Display Settings:

Format

Send to:

Choose Destination
HomoloGene:55435. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_000102.1          1   ----MIEPFG--NQYIVARPVYSTNAFEEN----------HKKTGRHHKT   34
XP_527858.2          1   ----MIEPFG--NQYIVARPVYSTNAFEEN----------HKKTERHHKT   34
XP_001090155.2       1   ----MIEPFG--NQYIVARPVYSTNAFEEN----------HKKRDRHHKT   34
XP_540380.3          1   ----MIEPIG--NQYVVARPVYSANAFGEE----------HKKKQRHHKT   34
NP_001077145.1       1   ----MIEPIG--NQYVVARPVYSANAFGED----------HKKKQRHHKT   34
NP_067328.1          1   ----MIEAIG--NQYVVARPVYSTKTFGEE----------FKKTHRHHKT   34
NP_446207.1          1   ----MIEAIG--NQYVVARPVYSTKAFGEE----------FKKTYGHHKT   34
NP_001186373.1       1   ----MVEPVG--NHYVVARRVYSENSFDEE----------YEKLHRYHKN   34
NP_001035265.1       1   ----MLRASA--QKYTVSRALYSEEHLEEE----------HAKAYRKHKG   34
NP_001129155.1       1   -----MQPFG--RHYVVVRPLFSEDSFAEQ----------HERINRKRKT   33
NP_491138.2          1   MAKHILSPIGVNEGEILAYDVNVTQNYTKSRQADVINQTVFDKTYLFKPE   50
XP_004913063.1       1   ----MIETVG--NQYVVSRPIYSENAFHTE----------HEKLHRYHKT   34


NP_000102.1         35   FLD-------HLK------------VCCSCSPQKAKRIVLSLFPIASWLP   65
XP_527858.2         35   FLD-------HLK------------VCCSCSPQKAKRIVLSLFPIASWLP   65
XP_001090155.2      35   LLD-------HLR------------VCFSCSPQKAKRIVLSLFPIASWLP   65
XP_540380.3         35   FLD-------HLK------------VCCSCSTQKAKKIALSLFPIASWLP   65
NP_001077145.1      35   LLD-------HLK------------KLCRCSAQRAKKIAFSSFPIASWLP   65
NP_067328.1         35   FLD-------HLK------------GCCSCSSQKAKKIALSLFPIASWLP   65
NP_446207.1         35   FLD-------HLK------------GCCSCSSQKAKKIALSLFPIASWLP   65
NP_001186373.1      35   FWD-------HLK------------LYFRCSPQRIKKVSLRMFPVVSWLP   65
NP_001035265.1      35   LLD-------HIK------------LYCTCTSERAKNAALSLLPVIGWMK   65
NP_001129155.1      34   LRH-------HLKDYFSGVSFSKLCLCCSCDAKRAKNAALSLFPFIGWMK   76
NP_491138.2         51   YLSLTGKIAFHLK------------SIGKWKRKEWIQFARGRIPITMWLP   88
XP_004913063.1      35   FLD-------HLR------------VFFGCSREKAKRIAYTFFPIASWLP   65


NP_000102.1         66   AYRLKEWLLSDIVSGISTGIVAVLQGLAFALLVDIPPVYGLYASFFPAII   115
XP_527858.2         66   AYRLKEWLLSDIVSGISTGIVAVLQGLAFALLVDIPPVYGLYASFFPAII   115
XP_001090155.2      66   AYRLKEWLLSDIVSGISTGIVSVLQGLAFALLVTIPPGYGLYAAFFSTII   115
XP_540380.3         66   AYQIKEWLLSDIVSGISTGLVAVLQGLAFALLVTVPPSYGLYAAFFPVIV   115
NP_001077145.1      66   AYRIKEWLLSDIVSGISTGLVAVLQGLAFALLVTIPPGYGLYAAFFPVII   115
NP_067328.1         66   AYKIKEWLLSDIVSGISTGLVAVLQGLAFALLVNIPPAYGLYAAFFPVIT   115
NP_446207.1         66   AYKIKEWLLSDIVSGISTGLVAVLQGLAFALLVNIPPAYGLYAAFFPVIT   115
NP_001186373.1      66   AYRFREWILSDIVSGINTGLVSVLQGLAFALLVNVPPGYGLYAAFFPVLV   115
NP_001035265.1      66   IYSIKEWLLNDIVSGVSTGLVAVLQGLAFSLLASISTWYGLYAAFFPVII   115
NP_001129155.1      77   DYKIKEWLLGDIVSGISTGLVAVLQGLAFSLLASLPPGYGLYTAFFPAII   126
NP_491138.2         89   RYTWKSNFLVDFLGGLMVSVLSVPQSLAYGMLVGVPPSYGLITGIIGPII   138
XP_004913063.1      66   MYRFKEWILSDIVSGISTGLVAVLQGLAFALLVNVTPGYGLYAAFFPVIT   115


