Display Settings:

Format

Send to:

Choose Destination
HomoloGene:37322. Gene conserved in Eukaryota Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_000519.2          1   ---------------------------------MGAYARASGVCA-RGCL   16
XP_003316198.2       1   ---------------------------------MGAYARASGVCA-RGCL   16
XP_002801133.1       1   ---------------------------------MGAYAPAAGVSA-RGCL   16
XP_005632890.1       1   ---------------------------------MGADARPSGVRAGGGGR   17
NP_776986.2          1   ---------------------------------MVGDARPSGVRA-GGCR   16
NP_034894.2          1   ---------------------------------MGTGPLTSGVRAGGGNT   17
NP_955436.1          1   ---------------------------------MGTGSLAPGVRAGGGNT   17
NP_001014354.1           --------------------------------------------------
NP_609408.1          1   --------------------------------------------MSAKTS   6
XP_557731.3          1   MQTAHGAPNPVASVIGRTHNSKQTSDFSQCKALHNSGIGLRTACAHNCST   50
NP_508811.1              --------------------------------------------------
NP_196902.2              --------------------------------------------------
NP_001067993.1           --------------------------------------------------
NP_001072469.1           --------------------------------------------------


NP_000519.2         17   DSAGPW----TMSRALRPPLPPLCFF-LLLLAAAG---------------   46
XP_003316198.2      17   DSAGPW----TMSRALRPPLPPLCFF-LLLLAAPG---------------   46
XP_002801133.1      17   DAAGPW----TISRALRPPLPPLCFFLLLLLAAPG---------------   47
XP_005632890.1      18   GSAGPG----TSSRALQPPLPPLSFLFLLLVAAPG---------------   48
NP_776986.2         17   GAVGSR----TSSRALRPPLPPLSSLFVLFLAAPC---------------   47
NP_034894.2         18   GWL--W----MSSCNLGSPVLPISFLFWLLLAAPG---------------   46
NP_955436.1         18   GWL--W----MSSCNLGLPVLSISFLIWLLLAAPG---------------   46
NP_001014354.1       1   MASEPW----LHISFL------LLFCFSLVFSLPT---------------   25
NP_609408.1          7   VWL----------------------VFFCALGCLIH--------------   20
XP_557731.3         51   VWLHPRVIIMLVVGRVSVPLASVVVVLVVLVGVTFNLQPVSAGPWRRNGN   100
NP_508811.1          1   ------------------MNLQVIFLFLGLLVIYS---------------   17
NP_196902.2          1   -----------------MDLAKFLCWIVLLLGISL---------------   18
NP_001067993.1       1   ---------------MGASAARLAALLLLLLAAAA---------------   20
NP_001072469.1       1   -----------------MERVELLLLPLLLLGAAGR--------------   19


NP_000519.2         47   -------------------ARAGGYE---------TCPTV--QPNMLNVH   66
XP_003316198.2      47   -------------------ARAGGYE---------TCPTV--QPNMLNVH   66
XP_002801133.1      48   -------------------ARAGGYEVCVFGVPVQTCPTV--QPNMLNVH   76
XP_005632890.1      49   -------------------ARAAGYE---------TCPVV--QPDMLNVH   68
NP_776986.2         48   -------------------AWAAGYK---------TCPKV--KPDMLNVH   67
NP_034894.2         47   -------------------ARAAGYK---------TCPPT--KPGMLNVH   66
NP_955436.1         47   -------------------AQAAGYK---------TCPTT--KPGMLNVH   66
NP_001014354.1      26   -----------------GRNSICGYK---------SCPAT--KPSMLNVH   47
NP_609408.1         21   ---------DADLRSIQPKASQCGYQ---------SCHPT--KPNMLNVH   50
XP_557731.3        101   ALPRRVAESDEYLEFGRKLKQSCGYE---------SCPKP--KKNMLNVH   139
NP_508811.1         18   -------------------SQDCAWN---------TCHKVDQDPNVITAH   39
NP_196902.2         19   ---------------V--ESRYMVYN---------TSHTI--VPGKLNVH   40
NP_001067993.1      21   ---------------AVGECVYIPYN---------TSAGV--VGGKLNVH   44
NP_001072469.1      20   ----------------LKQAEGCGEQ---------SCPQA--PDGFLNVH   42


