Display Settings:

Format

Send to:

Choose Destination
HomoloGene:55757. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_003468.2          1   MAASWRLGCDP--RLLRYLVGFPGR-----RSVGLVKGALGWSVSRGANW   43
XP_001149489.1       1   MAASWRLGCDP--RLLRYLVGFPGR-----RSVGLVKGALGWSVSRGANW   43
XP_001109997.2       1   MAASWRLGCDP--RLLRYLVGFPGC-----RSIGLVKGALGWSVSRGANW   43
XP_533153.2          1   MAASWRLGCDP--RGLRYLLGFGGC-----RRLALARGASGWPLGRGASW   43
NP_001069219.1       1   MAASWRLGCDP--RLLRCLLGFGSR-----RSPELVKGAARWSVGRGASW   43
NP_780303.1          1   MAASWRLHCNQ--PLLRYLLGFSSR-----RSLGLAQGAAAWPVDRGASW   43
NP_001026358.1       1   MAASWWRSGGA--GVLRLLRG--GR-----PVL-----SAGLAVPARGGW   36
NP_956854.1          1   MAASMRLGRRTLFTALRALTQTPAGLQSSFRPLRESPRTAGWS--RSAAR   48
XP_002937341.2       1   -------------------------------------MQSGGPYPQPGT-   12


NP_003468.2         44   RWFHSTQWLRGDP-IKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCE   92
XP_001149489.1      44   RWFNSTQWLRGDP-IKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCE   92
XP_001109997.2      44   RWFHSTQWLRGDP-IKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCE   92
XP_533153.2         44   RWLHSTQRLRADP-IKILMPSLSPTMEEGNIVKWLKKEGEAVSTGDALCE   92
NP_001069219.1      44   RWFHSTQWLRADP-IKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCE   92
NP_780303.1         44   RWFHSTQLLQADP-IKVLMPSLSPTMEQGNIVKWLRKEGEAVSAGDSLCE   92
NP_001026358.1      37   RFLHGTQELLGTPAIKVLMPALSPTMEEGNIVKWLKKEGEMVNAGDALCE   86
NP_956854.1         49   PLYQSCRARAGVCPLKVQMPALSPTMEEGNIVKWLKKEGEDVAAGDALCE   98
XP_002937341.2      13   --------LRGVPGVQVFMPALSPTMEEGNIVKWMKKEGETVSAGDALCE   54


NP_003468.2         93   IETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVE   142
XP_001149489.1      93   IETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVE   142
XP_001109997.2      93   IETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVE   142
XP_533153.2         93   IETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLLVEEGEDWKHVE   142
NP_001069219.1      93   IETDKAVVTLDASDDGILAKIVVAEGSKNIRLGSLIGLLVEEGEDWKHVE   142
NP_780303.1         93   IETDKAVVTLDANDDGILAKIVVEEGAKNIQLGSLIALMVEEGEDWKQVE   142
NP_001026358.1      87   IETDKAVVTMESSDDGILAKILVEEGSKNVRLGSLIGLLVEEGQDWKQVE   136
NP_956854.1         99   IETDKAVVVMESNEDGVLARILVQEGSRGVRLGTLIALMVSEGEDWKQVE   148
XP_002937341.2      55   IETDKAVVTMESNDDGVLAKILVEEGSRNVRLGSLIALLVEEGQDWKQVD   104