NP_000102.1        116   YLFFGTSRHISVGPFPILSMMVGLAVSGAV--SKA-VPDRNATTLGLPNN   162
XP_527858.2        116   YLFLGTSKHISVGPFPILSMMVGLAVSGAV--SKA-VPDRNATTLGLSNN   162
XP_001090155.2     116   YLFFGTSKHISAGPFPILSMMVG-AATVRL--AQN-LPGNTGSS---NNS   158
XP_540380.3        116   YFFLGTSRHISVGPFPVLSMMVG-AVVVRL--TPT-ASTAALEI--SNSS   159
NP_001077145.1     116   YFFLGTSRHISVGPFPVLSMMVG-AVVVRL--TPT-DSAADSTF--ANSS   159
NP_067328.1        116   YFFLGTSRHISVGPFPVLSMMVG-VVVTRV--V-S-DPNASSEL--SSSS   158
NP_446207.1        116   YFFLGTSRHISVGPFPVLSMMVG-VVVTRV--A-S-GSDTSPAL--SSSS   158
NP_001186373.1     116   YFIFGTSRHISVGPFPVLSLMVG-GVVTRL--VPD-GAAGNGTA------   155
NP_001035265.1     116   YFFLGTSRHISVGAFPVLSLMVG-AVVTKL--VPDEGPPANITA------   156
NP_001129155.1     127   YFFLGTSRHLSVGAFPILSLMVG-AVVTRL--VPDEGPSFNITG------   167
NP_491138.2        139   YALFGTSKHSSPGAFAIVSLMVG-TVVESFGDVGSTNGTIDSNVDLLCCR   187
XP_004913063.1     116   YFFFGTSRHISVGPFPVLSLMVG-TAVLRL--APD-DPSISANN------   155


NP_000102.1        163   SNNSSLLDDERVRVAAAASVTVLSGIIQLAFGILRIGFVVIYLSESLISG   212
XP_527858.2        163   SNNSSLLDDKRVTV--AASVTVLSGIIQLAFGILRIGFVVIYLSESLISG   210
XP_001090155.2     159   TSNSSSLDDYKVMV--AASVTVLSGVIQLALGILRIGFVVIYLSESLISG   206
XP_540380.3        160   MSNDSSTNEYKVMV--AATVTILSGIIQLLMGVLRIGFVVIYLSESLISG   207
NP_001077145.1     160   MTNDSSIDEQKVIV--AATVTILSGIIQLLMGVLRLGFVVIYLSESLISG   207
NP_067328.1        159   TENDSFIEE-KVMV--AASVTVLSGIIQLLLGVLQVGFVVIYLSESLISG   205
NP_446207.1        159   AENDSMIEE-KVMV--AASVTVLSGIIQLLLGVLQIGFVVIYLSESLISG   205
NP_001186373.1     156   -VNTSAIDEQRVMV--AASVTFLSGIFQLLLGLLQFGFIVIYLSHSLISG   202
NP_001035265.1     157   -FEGLTKEEQRILV--SASLTFLVGLFQLGMGLLQVGFIVMYLSEPYISG   203
NP_001129155.1     168   -FEGLSLEQQRVLV--ASSVTFLMGAFQLVMGLLQVGFIVMYLSETLVSG   214
NP_491138.2        188   ENKPRVSDGDAIGI--AASVTLLVGLFQILFGLLNAGLLAVWLSDQLVQG   235
XP_004913063.1     156   TEALTMLNEKRVVV--AASVTVLAGIFQLAMGLLQIGFIVIYLSDSLISG   203


