Display Settings:

Format

Send to:

Choose Destination
HomoloGene:4902. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_006727.2              --------------------------------------------------
XP_001147180.2           --------------------------------------------------
XP_002799104.1           --------------------------------------------------
XP_003434299.1       1   MHRPAPIAHRPARARESGRGTAGCGPLSAAEPAPARPGMTSPRREPKIAG   50
NP_001029764.1           --------------------------------------------------
NP_001153355.1           --------------------------------------------------
NP_001103011.1           --------------------------------------------------
XP_424624.4          1   -----CGPEGRSRNELRRQGKELFCPLGAQSCQAALPGCACGHRYCGSDG   45
NP_001073462.1           --------------------------------------------------
NP_725541.1              --------------------------------------------------
XP_320338.4              --------------------------------------------------
NP_001015737.1           --------------------------------------------------


NP_006727.2          1   -----------------------------MASYYEILDVPRSASADDIKK   21
XP_001147180.2       1   -----------------------------MASYYEILDVPRSASADDIKK   21
XP_002799104.1       1   -----------------------------MASYYEILDVPRSASADDIKK   21
XP_003434299.1      51   PAPASRQPARRPQPRPRAQAAGPPRALVVSAPLTQAGAHSRARRPPQLPR   100
NP_001029764.1       1   -----------------------------MASYYEILDVPRSASADDIKK   21
NP_001153355.1       1   -----------------------------MASYYEILDVPRSASPDDIKK   21
NP_001103011.1       1   -----------------------------MASYYEILDVPRSASPDDIKK   21
XP_424624.4         46   WLGFGGWEKRAERCCCRHGRS--------CERSARLGWLPCARRSLCLCR   87
NP_001073462.1       1   -----------------------------MVDYYDVLGVSRSASPDDIKK   21
NP_725541.1          1   -----------------------------MVDYYKILDVSRSATDSEVKK   21
XP_320338.4          1   -----------------------------MVDYYKILDVSRTATEAEIKK   21
NP_001015737.1       1   -----------------------------MVDYYDILGVPRNASQDDIKR   21


NP_006727.2         22   AYRR--------------------KALQWHPDKNPDNKEFAEKKFKEVAE   51
XP_001147180.2      22   AYRR--------------------KALQWHPDKNPDNKEFAEKKFKEVAE   51
XP_002799104.1      22   AYRR--------------------KALQWHPDKNPDNKEFAEKKFKEVAE   51
XP_003434299.1     101   AARPVPDGSGGGQGRGRPGGGRAWKALQWHPDKNPDNKEFAERKFKEVAE   150
NP_001029764.1      22   AYRK--------------------KALQWHPDKNPDNKEFAEKKFKEVAE   51
NP_001153355.1      22   AYRK--------------------KALQWHPDKNPDNKEFAEKKFKEVAE   51
NP_001103011.1      22   AYRK--------------------KALQWHPDKNPDNKEFAEKKFKEVAE   51
XP_424624.4         88   RYRK--------------------AALKWHPDKNPDNKEYAEQKFKEIAE   117
NP_001073462.1      22   AYRK--------------------LALQWHPDKNPDNKEEAEKKFKEIAE   51
NP_725541.1         22   AYRK--------------------LALKWHPDKNPDNLDEANKRFRELSE   51
XP_320338.4         22   AYKK--------------------LALRWHPDKNMDNPEESNRRFKEISE   51
NP_001015737.1      22   AYRK--------------------LALRWHPDKNPDNKEHAERKFKDIAE   51


