Display Settings:

Format

Send to:

Choose Destination
HomoloGene:393. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_000446.1              --------------------------------------------------
XP_524028.2              --------------------------------------------------
XP_001093806.1           --------------------------------------------------
XP_542206.2              --------------------------------------------------
NP_035622.1              --------------------------------------------------
NP_001101539.1           --------------------------------------------------
NP_001039298.1           --------------------------------------------------
NP_001017839.1           --------------------------------------------------
XP_312848.5          1   -----MNSSFPAAIPYSNDGGHRSKPTSATHNNNGSCVNDAHGSDEDEEQ   45
NP_001256779.1       1   MDAPSTSSGAQSKLLMPGDDEADEDHQNRGDPNLQQKQKIQLNVDPDYDD   50
NP_001016533.1           --------------------------------------------------


NP_000446.1          1   --------MEVV-DPQQLGMFTEGEL----------MSVGM---------   22
XP_524028.2          1   --------MEVV-DPQQLGMFTEGEL----------MSVGM---------   22
XP_001093806.1       1   --------MEVV-DPQQLGMFTEGEL----------MSVGM---------   22
XP_542206.2          1   --------MDVA-DPQQLGMFTEGEL----------MSVGM---------   22
NP_035622.1          1   --------MDVA-DPEPLGLFSEGEL----------MSVGM---------   22
NP_001101539.1       1   --------MDVA-DPQPLGLFPEGEL----------MSVGM---------   22
NP_001039298.1       1   --------MDMQ-ESQQLGMFGESEL----------MSVGM---------   22
NP_001017839.1       1   --------MSVGADLQHLDYLTENEL----------M--GM---------   21
XP_312848.5         46   AHGQDRFAFACD-EPPPDGRLQPSDS----------LEDDL---------   75
NP_001256779.1      51   DEDDDCFIDGCEASAPITRELVDGAIERRSKDRNVKMSIGVYDEYDDDDD   100
NP_001016533.1       1   --MLCPSSMDEG-GSQEIGFLGD-------------LSVGM---------   25


NP_000446.1         23   -----D-------------------------------------TFIHRID   30
XP_524028.2         23   -----D-------------------------------------TFIHRID   30
XP_001093806.1      23   -----D-------------------------------------TFIHRID   30
XP_542206.2         23   -----D-------------------------------------TFIHRID   30
NP_035622.1         23   -----D-------------------------------------TFIHRID   30
NP_001101539.1      23   -----D-------------------------------------TFIHRID   30
NP_001039298.1      23   -----D-------------------------------------TFIHRID   30
NP_001017839.1      22   -----D-------------------------------------TFIHRID   29
XP_312848.5         76   -----EEVYRTCNTQSAVEWINDDDELERLDLPLESLDPTGGGTVFNRVD   120
NP_001256779.1     101   DEEETEEDQRRRFVEGIRNIRHKQQESFDLEEHPIPVESEAMRQFINQQV   150
NP_001016533.1      26   -----D-------------------------------------TFIHRID   33


NP_000446.1         31   STEVIYQP----------RRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSE   70
XP_524028.2         31   STEVIYQP----------RRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSE   70
XP_001093806.1      31   STEVIYQP----------RRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSE   70
XP_542206.2         31   STEVIYQP----------RRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSE   70
NP_035622.1         31   STEVIYQP----------RRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSE   70
NP_001101539.1      31   STEVIYQP----------RRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSE   70
NP_001039298.1      31   STEVIYQP----------RRKRAKLIGKYLMGDLLGEGSYGKVKEMLDSE   70
NP_001017839.1      30   STEVIYQP----------RRKRAKLIGKYLMGDLLGEGSYGKVKEMLDPE   69
XP_312848.5        121   SSDIIYQE----------KKKKCKLVGKYVMGDVLGEGSYGKVKEVLDSE   160
NP_001256779.1     151   NNAMMFNQDNHIEFEPIVKQKGPKIIEGYMWGGQIGTGSYGKVKECIDMY   200
NP_001016533.1      34   STEVIYQP----------RRKRAKLVGKYLMGDLLGEGSYGKVKEMLDSD   73