NP_000102.1        213   FTTAAAVHVLVSQLKFIFQLT-VPSHTDPVSIFKVLYSVFSQIEKTNIAD   261
XP_527858.2        211   FTTAAAVHVLVSQLKFIFQLT-VPSHNDPLSIFKVLVSVFSQIEKTNIAD   259
XP_001090155.2     207   FTTAAAVHVLVSQLKFIFQLT-VPSHEDPCSIFKVLYSVFSQIEKTNIAD   255
XP_540380.3        208   FTTAAAVHVLVSQLKFMLQLT-VPAHTDPFSIFKVLNSVFTQIEKTNIAD   256
NP_001077145.1     208   FTTAAAIHVLVSQLKFMFQLT-VPAHTDPFSLFKVLESVFSQIEKTNIAD   256
NP_067328.1        206   FTTAAAIHVLVSQLKFMLQLP-VPAYSDPFSIFKVLESVFTQIQKTNIAD   254
NP_446207.1        206   FTTAAAIHVLVSQLKFMLQLT-VPAHSDPFSIFKVLESVFSQIQKTNIAD   254
NP_001186373.1     203   FTTAAAIHVLVSQIKFMLQLP-VPGFNKPFGIIYTLESVFSQITDTNIAD   251
NP_001035265.1     204   FTTAAAVHILVSQLKFILGLT-VPGFSGPLSIIYTLESVFTQITSTNIHD   252
NP_001129155.1     215   FTTAAAVHILVSQLRFVLGLD-FPGINGPLAIIYTLVEVFSRITSTNVAD   263
NP_491138.2        236   LISGAAVHVLTSQLKSMTRISNVPPTSEPFQNVVFYMCFFKQMPDVDYAS   285
XP_004913063.1     204   FTTAAAIHVLVSQLKFVFGLK-VEPFSGPLSLFYTLKGIFIQITDTNIAD   252


NP_000102.1        262   LVTALIVLLVVSIVKEINQRFKD-KLPVPIPIEFIMTV-IAAGVSYGCDF   309
XP_527858.2        260   LVTALIVLLVVSIVKEINQRFKD-KLPVPIPIEFIMTV-IAAGVSYGCDF   307
XP_001090155.2     256   LVTALIVLLVVSIFKEINQRFKD-KLPVPIPIEFIVTV-IATGVSYGFDF   303
XP_540380.3        257   LVTSLIILLVVFVVKEINQRYKA-KLPVPIPIELIMTV-IATGVSYGFDF   304
NP_001077145.1     257   LVTSLVILVVVFVVKEINQRYKA-KLPVPIPIELIVTV-IATGVSYGFDF   304
NP_067328.1        255   LVTSVIILVVVFVFKEINQRYRS-KLPVPIPIELIMTV-IATGVSYGCNF   302
NP_446207.1        255   LVTSVIILVVVFVVKEINQRYRS-KLPVPIPIELIMTV-IATGISYGCNF   302
NP_001186373.1     252   LVTSLLVLLIVFVVKEINERYKA-KLPAPIPIELIVTV-LAALISHFAKF   299
NP_001035265.1     253   LVTSIVVMVAVLAVKEINDRFKS-KLPVPIPIEVIMTI-IACGVSYAFNF   300
NP_001129155.1     264   LVTSIAIMALVLIVKEINDRFKS-KLPVPIPIEVIMTV-IACGVSYAFNF   311
NP_491138.2        286   IIISVICVVLLLISTLVIDPWLCKKVPVKFPMELVLVVSMTLTVHYTRNT   335
XP_004913063.1     253   LVTSIIIMVVVFVVKEINDRFKA-KIPVPIPIEVIMTV-IATGVSYALNF   300