NP_000519.2         67   LLPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQYILDSVISALLADPTRRF   116
XP_003316198.2      67   LLPHTHDDVGWLKTVDQYFYGINNDIQHAGVQYILDSVISALLADPTRRF   116
XP_002801133.1      77   LVPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQYILDSVISALLADPTRRF   126
XP_005632890.1      69   LVAHTHDDVGWLKTVDQYFYGIQNDVQHAGVQYILDSVILSLLMEPTRRF   118
NP_776986.2         68   LVPHTHDDVGWLKTVDQYFYGIYNNIQPAGVQYILDSVISSLLANPTRRF   117
NP_034894.2         67   LLPHTHDDVGWLKTVDQYYYGILSDVQHASVQYILDSVVSSLLEKPTRRF   116
NP_955436.1         67   LLPHTHDDVGWLKTVDQYYYGIMSDVQHASVQYILDSVIYSLLNDPTRRF   116
NP_001014354.1      48   LVPHTHDDVGWLKTVDQYFYGDRNNIQHAGVQYILDSVIDQLQKDPARRF   97
NP_609408.1         51   LVAHTHDDVGWLKTVDQYYYGSETKIQKAGVQYIIDSVVEALLRDPEKRF   100
XP_557731.3        140   LVPHTHDDVGWLKTVDQYYYGSKTTIQKAGVQYILDSVIQSLLSDPERKF   189
NP_508811.1         40   LIPHTHDDLGWIKTVDQYFWGAKPELVPVGVQYIYNTVIDELLKNPDRRF   89
NP_196902.2         41   VVPHSHDDVGWLKTVDQYYVGSNNSIQVACVQNVLDSIVPALLADKNRKF   90
NP_001067993.1      45   VVPHTHDDVGWLKTVDQYYVGSNNSIQGACVQNVLDSLVPALLKDENRKF   94
NP_001072469.1      43   LIPHTHNDVGWLKTVDQYYYGAHNDIQHAGVQYILDSVVSQLLHDPSKRF   92


NP_000519.2        117   IYVEIAFFSRWWHQQTNATQEVVRDLVRQGRLEFANGGWVMNDEAATHYG   166
XP_003316198.2     117   IYVEIAFFSRWWHQQTNATQEVVRDLVRQGRLEFANGGWVMNDEAATHYG   166
XP_002801133.1     127   IYVEIAFFSRWWHQQTNAMREVVRDLVRQGRLEFANGGWVMNDEAATHYG   176
XP_005632890.1     119   IYVEIAFFSRWWQQQTNATQEVVRNLVRQGRLEFANGGWVMNDEAATHYG   168
NP_776986.2        118   IYVEIAFFSRWWRQQTNATQKIVRELVRQGRLEFANGGWVMNDEATTHYG   167
NP_034894.2        117   IYVEMAFFSRWWKQQTSATQDAVRNLVRQGRLEFVNGGWVMNDEAATHYG   166
NP_955436.1        117   IYVEMAFFSRWWKQQTNVTQDAVRNLVRQGRLEFVNGGWVMNDEAATHYG   166
NP_001014354.1      98   IYVETAFFYRWWRQQNQNTRRIVTQLVNEGRLEFINGGWCMSDEATTHYS   147
NP_609408.1        101   IYVESAFFFKWWKEQKPKVQEAVKMLVEQGRLEFIGGAWSMNDEATTHYQ   150
XP_557731.3        190   IYVESAFFFKWYDEQTAELQQQVRMLVNEGRLEFIGGAWSMNDEAAAHYH   239
NP_508811.1         90   SFAETGFLWRWYTSNSDFDRHQLQKLVKNGQIEIIGGGWVQNDEATSHYV   139
NP_196902.2         91   IYVEQAFFQRWWNEQSEEIKRIVKELIHSGQLELINGGMCMHDEAAPHYI   140
NP_001067993.1      95   VYVEQAFFQRWWRQQSDMIKDIVKGLISTGRLELINGGMCMHDEATVHYI   144
NP_001072469.1      93   IYVESAFFWRWWKQQDELVRRDVTRLVEEGRLEFINGGWSMNDEAATHYS   142


