Display Settings:

Format

Send to:

Choose Destination
HomoloGene:37590. Gene conserved in Eukaryota Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_002159.2          1   -MAGYL-RVVRSLCRASGSRPAWAPAALTAPTSQE--QPRRHYADKRIKV   46
XP_510589.2          1   -MAGYL-RVVRSLCRASGSRPAWAPAALTAPTSQE--QPRRHYADKRIKV   46
XP_002804982.1       1   -MAGYL-RVVRSLCRASGSRPAWAPAALTAPTSQE--QTRRHYADKRIKV   46
XP_005618419.1       1   --------------------MNLTPLGTS-------------YADKRIKV   17
NP_786984.1          1   -MAGYL-RVVRSLCRASGSGSAWAPRALTAPNLQE--QPRRHYADKRIKV   46
NP_766599.2          1   -MAGYL-RAVSSLCRASGSARTWAPAALTVPSWPE--QPRRHYAEKRIKV   46
NP_001014183.1       1   -MAGYL-RAVSSLCRASGSTRTWAPAALNVPSWPE--QPRRHYAEKRIKV   46
NP_001026770.1       1   MAARCL-RAVPALSRAAGLSRCTPPAACTALGPPG--Q-RRHYADRRIKV   46
NP_955858.1          1   -MAGYL-KVLSSLSR-SAATLSKSPAVLAPACQS---LQQRNYADKRIQV   44
XP_312860.5          1   -MARLLARFCKTLPVQGSSTRTILPAVTMVPS-------RARSSDTRIQA   42
NP_509875.1          1   -----------MLSRLTSRNVLLARNVATAATQER----------QKIKV   29
NP_013275.1          1   --------------------------------------------MTKIKV   6
XP_455638.1          1   --------------------------------------------MSKISV   6
NP_982520.1          1   --------------------------------------------MGKVKV   6
NP_175836.1          1   ------------------------------------------MEFEKIKV   8
NP_001042583.1       1   ------------------------------------------MAFEKIVV   8
NP_001004799.1       1   -MAGYL-RAVSTICRASAAALGKNPGVLAPALSQQQLQQQRNYADKRIKV   48


NP_002159.2         47   AKPVVEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQV   96
XP_510589.2         47   AKPVVEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQV   96
XP_002804982.1      47   AKPVVEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQV   96
XP_005618419.1      18   AKPVVEMDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQV   67
NP_786984.1         47   AKPVVEMDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQV   96
NP_766599.2         47   EKPVVEMDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQV   96
NP_001014183.1      47   EKPVVEMDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQV   96
NP_001026770.1      47   ANPVVEMDGDEMTRIIWAFIKEKLILPNVDVQLKYFDLGLPHRDKTDDQV   96
NP_955858.1         45   AQPVVEMDGDEMTRIIWEFIKEKLILTNVNVDLKYYDLGLPYRDQTDDQV   94
XP_312860.5         43   VKPIVEMDGDEMTRIIWQFIKDKLIFPYVKVEALYYDLGLPYRDQTNDQV   92
NP_509875.1         30   DNPVVDLDGDEMTRIIWKEIKNKLILPYLDLDIKYYDLGLEYRDETNDQV   79
NP_013275.1          7   ANPIVEMDGDEQTRIIWHLIRDKLVLPYLDVDLKYYDLSVEYRDQTNDQV   56
XP_455638.1          7   KTPIVEMDGDEQTRIIWKLIKDHLIHPYLDIDLKYYDLSIENRDLTDDKV   56
NP_982520.1          7   QQPIVEMDGDEQTRIIWHLIKDQLIFPYLDVDLKYYDLSIENRDATEDRV   56
NP_175836.1          9   INPVVEMDGDEMTRVIWKFIKDKLIFPFLELDIKYFDLGLPNRDFTDDKV   58
NP_001042583.1       9   ANPVVEMDGDEMTRVIWKWIKDKLIFPFLDLDIKYYDLGLPNRDATGDKV   58
NP_001004799.1      49   ANPVVEMDGDEMTRIIWEFIKEKLILSNVDVELKYFDLGLPYRDQTNDQV   98