NP_006727.2         52   AYEVLSDKHKREIYDRYGREGLTGTGTGPS------RAEAGSGGP-----   90
XP_001147180.2      52   AYEVLSDKHKREIYDRYGREGLTGTGTGPS------RAEAGSGGP-----   90
XP_002799104.1      52   AYEVLSDKHKREIYDRYGREGLTGTGTGPS------RAEAGSGGP-----   90
XP_003434299.1     151   AYEVLSDKHKREIYDRYGREGLTGAGTGPS------RAEPGGGGP-----   189
NP_001029764.1      52   AYEVLSDKHKREIYDLYGREGLTGAGTGPS------RAEAGSGGP-----   90
NP_001153355.1      52   AYEVLSDKHKREIYDRYGREGLTGAGSGPS------RSETGGAGP-----   90
NP_001103011.1      52   AYEVLSDR------------------SGPS------RSETGGMEP-----   72
XP_424624.4        118   AYEVLSDKQKRDVYDHYGKEGLMGAGPGGS------RADAGA--P-----   154
NP_001073462.1      52   AYEVLSDKSKRDDYDRYGRSDMPSSGSGSS------GSFPDDF-P-----   89
NP_725541.1         52   AYEVLSDEKKRRIYDEYGKDGLGDRGQSRSHA----RHHYSTHDFDDFDI   97
XP_320338.4         52   AYEVLSDEKKRRIYDQYGKDGLMNNGSDRYHQSTRHRRHNGSSGMDDFEF   101
NP_001015737.1      52   AYEVLSDREKREAYDNM-TSGF--SDPGAF------RATRVQRPF-----   87


NP_006727.2         91   --GFTFTFRSPEEVFREFFGSGDPFAELF-DDLGPFSELQN--RGSRHSG   135
XP_001147180.2      91   --GFTFTFRSPEEVFREFFGSGDPFAELF-DDLGPFSELQN--RGSRHSG   135
XP_002799104.1      91   --GFTFTFRSPEEVFREFFGSGDPFAELF-DDLGPFSELQN--RGSRHSG   135
XP_003434299.1     190   --GFTFTFRSPEEVFREFFGSGDPFAELF-DDLGPFSELQS--RGSRPSG   234
NP_001029764.1      91   --GFTFTFRSPEEVFREFFGSGDPFAELF-DDLGPFSELQN--RGSRHSG   135
NP_001153355.1      91   --GFTFTFRSPEEVFREFFGSGDPFSELF-DDLGVFSELQN--QGPRLTG   135
NP_001103011.1      73   --GFTFTFRSPEEVFREFFGSGDPFSELF-DDLGAFSELQN--QGSRLTG   117
XP_424624.4        155   --EFTFTFRSAHDVFREFFGGRDPFADFF-DEMLPFSELRG--AGPRHHG   199
NP_001073462.1      90   --GFTFTFRSPDEVFREFFGGQDPFADFF-DDF-PFGGMHSGFHSSSRLG   135
NP_725541.1         98   LGGFQFAFRPPEEVFREFFGIHSPFADLFRDANGHSNGSTSGSSGSRRNG   147
XP_320338.4        102   F-GFPFTFRDPEDVFREFFG-GSPFDELFRSMFSLTHIHVL-RHGRRANG   148
NP_001015737.1      88   --DFGFQFRSPEDVFRDFFGGKDPFPDMIGDDVFMFPNHP---HGVTHHA   132


NP_006727.2        136   P--FFTFSSSFPGHSD----------------------------FSSSSF   155
XP_001147180.2     136   P--FFTFSSSFPGHSD----------------------------FSSSSF   155
XP_002799104.1     136   P--FFTFSSSFPGHSD----------------------------FSSSSF   155
XP_003434299.1     235   P--FFTFSSSFPGHSD----------------------------FSSSSF   254
NP_001029764.1     136   P--FFTFSSSFPGHSD----------------------------FSSSSF   155
NP_001153355.1     136   P--FFTFSSSFPANSD----------------------------FSSSSF   155
NP_001103011.1     118   P--FFTFSSSFPGNSD----------------------------FSSSSF   137
XP_424624.4        200   G--GHFF-STFPGSSD----------------------------FFASSF   218
NP_001073462.1     136   PSRFFSFPSANADFTS----------------------------FSSSLG   157
NP_725541.1        148   GSSGSSRHH--HHHHQHKVASPFGAPMLNYSMMDFFMPTSGFTSFSSMTH   195
XP_320338.4        149   ATNGHHHHHQRHSHPQNVISSPFMTPLMSFSLMDDF--------FSGAPR   190
NP_001015737.1     133   NS-VPMFPSSFHFGNE----------------------------FSFHSG   153