NP_003468.2        143   IPK-DVGPPPPVSKPSEP-RPSPE-PQISIPVKKEHIPGTLRFRLSPAAR   189
XP_001149489.1     143   IPK-DVGPPPPVSKPSEP-RPSPE-PQISIPVKKEHIPGTLRFRLSPAAR   189
XP_001109997.2     143   IPK-DVGPPPPVSKPSEP-RPSPE-PQISIPVKKEHIPRTLRFRLSPAAR   189
XP_533153.2        143   IPK-DEGPPSPASKPSVP-SPSPE-PQISTPVKKEHILGKLQFRLSPAAR   189
NP_001069219.1     143   IPK-DTGPPPPAAKPSVP-PPSAE-PQIATPVKKEHPPGKVQFRLSPAAR   189
NP_780303.1        143   IPK-DVSAPPPVSKPPAPTQPSPQ-PQIPCPARKEH-KGTARFRLSPAAR   189
NP_001026358.1     137   IPA-DANDQSSLAPPAAAVTSTPAGPSVSAPPKVEHQPGKLQFRLSPAAR   185
NP_956854.1        149   IPALEPVTPPTAALPTAA-PPTAG----SAPPALRQSVPTPLLRLSPAAR   193
XP_002937341.2     105   IPS-VKVSPTAAAAATQS-ADVPA-PQPVAPA------AKLGLRMSPAAR   145


NP_003468.2        190   NILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTA   239
XP_001149489.1     190   NILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPAA   239
XP_001109997.2     190   NILEKHSLDASQGTAT--------ESSVR----------ATIRSRRRLGS   221
XP_533153.2        190   NILEKHALDASQGTATGPRGIFTKEDALKLVQLKETGKITESRPTPAPPA   239
NP_001069219.1     190   NILEKHALDANQGTATGPRGIFTKEDALKLVQLKQTGKITEPRPTAALPT   239
NP_780303.1        190   NILEKHSLDASQGTATGPRGIFTKEDALKLVELKQMGKITESRPASAPPP   239
NP_001026358.1     186   NIVETHGLDPSSVTPSGPRGIFTKEDALKLLQGKQKDKPSELKPVVSPAT   235
NP_956854.1        194   HILDTHGLDPHQATASGPRGIITKEDALNLLS-----KASAVPPPAAAPA   238
XP_002937341.2     146   HIIGTHGLDSSSITPSGPRGILTKEDALKFLAQK---KVSGEKPIAAAPS   192


NP_003468.2        240   TPTAPSP---LQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRV   286
XP_001149489.1     240   TPTAPSP---LQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRV   286
XP_001109997.2     222   LPAAPMS---L---------------LGVLFQPHAVGTFTEIPASNIRRV   253
XP_533153.2        240   TPTVPLP---PQATATPPYSRPMIPPVSTPGQPNVPGTFTEIPASNIRRV   286
NP_001069219.1     240   TPAAPLP---PQAAATASYPRPMIPPVSTPGQPNVEGTFTEIPASNIRRV   286
NP_780303.1        240   SLSASVP---PQATAGPSYPRPMTPPVSIPGQPNAAGTFTEIPASNIRRV   286
NP_001026358.1     236   PQPTAVPSALPAAAVPSAYPRPIVPPVSTPGQPAAPGTFTEIPASNIRRV   285
NP_956854.1        239   PPAAP-----PAA-------RPTHPPASAPARPAAPGTFTEIPASSVRRI   276
XP_002937341.2     193   PPPEKLPASPPAAAPAPVSGRPFFPPMSIPGKPHTEGMFSEIPASNIRKV   242


NP_003468.2        287   IAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAA   336
XP_001149489.1     287   IAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAA   336
XP_001109997.2     254   IAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAA   303
XP_533153.2        287   IAKRLTESKSTVPHAYATADCDLGAVLKARQSLVKDDIKVSVNDFIIKAA   336
NP_001069219.1     287   IAKRLTESKSTIPHAYATTDCDLGAVLTARQNLVRDDIKVSVNDFIIKAA   336
NP_780303.1        287   IAKRLTESKSTVPHAYATADCDLGAVLKVRRDLVKDDIKVSVNDFIIRAA   336
NP_001026358.1     286   IAKRLTESKTTIPHAYAAADCDIDAILKLRSELAKDDIKVSVNDFIIKAA   335
NP_956854.1        277   IAQRLTQSKTTIPHTYACIHCDISGVMRVRKRLAEENIKVSVNDFIIKAA   326
XP_002937341.2     243   IAKRLMESKSSIPHAYATTDCDLGAVMRLRKELAKDNIKVSVNDFIIKAT   292