NP_002159.2         97   TIDSALATQKYSVAVKCATITPDEARVE----------------------   124
XP_510589.2         97   TIDSALATQKYSVAVKCATITPDEARVE----------------------   124
XP_002804982.1      97   TIDSALATQKYSVAVKCATITPDEARVEVGGSGREALKIHLQTPQACPCP   146
XP_005618419.1      68   TIDSALATQKYSVAVKCATITPDEARVE----------------------   95
NP_786984.1         97   TIDSALATQKYSVAVKCATITPDEARVE----------------------   124
NP_766599.2         97   TIDSALATQKYSVAVKCATITPDEARVE----------------------   124
NP_001014183.1      97   TIDSALATQKYSVAVKCATITPDEARVE----------------------   124
NP_001026770.1      97   TIDSALATKKYSVAVKCATITPDEARVE----------------------   124
NP_955858.1         95   TIDSAIATKKYNVAVKCATITPDEARVE----------------------   122
XP_312860.5         93   TIDAAHAMLKHNVGIKCATITPDEQRVE----------------------   120
NP_509875.1         80   TIDAAHAILEHSVGIKCATITPDEARIK----------------------   107
NP_013275.1         57   TVDSATATLKYGVAVKCATITPDEARVE----------------------   84
XP_455638.1         57   TEQSAQATLKYGVAVKCATITPDEARVE----------------------   84
NP_982520.1         57   TVESAEATLKYGVAVKCATITPDEARVE----------------------   84
NP_175836.1         59   TIETAEATLKYNVAIKCATITPDEARVR----------------------   86
NP_001042583.1      59   TIESAEATLKYNVAIKCATITPDEGRVK----------------------   86
NP_001004799.1      99   TIDSALATLKYNVAVKCATITPDEARVE----------------------   126


NP_002159.2        125   -EFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRH   173
XP_510589.2        125   -EFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRH   173
XP_002804982.1     147   AEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRH   196
XP_005618419.1      96   -EFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRH   144
NP_786984.1        125   -EFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRH   173
NP_766599.2        125   -EFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRH   173
NP_001014183.1     125   -EFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRH   173
NP_001026770.1     125   -EFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTQPITIGRH   173
NP_955858.1        123   -EFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTQAITIGRH   171
XP_312860.5        121   -EFKLKKMWLSPNGTIRNILGGTVFREPIICNNIPRIVPGWTKPIVIGRH   169
NP_509875.1        108   -EFNLKKMWLSPNGTIRNILGGTVFREPILCKNIPRLVPGWTQPITIGRH   156
NP_013275.1         85   -EFHLKKMWKSPNGTIRNILGGTVFREPIIIPRIPRLVPQWEKPIIIGRH   133
XP_455638.1         85   -EFKLKKMWKSPNGTIRNILGGTVFREPIVIPRIPKLVTNWEKPIIIGRH   133
NP_982520.1         85   -EFGLKEMWKSPNGTIRNILGGTVFREPIIIPRIPRLVPGWNEPIIVGRH   133
NP_175836.1         87   -EFGLKKMWRSPNGTIRNILNGTVFREPIICRNIPRLVPGWTKPICIGRH   135
NP_001042583.1      87   -EFNLSAMWKSPNGTIRNILNGTVFREPIICKNIPRLVPGWIKPICIGRH   135
NP_001004799.1     127   -EFKLKKMWKSPNGTIRNILGGTVFRDPIICKNIPRLVPGWTQAITIGRH   175