NP_006727.2        156   S--------FSPGAG-AFRSVSTSTTFVQGRRITTRRIMENGQERVEVEE   196
XP_001147180.2     156   S--------FSPGAG-AFRSVSTSTTFVQGRRITTRRIMENGQERVEVEE   196
XP_002799104.1     156   S--------FSPGAG-AFRSVSTSTTFVQGRRITTRRIMENGQERVEVEE   196
XP_003434299.1     255   S--------FSPGAG-AFRSVSTSTTFVQGHRITTRRIMENGQERVEVEE   295
NP_001029764.1     156   S--------FSPGAG-AFRSVSTSTTFVQGRRITTRRIMENGQERVEVEE   196
NP_001153355.1     156   S--------FSPGAG-AFRSVSTSTTFVQGRRITTRRIMENGQERVEVEE   196
NP_001103011.1     138   S--------FSPGAG-AFRSVSTSTTFVQGRRITTRRIMENGQERVEVEE   178
XP_424624.4        219   S--------SGADAGLGFRSVSTSTTFVNGRRITTKRIIENGRERVEVEE   260
NP_001073462.1     158   G--------MGSMGGANFKSVSTSTRVVNGKRLTTKKVRENGQERTEVEE   199
NP_725541.1        196   GNGSSGVTHISSGPGASVKRTSTSTVFVNGKKLMTKRVVENGKETVFSYE   245
XP_320338.4        191   G-GMSSVSEYTIGGGGPVKRTSTSTTFINGKKLMTKKVYENGTETIMSYE   239
NP_001015737.1     154   G--------L--GGSRNFCSVSTSTKFVNGKRITTKRIMENDVERIEVEE   193


NP_006727.2        197   DGQLKSVTINGVPDDLALGLELSRREQ---------QPSVTSRSGGTQ--   235
XP_001147180.2     197   DGQLKSVTINGVPDDLALGLELSRREQ---------QPSVTSRSGGTQ--   235
XP_002799104.1     197   DGQLKSVTINGVPDDLALGLELSRREQ---------QPSVTSRSGGTQ--   235
XP_003434299.1     296   DGQLKSVTINGVPDDLALGLELSRREQ---------QQSVTSRSGGTQ--   334
NP_001029764.1     197   DGQLKSVTINGIPDDLALGLELSRREQ---------QQSVTSRSGATQ--   235
NP_001153355.1     197   DGQLKSVSINGVPDDLALGLELSRREQ---------QPSVAPGLGVMQ--   235
NP_001103011.1     179   DGQLKSVSINGVPDDLALGLELSRREQ---------QPSVTPGLGVMQ--   217
XP_424624.4        261   DGELKSIHIDGVPDDMALGLELSRREQ---------QAFSSPRPPSPPPP   301
NP_001073462.1     200   DGVLKSVLINGVEDEMALALELSRREQSSEPPRQSHQPLLRPNNHSSPNP   249
NP_725541.1        246   NDVLKSKTVMGSLQ------------------------------------   259
XP_320338.4        240   NDVLKSKTVNGVAQAIPYNH------------------------------   259
NP_001015737.1     194   DGELKSILVNGVEDDLALAVELSKREQAS-------VPRASARTDGPSYN   236