NP_003468.2        337   AVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATDKGLLTPIIKDAAAKGI   386
XP_001149489.1     337   AVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATDKGLLTPIIKDAAAKGI   386
XP_001109997.2     304   AVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATDKGLLTPIIKDAAAKGI   353
XP_533153.2        337   AVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATDKGLITPIIKDAAAKGI   386
NP_001069219.1     337   AVTLKQMPNVNASWDGEGAKQLPSIDISVAVATDRGLITPVIKDAAAKGL   386
NP_780303.1        337   AVTLKQMPGVNVTWDGEGPKQLPSVDISVAVATDKGLITPIIKDAAAKGI   386
NP_001026358.1     336   AVTLKQMPDVNATWDGEGCRQLQSIDISIAVATDRGLITPIIKDVPAKGI   385
NP_956854.1        327   AVSLRELPAVNVSWSADGPQPLGFIHISMAVATDRGLITPIIRDAADKGL   376
XP_002937341.2     293   AAALKQMPEVNVTWNGEGAAPLETIDISIAVATDRGLITPIIKQAASKGI   342


NP_003468.2        387   QEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQ   436
XP_001149489.1     387   QEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQ   436
XP_001109997.2     354   QEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQ   403
XP_533153.2        387   QEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQ   436
NP_001069219.1     387   QEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQ   436
NP_780303.1        387   QEIADSVKVLSKKARDGKLMPEEYQGGSFSISNLGMFGIDEFAAVINPPQ   436
NP_001026358.1     386   QEIAASAKALAKKARDGKLLPEEYQGGSFSISNLGMFGINDFIAVINPPQ   435
NP_956854.1        377   QEISSTAKALAQKARDGKLLPEEYQGGSFSVSNLGMFGISEFSAVINPPQ   426
XP_002937341.2     343   QEIAATAKVLAQKARDGKLLPEEYQGGSFSISNLGMFGITGFSAVINPPQ   392


NP_003468.2        437   ACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRF   486
XP_001149489.1     437   ACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRF   486
XP_001109997.2     404   ACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRF   453
XP_533153.2        437   ACILAVGRFRPVLKLEQDEEGNDRLQQRQLITVTMSSDSRVVDDELATRF   486
NP_001069219.1     437   ACILAVGRFRPVLKLTQDEEGNAQLQQRQLITVTMSSDSRVVDDELATRF   486
NP_780303.1        437   ACILAVGRFRPVLKLTEDEEGNPQLQQHQLITVTMSSDSRVVDDELATRF   486
NP_001026358.1     436   ACILAVGRARPELKIVEDEEGNEKLKQHQLMTVTLSSDGRVVDDELASKF   485
NP_956854.1        427   ACILAVGGSRTELSLSAED----TLQTQHTLTVTLSSDARLVDDELASRF   472
XP_002937341.2     393   SCILAVGRSRVELDLAEGEEGNPQLCQKHVMNVTLSSDGRLVDDELASKF   442


NP_003468.2        487   LKSFKANLENPIRLA---   501
XP_001149489.1     487   LKSFKANLENPIRLA---   501
XP_001109997.2     454   LKSFKANLENPIRLA---   468
XP_533153.2        487   LENFKANLENPIRLA---   501
NP_001069219.1     487   LESFKANLENPLRLA---   501
NP_780303.1        487   LETFKANLENPMRLG---   501
NP_001026358.1     486   LETFKANIENPIRLALC-   502
NP_956854.1        473   LETFRLNLERPERMSLQA   490
XP_002937341.2     443   LDCFRKNLENPLHCALL-   459


Protein Acc. Gene Organism
NP_003468.2 PDHX H.sapiens
XP_001149489.1 PDHX P.troglodytes
XP_001109997.2 PDHX M.mulatta
XP_533153.2 PDHX C.lupus
NP_001069219.1 LOC517402 B.taurus
NP_780303.1 Pdhx M.musculus
NP_001026358.1 PDHX G.gallus
NP_956854.1 pdhx D.rerio
XP_002937341.2 pdhx X.tropicalis


Support Center