NP_000519.2        167   AIVDQMTLGLRFLEDTFGNDGRPRVAWHIDPFGHSREQASLF-AQMGFDG   215
XP_003316198.2     167   AIVDQMTLGLRFLEDTFGNDGRPRVAWHIDPFGHSREQASLF-AQMGFDG   215
XP_002801133.1     177   AIVDQMTLGLRFLEDTFGSDGRPRVAWHIDPFGHSREQASLF-AQMGFDG   225
XP_005632890.1     169   AIIDQMTLGLRFLEDTFGKDGRPRVAWHIDPFGHSREQASLF-AQMGFDG   217
NP_776986.2        168   AIIDQMTLRLRFLEETFGSDGRPRVAWHIDPFGHSREQASLF-AQMGFDG   216
NP_034894.2        167   AIVDQMTLGLRFLQDTFGSDGLPRVAWHIDPFGHSREQASLF-AQMGFDG   215
NP_955436.1        167   AIVDQMTLGLRFLQDTFGSDGLPRVAWHIDPFGHSREQASLF-AQMGFDG   215
NP_001014354.1     148   AVIDQMTLGLRFLNDTFGECGRPRVAWHIDPFGHAREHASIF-AQMGYDG   196
NP_609408.1        151   SVIDQFSWGLRLLNDTFGECGRPRVGWQIDPFGHSREMASMF-AQMGFDG   199
XP_557731.3        240   SIVDQFTWGLAKLNDTFGECGRPRIGWQIDPFGHSREQASLF-AQMGYDG   288
NP_508811.1        140   DIIDQMTLGLQRLEQIFGECGKPVTGWQIDPFGHSREMANIY-REMGYSS   188
NP_196902.2        141   DMIDQTTLGHRFIIREFNVT--PRIGWQIDPFGHSAVQAYLLGAEVGFDS   188
NP_001067993.1     145   DMIDQTTLGHRFIKEEFGQI--PRIGWQIDPFGHSAVQAYLLGTEVGFDA   192
NP_001072469.1     143   SIIDQMTLGLQFLKSTFGDCGRPRVAWHIDPFGHSREQALLF-AQMGYDG   191


NP_000519.2        216   FFFGRLDYQDKWVRMQKLEMEQVWRASTSLKPPTADLFTGVLPN-GYNPP   264
XP_003316198.2     216   FFFGRLDYQDKWVRMQKLEMEQVWRASTSLKPPTADLFTGVLPN-GYNPP   264
XP_002801133.1     226   FFFGRLDYQDKRVRMQKLEMEQVWRASASLKPPTADLFTGVLPN-GYNPP   274
XP_005632890.1     218   FFFGRLDYQDKSVRQEKLQMEQVWRASASLKPPVADLFTSVLPN-MYNPP   266
NP_776986.2        217   FFFGRLDYQDKKVRKKTLQMEQVWRASTSLKPPTADLFTSVLPN-MYNPP   265
NP_034894.2        216   FFLGRIDYQDKLNRKKKLRMEELWRASDSLEPPAADLFTGVLPN-NYNPP   264
NP_955436.1        216   FFLGRIDYQDKFNRKRKLKMEELWRASASLKPPAADLFTGVLPN-NYNPP   264
NP_001014354.1     197   FFFGRLDYQDKDRRMKTKEMEMLWRASESLTPPIADLFTGVLPN-GYNPP   245
NP_609408.1        200   MFFGRLDYQDKDERLMTKNAEMIWHGSANLGEE-ADLFSGALYN-NYQAP   247
XP_557731.3        289   LFFGRLDYQDKRERMTHKRAEMIWKTSDNLA-D-GDLFTGVLYN-LYQAP   335
NP_508811.1        189   VYFARIHYLEKQIRLKNKTLEFMWNTSDDITDN--KLFTGAFFNDNYGPP   236
NP_196902.2        189   VFFGRIDYQDREKRYKEKTLEVIWRGSKSLGSS-SQIFAGAFPT-NYEPP   236
NP_001067993.1     193   FYFFRIDYQDRDTRKGTKELEVVWRGSKTFGSS-ADIFAGIFPK-NYEPP   240
NP_001072469.1     192   FFFGRLDYQDKANREKTKQMEMLWRASDDISPPYADLFTGVLPN-GYNPP   240