NP_000102.1        310   KNRFKVAVVGDMNPGFQPPITPDVETFQNTVGDCFGIAMVAFAVAFSVAS   359
XP_527858.2        308   KNRFKVAVVGDMNPGFQPPITPDVQAFQNTIGDCFGIAMVAFAVAFSVAS   357
XP_001090155.2     304   HRRFNVAVVGKMNPGFEPPNAPNVTVFQETIGDCFAIAMVGFAVAFSVAS   353
XP_540380.3        305   ENRFKVAVVGEMNRGFKSPITPDTQILQETIGDSFGIAIVGFAVAFSVAS   354
NP_001077145.1     305   KRRFNVAVIGEMKPGFQAPIIPSRQTFQDTIGDCFGIAIVGFAVAFSVAS   354
NP_067328.1        303   EDRFGVAVVGNMSLGFQPPITPSVEVFQDTIGDSFGIAIVGFAVAFSVAS   352
NP_446207.1        303   EQRFGVAVVGNMSLGFQPPITPSVEVFQDTIGDCFGIAIVGFAVAFSVAS   352
NP_001186373.1     300   EEKFKVAVVGKLEEGFQAPVAPDAGIIQNCVGDGISIAIVGFAVGFSVAK   349
NP_001035265.1     301   RDNHGVDVVGKIPNTFESPIAPDLQVFQMAAVDAFPIAIVGFAVAFAVAK   350
NP_001129155.1     312   EERFDVVIVGEMVNGYESPVAPNLEVIEETAVEAFPMAIVGFAVAFSVAK   361
NP_491138.2        336   AYEFQIPTVGQVTSGIPAPVIPPMRNAFGMMGSAMSIAIISFVIHISLCK   385
XP_004913063.1     301   KDRYKVDIVGTLEKGFQPPIAPSLSVFQDCVGDGFSIAIVGFAVAFSVAK   350


NP_000102.1        360   VYSLKYDYPLDGNQELIALGLGNIVCGVFRGFAGSTALSRSAVQESTGGK   409
XP_527858.2        358   VYSLKYDYPLDGNQELIALGLGNIVCGVFRGFAGSTALSRSAVQESTGGK   407
XP_001090155.2     354   VYSLKHDYPLDGNQELIALGLSNIVCGAFRGFAGSTALSRSAVQESTGGK   403
XP_540380.3        355   VYSLKYDYPIDGNQELIALGLSNILGGSFKGFASSTALSRSGVQESTGGK   404
NP_001077145.1     355   VYSLKYDYPIDGNQELIAMGAGNIFGGSFRGFAASTSLSRSGVQESTGGK   404
NP_067328.1        353   VYSLKYDYPIDGNQELIALGVSNIFTGAFKGFAGSTALSRSGVQESTGGK   402
NP_446207.1        353   VYSLKYDYPIDGNQELIALGVSNIFTGAFKGFAGSTALSRSGVQESTGGK   402
NP_001186373.1     350   VYSIKHDYPIDGNQELIAFGLGNILGGSFKGFASSTALSRSGVQESTGGK   399
NP_001035265.1     351   VYSVKHDYIIDGNQELIAFGASNIFGGSFKALAASTALSRSAVQESTGGK   400
NP_001129155.1     362   VYSVKHDYTIDGNQELIAFGVSNMFGASFRSFAASTALSRTAIQESTGGK   411
NP_491138.2        386   LISKKLQYVVNSNQEWFALGLMHTTSSFFGCFAGGSSLGRTMMQVKCGTK   435
XP_004913063.1     351   VYSVKHDYVINGNQELVAFGLSNIFGGCFKGFAASTALSRSAVQESTGGK   400


NP_000102.1        410   TQIAGLIGAIIVLIVVLA--IGFLLAPLQKSVLAALALGNLKGMLMQFAE   457
XP_527858.2        408   TQIAGLIGAIIVLIVLLA--IGFLLAPLQKSVLAALALGNLKGMLMQFAE   455
XP_001090155.2     404   TQIAGLISAIVVLIVILA--IGFLLEPLQRSVLAALALGNLKGMLMQFAE   451
XP_540380.3        405   TQIAGILSAVIVLIVILA--LGFLLEPLQKSVLAALALGNLKGMLMQFTE   452
NP_001077145.1     405   TQIAGLISAIIVLIVV-A--IGFLLEPLQKSVLAALALGNLKGMLMQFVE   451
NP_067328.1        403   TQVAGLLSAVIVLIVIVA--IGFLLQPLQKSVLAALALGNLKGMLMQFAE   450
NP_446207.1        403   TQVAGLLSAVIVLIVIVA--IGFLLQPLQKSVLAALALGNLKGMLMQFAE   450
NP_001186373.1     400   TQIAGIVSAIIVLIVILA--IGFLLAPLQKSVLASLALGNLKGMLMQFRE   447
NP_001035265.1     401   TQIAGLLSAIIVLVVILG--IGFLLEPLPKSVLGAVVIVNLKGMLMQVVT   448
NP_001129155.1     412   TQIAGILSAMMVLIVIVG--VGFLLEPLPRSVLGALVIVNLKGMLMQFSE   459
NP_491138.2        436   SQLSTLITSIVLIIFVCGGAVG-CIQHLPKPVLASIVVVAMKDLFIQIFT   484
XP_004913063.1     401   TQIAGILSAIIVMIVILA--IGFLIEPLQKSVLGALVIINLKGMLMQFNE   448