NP_000446.1         71   TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE   120
XP_524028.2         71   TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE   120
XP_001093806.1      71   TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE   120
XP_542206.2         71   TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE   120
NP_035622.1         71   TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHRNVIQLVDVLYNE   120
NP_001101539.1      71   TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHRNVIQLVDVLYNE   120
NP_001039298.1      71   TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE   120
NP_001017839.1      70   TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLQHKNVIQLVDVLYNE   119
XP_312848.5        161   TLNRRAVKILTKRKLRRIPNGEQNVRSEIKLLRKLQHRNVIELLDVLYNE   210
NP_001256779.1     201   TLTRRAVKIMKYDKLRKITNGWENIRSEMSILRRMNHRNVIKLIEIFNIP   250
NP_001016533.1      74   TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHRNVIQLVDVLYNE   123


NP_000446.1        121   EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQ   170
XP_524028.2        121   EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQ   170
XP_001093806.1     121   EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQ   170
XP_542206.2        121   EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLVDGLEYLHSQ   170
NP_035622.1        121   EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFRQLIDGLEYLHSQ   170
NP_001101539.1     121   EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFRQLIDGLEYLHSQ   170
NP_001039298.1     121   EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVFQAHGYFCQLIDGLEYLHSQ   170
NP_001017839.1     120   EKQKMYMVMEYCVCGMQEMLDSVPGKRFPVFQAHGYFCQLLDGLEYLHSQ   169
XP_312848.5        211   QKQKMYLIMEYCVGGLQEMLDSVPDKRLPIHQAHDYFVQLLDGLEYLHGR   260
NP_001256779.1     251   AKGKVYMVFEYCIGSVQQLLDMEPARRLTIGESHAIFIELCQGLNYLHSK   300
NP_001016533.1     124   EKQKMYMVMEYCVCGMQEMLDSVQEKHFPVFQAHGYFCQLIDGLEYLHSQ   173


NP_000446.1        171   GIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQ   220
XP_524028.2        171   GIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQ   220
XP_001093806.1     171   GIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQ   220
XP_542206.2        171   GIVHKDIKPGNLLLTTSGTLKISDLGVAEALHPFAEDDTCRTSQGSPAFQ   220
NP_035622.1        171   GIVHKDIKPGNLLLTTNGTLKISDLGVAEALHPFAVDDTCRTSQGSPAFQ   220
NP_001101539.1     171   GIVHKDIKPGNLLLTTNGTLKISDLGVAEALHPFAVDDTCRTSQGSPAFQ   220
NP_001039298.1     171   GIVHKDIKPGNLLLTTNGTLKISDLGVAEALHPFAEDDTCRTSQGSPAFQ   220
NP_001017839.1     170   GIVHKDIKPGNLLLTTDGALKISDLGVAEALHPFAKDDTCRTSQGSPAFQ   219
XP_312848.5        261   GIIHKDIKPGNLLLTLDHTLKISDFGVAEALDTFAPTDECTTGQGSPAFQ   310
NP_001256779.1     301   RVSHKDIKPGNLLVSIDFTVKICDFGVAEQINLFQRDGRCTKVNGTPKFQ   350
NP_001016533.1     174   GIVHKDIKPGNLLLTTDGTLKISDLGVAEALHPFAEGDTCRTSQGSPAFQ   223


NP_000446.1        221   PPEIANG-LDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGK   269
XP_524028.2        221   PPEIANG-LDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGK   269
XP_001093806.1     221   PPEIANG-LDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGK   269
XP_542206.2        221   PPEIANG-LDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGK   269
NP_035622.1        221   PPEIANG-LDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGR   269
NP_001101539.1     221   PPEIANG-LDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGR   269
NP_001039298.1     221   PPEIANG-LDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGK   269
NP_001017839.1     220   PPEIANG-LDTFSGFKVDIWSAGVTLYNITTSLYPFEGDNIYKLFENIGK   268
XP_312848.5        311   PPEIANG-HEVFSGFKVDIWSTGVTLYNITTGLYPFEGDNIYKLLENIGK   359
NP_001256779.1     351   PPECIYGNHDFFDGYKADMWSAGVTLYNLVSGKYPFEKPVLLKLYECIGT   400
NP_001016533.1     224   PPEIANG-LDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGK   272