NP_002159.2        174   AHGDQYKATDFVADRAGTFKMVFTPKDG--SGVKEWEVYNF-PA--GGVG   218
XP_510589.2        174   AHGDQYKATDFVADRAGTFKMVFTPKDG--SGVKEWEVYNF-PA--GGVG   218
XP_002804982.1     197   AHGDQYKATDFVADRAGTFKMVFTPKDG--SGVKEWEVYNF-PA--GGVG   241
XP_005618419.1     145   AHGDQYKATDFVVDRAGTFKIIFSPKDG--SGAKEWEVYNF-PG--GGVG   189
NP_786984.1        174   AHGDQYKATDFVVDRAGTFKVVFTPKDG--SGPKEWEVYNF-PA--GGVG   218
NP_766599.2        174   AHGDQYKATDFVVDRAGTFKLVFTPKDG--SSAKEWEVYNF-PA--GGVG   218
NP_001014183.1     174   AHGDQYKATDFVVDRAGMFKLVFTPKDG--SGAKEWEVYNF-PA--GGVG   218
NP_001026770.1     174   AHGDQYKATDFVVNKSGTFKMVFTPKDG--SGVKEWEVFNF-PG--GGVG   218
NP_955858.1        172   AFGDQYKATDFVVNQPGKFKMVFTPADG--SKNKEWEVYDF-PG--GGCG   216
XP_312860.5        170   AHGDQYKAQDYVVRKPGTVKMVYTGEDG--T-VEEIQLYKY-TS--PGVA   213
NP_509875.1        157   AFGDQYKCTDLVIPSGSTLQLLVNKPDG--S-KDVHNVYDFKKS--GGVG   201
NP_013275.1        134   AFGDQYKATDVIVPEEGELRLVYKSKSG--THDVDLKVFDYPEH--GGVA   179
XP_455638.1        134   AFGDQYRATDVVIPGAGKLKLVFESDDSN-TENIELSVYDFDEESKGGVA   182
NP_982520.1        134   AFGDQYKATDVVIPGEGTLKLVFESKDGDKSKNLDLEVFEYPKD--GGVA   181
NP_175836.1        136   AFGDQYRATDLIVNEPGKLKLVFEPSGS--SQKTEFEVFNFTG---GGVA   180
NP_001042583.1     136   AFGDQYRATDTVIKGPGKLKLVFD--GR--EEQIELDVFNFTGA--GGVA   179
NP_001004799.1     176   AHGDQYKATDFVVDQAGTFKLVFAPANG--TATKEWEVFNF-PA--GGVG   220


NP_002159.2        219   MGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQE   268
XP_510589.2        219   MGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQE   268
XP_002804982.1     242   MGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQE   291
XP_005618419.1     190   MGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQE   239
NP_786984.1        219   MGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQA   268
NP_766599.2        219   MGMYNTDESISGFAHSCFQYSIQKKWPLYLSTKNTILKAYDGRFKDIFQE   268
NP_001014183.1     219   MGMYNTDESISGFAHSCFQYSIQKKWPLYLSTKNTIMKAYDGRFKDIFQE   268
NP_001026770.1     219   MGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQE   268
NP_955858.1        217   MGMYNTDESITGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQD   266
XP_312860.5        214   LAMYNTDESISAFAHSSFQVALGKRWPLYLSTKNTILKRYDGRFKDIFQE   263
NP_509875.1        202   LAMYNTDESIKGFAHSCFQYALMKQWPLYLSTKNTILKKYDGRFKDIFQD   251
NP_013275.1        180   MMMYNTTDSIEGFAKASFELAIERKLPLYSTTKNTILKKYDGKFKDVFEA   229
XP_455638.1        183   MAMYNTLESITGFAHASFKMALERGLPLYSTTKNTILKKYDGKFKDVFES   232
NP_982520.1        182   MTMYNTTDSITGFAKSSFELALQRKMPLYSTTKNTILKKYDGKFKDIFEG   231
NP_175836.1        181   LAMYNTDESIRAFAESSMYTAYQKKWPLYLSTKNTILKIYDGRFKDIFQE   230
NP_001042583.1     180   LSMYNTDESIWAFAEASMNMAYQKRWPLYLSTKNTILKKYDGRFKDIFQE   229
NP_001004799.1     221   MGMYNTDESISGFAHSCFQYSIQKKWPLYLSTKNTILKAYDGRFKDIFQD   270