NP_000102.1        458   IGRLWRKDKYDCLIWIMTFIFTIVLGLGLGLAASVAFQLLTIVFRTQFPK   507
XP_527858.2        456   IGRLWRKDKYDCLIWIMTFIFTIVLGLGLGLAASVAFQLLTIVFRTQFPK   505
XP_001090155.2     452   IRRLWRKDKYDCLIWVTTCIFTIVLGLGLGLAASVAFQLLTIVFRTQFPK   501
XP_540380.3        453   IRRLWRKDKYDCLVWIMTFIFAIVLGLGLGLAASVAFQLLTIVFRTQFPK   502
NP_001077145.1     452   IRRLWRKDKYDCLIWVMTFIFAVVLGLGLGLAASVAFQLLTIVFRTQFPK   501
NP_067328.1        451   IGRLWKKDKYDCLIWIMTFIFAIVLGLGLGLAASVAFQLLTIVFRTQFPK   500
NP_446207.1        451   IGRLWKKDKYDCLIWIMTFIFAIVLGLGLGLAASVAFQLLTIVFRTQFPK   500
NP_001186373.1     448   VGVLWRKDKYDCMIWVVTFLAAVFLGLDIGLATAVAFELLTVVIRSQIPS   497
NP_001035265.1     449   VPYLWKKDRPDCIVWVGTCLAAIILGLDIGLAVGLGLEFLTVVFRAQFPR   498
NP_001129155.1     460   LPFLWRNDRPDFVTWMVTFMASLFLGLDLGLAVGIGAELFTVVYRTQFPR   509
NP_491138.2        485   CFALRKLSFVDYLIFAATFISVIVLNVNFGLLIGVVFELLTVVLRSQWAD   534
XP_004913063.1     449   LPVLFRKDKYDMLVWIVTFLGAVLLGLDLGLAAGVGFELLTVVFRAQFPK   498


NP_000102.1        508   CSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPSPIYFANIGFFRRKLI   557
XP_527858.2        506   CSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPSPIYFANIGFFRQKLI   555
XP_001090155.2     502   CSTLANIGRSNIYKNKKDYYDMYELKGVKIFRCPSPIYFANIGFFKQKLI   551
XP_540380.3        503   CTTLANVGRSNIYKNKKDYPDMYEPEGVKIFRCPSPIYFANIHFFKQKLI   552
NP_001077145.1     502   CSMLANVGRSNIYKNRKDYSEIYKPEGVKIFRCPSPIYFANISFFKQKLI   551
NP_067328.1        501   CSTLANVGRSNIYKNKKNYAEVYEPEGVKIFRCPSPIYFANIGFFKQKLI   550
NP_446207.1        501   CSTLANVGRSNIYKNKKNYADVYEPEGVKIFRCPSPIYFANIGFFKQKLI   550
NP_001186373.1     498   CTTLANVGRSNIYRNRKDYNDIYEPEGVKIFKCSSPIFFANIEFFKEKLI   547
NP_001035265.1     499   CCVLANIPGTDIYRDRKHYINIFEPEGVKIFRIPSPIFFANIEFFRDKLK   548
NP_001129155.1     510   CSVLANISGTDLYRDRKDYTSIYEPDGVKIFKIPSPIFFANIDFFRDKLV   559
NP_491138.2        535   SSLLGRITGTNHYRRLGLYETANDIPGIKIFRFDSPIYFGNSEMFVRKIH   584
XP_004913063.1     499   CSQIANVGGSNIYKNRKDYKNIYEPQGVKIFRCPSPVFFANIEFFKDKVI   548