NP_000446.1        270   GSYAIPGDCG--PPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAE   317
XP_524028.2        270   GSYAIPGDCG--PPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAE   317
XP_001093806.1     270   GSYAIPGDCG--PPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAE   317
XP_542206.2        270   GDYTIPGDCG--PPLSDLLRGMLEYEPARRFSIQQIRQHSWFRKKHPPAE   317
NP_035622.1        270   GDFTIPCDCG--PPLSDLLRGMLEYEPAKRFSIRQIRQHSWFRKKHPLAE   317
NP_001101539.1     270   GDFTIPCDCA--PPLSDLLRGMLEYEPAKRFSIRQIRQHSWFRKKHPLAE   317
NP_001039298.1     270   GDFTIPEDCG--PPLSDLLRGMLEYDPAKRFSIQQIRQHNWFRKKHAQAE   317
NP_001017839.1     269   GDYSIPEECG--PLLSDLLRGMLEYDPVKRFSIQRIRQHNWVRKKHASSE   316
XP_312848.5        360   CEWNPPEWLE--PRLADLLVNILQADPRRRFTLQQIRHHEWFQFAPDATS   407
NP_001256779.1     401   EPLQMPTNVQLTKDLQDLLTKLLEKDFNERPTCLETMIHPWFLSTFPEDQ   450
NP_001016533.1     273   GDYSIPEECG--PLLSDLLRGMLEYDPAKRFSIQQIRQHNWFRKKHPHMD   320


NP_000446.1        318   APVPIPPSPDTKDRW-RSMTVVPYLEDLH-GADED--------EDLFDIE   357
XP_524028.2        318   APVPIPPSPDTKDRW-RSMTVVPYLEDLH-GAGEH--------EDLFDIE   357
XP_001093806.1     318   APVPIPPSPDTKDRW-RSMTVVPYLEDLH-GADED--------EDLFDIE   357
XP_542206.2        318   ELVPIPPSTDCKDRW-RGMTVVPYLEDLH-GCADDNG-----EEDLFDIE   360
NP_035622.1        318   ALVPIPPSPDTKDRW-RSMTVVPYLEDLH-GRAEEEE-----EEDLFDIE   360
NP_001101539.1     318   ALVPIPPSPDTKDRW-RSMTVVPYLEDLH-GRAEEEE-----DEDLFDIE   360
NP_001039298.1     318   TLVPIPPSPETKDKW-RSMTAVPYLEDLH-GYNED-E-----DDDLYDIE   359
NP_001017839.1     317   RPVPIPPSAETRDRW-RSMTVVPYLEDLH-GYGDEED-----EEELFDGE   359
XP_312848.5        408   PLVPIPP---LKGDWNRCSTVLPYLIA-H-HYGNDRDMPYYTEHDINEMA   452
NP_001256779.1     451   GLGRIMERMRTGD---RPLTMLSSMTALYDGITPEDELII--EDNLGIIQ   495
NP_001016533.1     321   PIVPIPPSPETKDRW-RSLTVVPYLEDLH-GYSEE--------EDLCDLE   360