NP_002159.2        269   IFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSD   318
XP_510589.2        269   IFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSD   318
XP_002804982.1     292   IFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSD   341
XP_005618419.1     240   IFEKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSD   289
NP_786984.1        269   IFEKHYKTEFDKHKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSD   318
NP_766599.2        269   IFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSD   318
NP_001014183.1     269   IFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSD   318
NP_001026770.1     269   IFDKHYKTEFDKLKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSD   318
NP_955858.1        267   IFEKNYKPEFDKLKIWYEHRLIDDMVAQVLKSSGAFVWACKNYDGDVQSD   316
XP_312860.5        264   IYEKDYKKQFEEAKIWYEHRLIDDMVAQALKSSGEFVWACKNYDGDVQSD   313
NP_509875.1        252   IYEKKYEADFKNNKIWYEHRLIDDQVAQALKSSGGFVWACKNYDGDVQSD   301
NP_013275.1        230   MYARSYKEKFESLGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYDGDVESD   279
XP_455638.1        233   LYESQYKSAFEAKGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYDGDVESD   282
NP_982520.1        232   MYAAEYKEKFEAAGIWYEHRLIDDMVAQMLKSKGGFIIAMKNYDGDVQSD   281
NP_175836.1        231   VYEANWRSKYEAAGIWYEHRLIDDMVAYAMKSEGGYVWACKNYDGDVQSD   280
NP_001042583.1     230   NYETKWRAKFDDAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSD   279
NP_001004799.1     271   IFEKHYKPEFDKLKIWYEHRLIDDMVAQVLKSTGGFVWACKNYDGDVQSD   320


NP_002159.2        319   ILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNP   368
XP_510589.2        319   ILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNP   368
XP_002804982.1     342   ILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNP   391
XP_005618419.1     290   ILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNP   339
NP_786984.1        319   ILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNP   368
NP_766599.2        319   ILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNP   368
NP_001014183.1     319   ILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNP   368
NP_001026770.1     319   ILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNP   368
NP_955858.1        317   ILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNP   366
XP_312860.5        314   IVAQGYGSLGLMTSVLVCPDGKTVESEAAHGTVTRHYREHQKGRPTSTNP   363
NP_509875.1        302   IVAQGYGSLGLMSSVLMCPDGKTIEAEAAHGTVTRHYREHQKGNSTSTNP   351
NP_013275.1        280   IVAQGFGSLGLMTSVLITPDGKTFESEAAHGTVTRHFRQHQQGKETSTNS   329
XP_455638.1        283   IVAQGFGSLGLMTSVLITPDGKAFESEAAHGTVTRHYRQHQQGKETSTNS   332
NP_982520.1        282   IVAQGFGSLGLMTSVLVSPDGKTFESEAAHGTVTRHYRQHQQGKETSTNS   331
NP_175836.1        281   FLAQGYGSLGMMTSVLVCPDGKTIEAEAAHGTVTRHYRVHQKGGETSTNS   330
NP_001042583.1     280   LIAQGFGSLGLMTSVLVCPDGRTIEAEAAHGTVTRHYRVHQKGGETSTNS   329
NP_001004799.1     321   ILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNP   370


NP_002159.2        369   IASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETV-ESGAMTKDLAG   417
XP_510589.2        369   IASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVETV-ESGAMTKDLAG   417
XP_002804982.1     392   IASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVETV-ESGAMTKDLAG   440
XP_005618419.1     340   IASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVQTV-ESGAMTKDLAG   388
NP_786984.1        369   IASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVETV-ESGAMTKDLAG   417
NP_766599.2        369   IASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVQTV-ESGAMTKDLAG   417
NP_001014183.1     369   IASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVQTV-ESGAMTKDLAG   417
NP_001026770.1     369   IASIFAWTRGLEHRGKLDSNPELIKFAQTLEKVCVETV-ESGTMTKDLAG   417
NP_955858.1        367   IASIFAWTRGLEHRGKLDGNPDLIKFSQTLERVCVETV-ESGVMTKDLAG   415
XP_312860.5        364   IASIFAWTRGLEHRAKLDNTPELARFSKALEKACVDTV-ESGKMTKDLAL   412
NP_509875.1        352   IASIFAWTRGLHHRGVLDNNEALKTFSLTLEKACIDTV-EEGKMTKDLSI   400
NP_013275.1        330   IASIFAWTRGIIQRGKLDNTPDVVKFGQILESATVNTVQEDGIMTKDLAL   379
XP_455638.1        333   IASIFAWTRGLIQRGKLDSTPDVVKFAELVESATVNTVQEDEIMTKDLAL   382
NP_982520.1        332   IASIFAWTRGIIHRGKVDGTPDVVKFGELLEKSTLDTVQEDNIMTKDLAL   381
NP_175836.1        331   IASIFAWSRGLAHRAKLDSNAALLSYTEKLEAACMGTV-ESGKMTKDLAL   379
NP_001042583.1     330   IASIFAWTTGLGHRAKLDDNKRLLDFVQKLEAACVGTV-ESGKMTKDLAL   378
NP_001004799.1     371   IASIFAWTRGLEHRGKLDGNQDLINFSLTLEKVCVETV-ESGIMTKDLAG   419