NP_006727.2        236   -VQQTPAS----CP--LDSDLS-EDEDLQLAMAYSLSEMEAAGKKP----   273
XP_001147180.2     236   -VQQTPAS----CP--LDSDLS-EDEDLQLAMAYSLSEMEAAGKKP----   273
XP_002799104.1     236   -VQQTPAS----CP--LDSDLS-EDEDLQLAMAYSLSEMEAAGKKP----   273
XP_003434299.1     335   -VRQTPAS----HP--SDSDLSEDDEDLQLAMAYSLSEMEAAGKKP----   373
NP_001029764.1     236   -VRQTPVS----RP--LDGSLSEEDEDLQLAMAYSLSEMEAAGKKP----   274
NP_001153355.1     236   -VRPTSLS----RP--PDHDLS-EDEDLQLAMAYSLSEMEAAGQKP----   273
NP_001103011.1     218   -VRPTSVS----RP--PDSDLS-EDEDMQLAMAYSLSEMEASGQKP----   255
XP_424624.4        302   APQQPPSS----SPICLYTDSEDEDEDLQLAMAYSLSEMEAAGHHQ----   343
NP_001073462.1     250   ALRSYSAAPFYHCP---SSNEDEEDEDLQMALAYSLSEMDAQQRAEDMIS   296
NP_725541.1              --------------------------------------------------
XP_320338.4              --------------------------------------------------
NP_001015737.1     237   IQQRSPGT-----P--VVQDRDDEDEELQLAMACSLSEFEQSRQHP----   275


NP_006727.2        274   -AGGREAQHRRQGRPKAQHQDPGLGGTQEGARGEATKRS-----------   311
XP_001147180.2     274   -AD-----------------------------------------------   275
XP_002799104.1     274   -AGGREAQHRRQGRPKAQHQDPGLGGTQEGARGEATKRS-----------   311
XP_003434299.1     374   -AD-----------------------------------------------   375
NP_001029764.1     275   -AD-----------------------------------------------   276
NP_001153355.1     274   -AGGRGAQQRQHGQPKAQHRDLDVGGTHKSVRGEAAKLS-----------   311
NP_001103011.1     256   -A------------------------------------------------   256
XP_424624.4        344   -AGGHGPSAPPAPGGSPGPRATSAAHGPRGGPEREPPRAGSPTTP-----   387
NP_001073462.1     297   GAGGGRGRISGAVGGKGGKSGDGTGGVQINQNMREETDESDQNTPSSPED   346
NP_725541.1              --------------------------------------------------
XP_320338.4              --------------------------------------------------
NP_001015737.1     276   -EG-----------------------------------------------   277


NP_006727.2        312   ------------------------------PSPEEKASRCLIL   324
XP_001147180.2     276   -----------------------------------------VF   277
XP_002799104.1     312   ------------------------------PSPEEKASRCLIL   324
XP_003434299.1     376   -----------------------------------------VF   377
NP_001029764.1     277   -----------------------------------------VF   278
NP_001153355.1     312   ------------------------------PSSEEKASRCHIL   324
NP_001103011.1     257   ----------------------------------------DVF   259
XP_424624.4        388   ---------------------------GRKPASKAKQWHCRLL   403
NP_001073462.1     347   RLTEQGLAKGSEAVIVQDRENDKMAANGTNVVKKRRKCQCVVC   389
NP_725541.1              -------------------------------------------
XP_320338.4              -------------------------------------------
NP_001015737.1     278   -----------------------------------------VF   279


Protein Acc. Gene Organism
NP_006727.2 DNAJB2 H.sapiens
XP_001147180.2 DNAJB2 P.troglodytes
XP_002799104.1 DNAJB2 M.mulatta
XP_003434299.1 DNAJB2 C.lupus
NP_001029764.1 DNAJB2 B.taurus
NP_001153355.1 Dnajb2 M.musculus
NP_001103011.1 Dnajb2 R.norvegicus
XP_424624.4 DNAJB2 G.gallus
NP_001073462.1 dnajb2 D.rerio
NP_725541.1 mrj D.melanogaster
XP_320338.4 AgaP_AGAP012194 A.gambiae
NP_001015737.1 dnajb2 X.tropicalis


Support Center