NP_000102.1        558   DAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDTIKDSDEE   607
XP_527858.2        556   DAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDTIKDSDEE   605
XP_001090155.2     552   DAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDTIKDSDEE   601
XP_540380.3        553   NAVGFNPLRILRKRNKALKKIRKLQKKGLLQMTPKGLICTHDGFKDSDDE   602
NP_001077145.1     552   DAIGFRPLRILRKRNKALKKIRKLQKKGLLQVTPKGFICTVDGFKDSDEE   601
NP_067328.1        551   DAVGFSPLRILRKRNKALKKIRKLQKRGLIQMTPKGFICTSDGFKDSDEE   600
NP_446207.1        551   DAVGFNPLRILRKRNKALKKIRKLQKQGLIQVTPKGFICTSDGFKDSDEE   600
NP_001186373.1     548   SAVGFSPLRVLRKRNKALRKIRKMLKKGELQVTPKGLICMAHHTQESDDE   597
NP_001035265.1     549   DAVGFNPLRILRKRNKAVKKIKKMLKKGELTLTSNGLQTTC--LMPIEES   596
NP_001129155.1     560   QEVGFNPMRVLKKRNKALRKIRKMLCNGELEVSDRG---PV--LRQPSVD   604
NP_491138.2        585   QACGLNPL-IVRGELETENKKKDARKEKE----EEDAEIPKETEKETKLE   629
XP_004913063.1     549   AAVGFNPLRILRKRNKALRKIRKLLSKGELQWTPKGMINTSNYNIDSDEE   598


NP_000102.1        608   LDNNQIEVLDQPINTTDLPFHIDWNDDLPLNIEVPKISLHSLILDFSAVS   657
XP_527858.2        606   LDNNQIEVLDQPINTTDLPFQIDWNDDLPLNIEVPKISLHSLILDFSAVS   655
XP_001090155.2     602   LDNNQIQVLDEPIDTTDLPFQIDWNDQLPLNIEVPKISLHSLILDFSAVS   651
XP_540380.3        603   LDNNEIEELDQPINTTDLPFQIDWNADLPLNIMVPKVSLHSLILDFSAVS   652
NP_001077145.1     602   LDNDKIEELDQPINTKDLPFQIDWNANLPLNIVVPKINLHSLILDFSAVS   651
NP_067328.1        601   LDNNQIEELDQPINTTDLPFDIDWNGDLPLNITIPKISLHSLILDFSAVS   650
NP_446207.1        601   LDNNQIEELDQPINTTDLPFEIDWNADLPLNITIPKISLHSLILDFSAVS   650
NP_001186373.1     598   LDNNRMEELDQPTDMADLPIQINWDAELPPGIVVPRVDIHSIVLDFSAVS   647
NP_001035265.1     597   EYDSNADDLDQPTDYTDLPIQINWNAELPANISVPPVNIHSLILDFSAVS   646
NP_001129155.1     605   TSEGSMEDLDQPIDFSDLPIQVNWNSQLPANISVPPVNIHSLILDFCAVS   654
NP_491138.2        630   VTTHQAKVLDEK------------HAEPEPNPADQYERLTHIIIDCSTII   667
XP_004913063.1     599   LDNNHIEELDQPTYTADLPITINWNEDLPNNISVPKIDIHSLILDFGAVS   648


NP_000102.1        658   FLDVSSVRGLKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFFDGEVKSS   707
XP_527858.2        656   FLDVSSMRGLKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFFDGEVKNS   705
XP_001090155.2     652   FLDVSSMRGLKSILQEFIRIKVDVYIVGVDDDFIEKLNRYEFFDGEVKTS   701
XP_540380.3        653   FLDVSSMRGLKTVLQEFIRINVDVYIVGSDDDFIEKLARCEFFDDEVKDS   702
NP_001077145.1     652   FLDVSSMRGLKTILQEFIRIQVDVYIVGTDDDFIEKLKRCEFFDDEVKDS   701
NP_067328.1        651   FLDVSSMRGLRTILQEFIRIKVDVYIVGTDDDFIDKLARCEFFDDEVTDS   700
NP_446207.1        651   FLDISSMRGLRTILQEFIRIKVDVYIVGTDDDFIDKLARCEFFDDEVTDS   700
NP_001186373.1     648   FLDFSAMRVLQKTLKEFVRIDIDIYIAGAHEGFLEKLERCAFFDEEIKPS   697
NP_001035265.1     647   FIDISAIKGLKAAIKEFIRIDVDVYIVGCDTGIMEKLKNCKFFDDEIKSS   696
NP_001129155.1     655   FIDVSALKGLKATLKEFIRIEVDVYIVSCDVYIMEKLQHCTFFDDEIKTS   704
NP_491138.2        668   YVDLMGQGALKDVYNDYKTIGISVLFANTNEHVRQNFETSQFFE-EVPRG   716
XP_004913063.1     649   FIDMSGMKGLKGALKEFLKIEVDIYIAGIDDNLLEKLERCGFFDDEITTS   698