NP_002159.2        418   CIH-GLSNVKLNEHFLNTTDFLDTIKSNLDRA-LGRQ---   452
XP_510589.2        418   CIH-GLSNVKLNEHFLNTTDFLDTIKSNLDRA-LGRQ---   452
XP_002804982.1     441   CIH-GLSNVKLNEHFLNTTDFLDTIKSNLDRA-LGRQ---   475
XP_005618419.1     389   CIH-GLSNVKLNEHFLNTSDFLDTIKNNLDKA-LGQ----   422
NP_786984.1        418   CIH-GLSNVKLNEHFLNTSDFLDTIKSNLDRA-LGQQ---   452
NP_766599.2        418   CIH-GLSNVKLNEHFLNTTDFLDTIKSNLDRA-LGKQ---   452
NP_001014183.1     418   CIH-GLSNVKLNEHFLNTTDFLDTIKSNLDRA-LGKQ---   452
NP_001026770.1     418   CIH-GLANVKLNEHFVNTTDFLDAIKNTLDKA-LGKK---   452
NP_955858.1        416   CIH-GLANCKLNEHYVNTTDFLDAIKTNLDKA-LGK----   449
XP_312860.5        413   CIH-GSRNLK-DSMYLNTQDFLEAISEQLERT-WKK----   445
NP_509875.1        401   CIH-GTKKGTEKGAYLITEDFLSAIDTKMAEL-MRQD---   435
NP_013275.1        380   IL--GKSERS---AYVTTEEFIDAVESRLKKE-FEAAAL-   412
XP_455638.1        383   IL--GKTDRS---SYVTTEEFIEAVHKRLDSE-FKSSFN-   415
NP_982520.1        382   IL--GKTDRA---SYVTTEEFITAVANRLADG-YKRLFCE   415
NP_175836.1        380   LIH-GAKVRR--DQYVNTEEFIDAVAWELKRRLLGNNSRL   416
NP_001042583.1     379   LVH-GPNVSR--DKYLNTVEFIDAVAEDLRTR-LSVTSKL   414
NP_001004799.1     420   CIHGGMSNVRLNEHYVNTTDFLDAIKNNLDKA-LGKN---   455


Protein Acc. Gene Organism
NP_002159.2 IDH2 H.sapiens
XP_510589.2 IDH2 P.troglodytes
XP_002804982.1 IDH2 M.mulatta
XP_005618419.1 IDH2 C.lupus
NP_786984.1 IDH2 B.taurus
NP_766599.2 Idh2 M.musculus
NP_001014183.1 Idh2 R.norvegicus
NP_001026770.1 IDH2 G.gallus
NP_955858.1 idh2 D.rerio
XP_312860.5 AgaP_AGAP003168 A.gambiae
NP_509875.1 idh-2 C.elegans
NP_013275.1 IDP2 S.cerevisiae
XP_455638.1 KLLA0F12342g K.lactis
NP_982520.1 AGOS_AAL022W E.gossypii
NP_175836.1 ICDH A.thaliana
NP_001042583.1 Os01g0248400 O.sativa
NP_001004799.1 idh2 X.tropicalis


Support Center