ---------------------------
NP_001092205.1           ---------------------------
NP_524537.1              ---------------------------
XP_001237070.2           ---------------------------
NP_496281.1        392   DEGGRGGGKGRWRSREKRSDDDGKKKE   418
XP_002933390.1           ---------------------------


Protein Acc. Gene Organism
NP_064576.1 MRPS22 H.sapiens
XP_001157957.1 MRPS22 P.troglodytes
XP_001113756.2 MRPS22 M.mulatta
XP_005634558.1 MRPS22 C.lupus
NP_001039784.1 MRPS22 B.taurus
NP_079761.1 Mrps22 M.musculus
NP_001070998.1 Mrps22 R.norvegicus
XP_422638.3 MRPS22 G.gallus
XP_003200059.1 LOC100537304 D.rerio
NP_001092205.1 mrps22 D.rerio
NP_524537.1 mRpS22 D.melanogaster
XP_001237070.2 AgaP_AGAP007519 A.gambiae
NP_496281.1 mrps-22 C.elegans
XP_002933390.1 mrps22 X.tropicalis


Support Center