NP_000102.1        708   IFFLTIHDAVLHILMKKDYSTSKFNPS------------QEKDGKI----   741
XP_527858.2        706   IFFLTIHDAVLHILMKKDYSTSKFNPS------------QEKDGKI----   739
XP_001090155.2     702   ILFLTIHDAVLHISMKKDYSTSKFKPS------------QEKDGKI----   735
XP_540380.3        703   IFFLTIHDAVLHIWMKKDYGISKFNSS------------QEKEMKF----   736
NP_001077145.1     702   IFFLTIHDAVLHILMKKDYSTSKFNPS------------QEVEAKL----   735
NP_067328.1        701   IFFLTIHDAILHILMKKDYSTSKFNSS------------QEKERKF----   734
NP_446207.1        701   IFFLTIHDAILHIWMKKDYSTSKFNSS------------QEKERKF----   734
NP_001186373.1     698   MFFLTIHDAVLHILLKKDIASSPKLKL------------GEKGSSN----   731
NP_001035265.1     697   IFFLTIHDAVLYIQ-----ESHPPRTV------------SEKVSGSHQYQ   729
NP_001129155.1     705   IFYPTLHDAMLHIL-----ETHPDHGE------------LEK--------   729
NP_491138.2        717   RMFVSVSDAVDQAELEQRHKTETVQTTAAPKATVVPPVAKSVGQKSVPIT   766
XP_004913063.1     699   IIFLSIHDAVLHILAKKD-NMANLNNF------------KEKETRFFANE   735


NP_000102.1        742   -----------------DFTINTN----GGLRNRVYEVPVETKF------   764
XP_527858.2        740   -----------------DFTINTN----GGLRNRVYEVPVETKF------   762
XP_001090155.2     736   -----------------DFTINTN----GGLRNREYQVRFFNRFIFT---   761
XP_540380.3        737   -----------------DFTINTN----GGLRNRECQIPVETKF------   759
NP_001077145.1     736   ----------------DDFTINTN----GGLRNRECQVPIETKF------   759
NP_067328.1        735   -----------------DFTINTN----GGLRNRECQVPVETKF------   757
NP_446207.1        735   -----------------DFTINTN----GGLRNRECQVPVETKF------   757
NP_001186373.1     732   -----------------NYVITTS----NGQRSWESTIPAETKF------   754
NP_001035265.1     730   HLNGSSVSNGVALQEIADMKIEEE----TDPKP-------ETRF------   762
NP_001129155.1     730   -----------------DININYE----VIQRD-------SLTV------   745
NP_491138.2        767   EPVLVPIQSSASLVTGIDFSMKENTAKGGKFPNPTRKLRVPSKLSLMEEL   816
XP_004913063.1     736   YTNLGISSKDFAQQEKESFANDKN----NGLRNRANSETVSSAL------   775


NP_000102.1              -------
XP_527858.2              -------
XP_001090155.2           -------
XP_540380.3              -------
NP_001077145.1           -------
NP_067328.1              -------
NP_446207.1              -------
NP_001186373.1           -------
NP_001035265.1           -------
NP_001129155.1           -------
NP_491138.2        817   EKTDKTQ   823
XP_004913063.1           -------


Protein Acc. Gene Organism
NP_000102.1 SLC26A3 H.sapiens
XP_527858.2 SLC26A3 P.troglodytes
XP_001090155.2 SLC26A3 M.mulatta
XP_540380.3 SLC26A3 C.lupus
NP_001077145.1 SLC26A3 B.taurus
NP_067328.1 Slc26a3 M.musculus
NP_446207.1 Slc26a3 R.norvegicus
NP_001186373.1 SLC26A3 G.gallus
NP_001035265.1 si:dkey-31f5.1 D.rerio
NP_001129155.1 slc26a3 D.rerio
NP_491138.2 sulp-6 C.elegans
XP_004913063.1 LOC101731072 X.tropicalis


Support Center