NP_000519.2        265   RNLCWDVLCVDQPLV-EDPRSPEYNAKELVDYFLNVATAQGRYYRTNHTV   313
XP_003316198.2     265   RNLCWDVLCVDQPVV-EDPRSPEYNAKELVDYFLNVATAQGRYYRTNHIV   313
XP_002801133.1     275   MNLCWDVLCVDQPVV-EDPRSPEYNAKELVDYFLNVATAQGRHYRTNHIV   323
XP_005632890.1     267   EKLCWDTLCADKPFV-EDPRSPEYNAKELVNYFLQLATAQSEHYRTNHTI   315
NP_776986.2        266   EGLCWDMLCADKPVV-EDTRSPEYNAKELVRYFLKLATDQGKLYRTKHTV   314
NP_034894.2        265   KYLCWDVLCTDPPVV-DNPRSPEFNAKTLVNYFLKLASSQKGFYRTNHTV   313
NP_955436.1        265   KDLCWDVLCTDPPVV-DDPTSPEFNANKLVDYFLNLASSQKKYYRTNHTV   313
NP_001014354.1     246   EGFCWDQSCDDAPIR-DDPDLEDYNVDEIVQKFLNASHKQADYYKTNHII   294
NP_609408.1        248   DGFCFDILCNDAPII-DGKHSPDNNVKERIDTFLDFAKTQSQYYRTNNII   296
XP_557731.3        336   PGFCFDILCSDEPFM-DSPYSAENNVKAKVEKFLYYVNLQAESYRTNNIL   384
NP_508811.1        237   EGFCWDSLCGDDPIM-DNLNIEGYNVKEKVDAFVDHVKNQAAHQSTNQVM   285
NP_196902.2        237   PGGFYYEITDDSPVVQDDPDLFDYNVQERVNAFVAAALDQANITRINHIM   286
NP_001067993.1     241   PGQFYFEVDDTSPIVQDDPLLFDYNVEQRVDDFVAAAIAQANITRTNHVM   290
NP_001072469.1     241   DGFCWDQLCDDTPII-DDPSVEDYNADVIVQKFLKAATQQAQKYLSSHIV   289