NP_000446.1        358   --------DDIIYTQDFTV--------PGQVPEEEASHNGQR--R--GLP   387
XP_524028.2        358   --------DDIIYTQDFTV--------PGQVPEEEASQNGQR--R--GLP   387
XP_001093806.1     358   --------DDIIYTQDFTV--------PGQVPEEEASQNGQS--R--GLP   387
XP_542206.2        361   --------DDIIYTQDFTV--------PGQVPEEEAGQNGQS--R--GPP   390
NP_035622.1        361   --------DGIIYTQDFTV--------PGQVLEEEVGQNGQS--H--SLP   390
NP_001101539.1     361   --------DGIIYTQDFTV--------PGQVLEEEVGQNGQS--H--SLP   390
NP_001039298.1     360   --------DDIIYTQDFTV--------PGQVPEEEAGQNGQSRGR--GLP   391
NP_001017839.1     360   --------DDIIYTQDFTV--------PGQVAEDEEEDEECAPERTCAVA   393
XP_312848.5        453   RQQYDSYTEGGLYDRAYLP--------APTMDSLSFHTDDQGSET--GLR   492
NP_001256779.1     496   QILPINLTSEAVLERGSFPGFKFLEAKPGDGPDGVEGSEDSAAPL--GPQ   543
NP_001016533.1     361   --------DDIIYTQDFTV--------PGQVAEDDYFAQTQS--T--APS   390


NP_000446.1        388   K-------AVCMN-GTEAAQLSTKSRAEGR-------APNPARK-----A   417
XP_524028.2        388   K-------AVCMN-GTEAAQLSTKSRAEGR-------APNPARK-----A   417
XP_001093806.1     388   K-------AVCMN-GTEAAQLSTKSKAEGR-------APNPARK-----A   417
XP_542206.2        391   K-------VVCMN-GTESAQLSTKSKVERR----ASAASNPARK-----A   423
NP_035622.1        391   K-------AVCVN-GTEP-QLSSKVKPEGR-----PGTANPARK-----V   421
NP_001101539.1     391   K-------AVCVN-GTEP-QLSSKVKPEGR-----PGAANPARK-----V   421
NP_001039298.1     392   K-------AICMN-GTEPGQLSTKSKAERR----ASASSNPSRK-----A   424
NP_001017839.1     394   K-------AVCVN-GTESAAL--KPKCERR----SSSSSNPSRK-----G   424
XP_312848.5        493   R-------AYYNQPNSGSGRSTVEKRPSRS----FSLSPKPSIRHMIGTS   531
NP_001256779.1     544   RRPSSRSMPTCAPPGPAAGNAQNSTAENGAETDGVASASDPPPT-----A   588
NP_001016533.1     391   K-------QLCMN-GTEN-QLKTERRV----------SSSSQRK-----A   416


NP_000446.1        418   CSASS-------------------KIRRLSACKQQ------   433
XP_524028.2        418   CSASS-------------------KIRRLSACKQQ------   433
XP_001093806.1     418   CSASS-------------------KIRRLSACKQQ------   433
XP_542206.2        424   CSASS-------------------KIRRLSACKQQ------   439
NP_035622.1        422   CS-SN-------------------KIRRLSACKQQ------   436
NP_001101539.1     422   CS-SN-------------------KIRRLSACKQQ------   436
NP_001039298.1     425   CSASS-------------------KIRKLSTCKQQ------   440
NP_001017839.1     425   LSAAS-------------------KIRKLSTCKQQ------   440
XP_312848.5        532   CPATTANSSSSSGKRRSRKTVSCISWRKWPHCRQS------   566
NP_001256779.1     589   APGAPPRR----------------RKRNFFSCIFRSRTDSA   613
NP_001016533.1     417   STAGS-------------------KVRKLSACKQQ------   432


Protein Acc. Gene Organism
NP_000446.1 STK11 H.sapiens
XP_524028.2 STK11 P.troglodytes
XP_001093806.1 STK11 M.mulatta
XP_542206.2 STK11 C.lupus
NP_035622.1 Stk11 M.musculus
NP_001101539.1 Stk11 R.norvegicus
NP_001039298.1 STK11 G.gallus
NP_001017839.1 stk11 D.rerio
XP_312848.5 AgaP_AGAP003158 A.gambiae
NP_001256779.1 par-4 C.elegans
NP_001016533.1 stk11 X.tropicalis


Support Center