NP_000519.2        314   MTMGSDFQYENANMWFKNLDKLIRLVNA-QQAKGSSVHVLYSTPACYLWE   362
XP_003316198.2     314   MTMGSDFQYENANMWFKNLDKLIRLVNAQQQAKGSSVHVLYSTPACYLWE   363
XP_002801133.1     324   MTMGSDFQYENANMWFKNLDKLIRLVNAQ-----------VSVPT--LW-   359
XP_005632890.1     316   MTMGSDFQYENANMWFKNLDRLIQLVNAQQQANGSRINVLYSTPACYLWE   365
NP_776986.2        315   MTMGSDFQYENANTWFKNLDKLIQLVNAQQRANGIRVNVLYSTPACYLWE   364
NP_034894.2        314   MTMGSDFHYENANMWFKNMDKLIRLVNA-QQVNGSLVHVLYSTPTCYLWE   362
NP_955436.1        314   MTMGSDFQYENANMWFKNMDKLIRLVNE-QQANGSKVHVLYSTPSCYLWE   362
NP_001014354.1     295   MTMGSDFQYENANLWYKNMDKLIKYVNA-LQAKGSKLNVLYSTPSCYLQE   343
NP_609408.1        297   VTMGGDFTYQAAQVYYKNLDKLIRYGNE-RQANGSNINLLYSTPSCYLKS   345
XP_557731.3        385   LTMGGDFTYMDANVYFKNMDKLIKYTNA-LQSNGSNVNVFYSTPSCYLKA   433
NP_508811.1        286   LLMGSDFQYTNANSWYVNLDKLIKYVNA---DTSKKVRVIYSTPACYTKA   332
NP_196902.2        287   FTMGTDFRYQYAHTWYRQMDKLIHYVNL-----DGRVNAFYSTPSIYTDA   331
NP_001067993.1     291   FTMGTDFKYQYAESWFRQMDKLIHYVNK-----DGRVNALYSTPSIYTDA   335
NP_001072469.1     290   MTMGSDFQYENAIMWFKNMDRLIKNVNM-QQINGSKVNVFYSTPSCYLQS   338


NP_000519.2        363   LNKANLTWSVKHDDFFPYADGPHQFWTGYFSSRPALKRYERLSYNFLQVC   412
XP_003316198.2     364   LNKANLTWSVKRDDFFPYADGPHQFWTGYFSSRPALKRYERLSYNFLQVC   413
XP_002801133.1     360   ---------------YPY--------------------------------   362
XP_005632890.1     366   LNKANLTWSVKQDDFFPYADGPHKFWTGYFSSRPALKRYERLSYNFLQVC   415
NP_776986.2        365   LNKANLSWSVKKDDFFPYADGPYMFWTGYFSSRPALKRYERLSYNFLQVC   414
NP_034894.2        363   LNKANLTWTVKEDDFFPYADGPHMFWTGYFSSRPALKRYERLSYNFLQVC   412
NP_955436.1        363   LNKANLTWTVKEDDFFPYADGPHMFWTGYFSSRPALKRYERLSYNFLQVC   412
NP_001014354.1     344   LNLANFTWPMKTDDFFPYADDAHDFWTGYFTSRPALKLYERLSNSRLQTC   393
NP_609408.1        346   LHDAGITWPTKSDDFFPYASDPHAYWTGYFTSRPTLKRFERDGNHFLQVC   395
XP_557731.3        434   LHDVGITWPTKSDDFFPYASDPHSFWTGYYTSRPTSKRFERVGNHFLQVC   483
NP_508811.1        333   VQAKTPTLSVKHDDFFPYASGRHSYWTGYFTSRPAFKGMIRQASCMLQLA   382
NP_196902.2        332   KHAANEAWPLKTEDYFPYADRINAYWTGYFTSRPALKRYVRVMSAYYLAA   381
NP_001067993.1     336   KHAENVPWPLKTNDFFPYADNPNAYWTGYFTSRPALKRYVRVMSGYYLAA   385
NP_001072469.1     339   LHRANLTWPMKMDDFFPYADGPHMFWTGYFTSRPAFKGYERLSNNFLQVC   388


NP_000519.2        413   NQLEALV-GLAANVGPYGSGDSAPLNEAMAVLQHHDAVSGTSRQHVANDY   461
XP_003316198.2     414   NQLEALV-GLAANVGPYGSGDSAPLNEAMAVLQHHDAVSGTSRQHVANDY   462
XP_002801133.1     363   --------------------------KAMAVLQHHDAVSGTSRQHVADDY   386
XP_005632890.1     416   NQLEALA-GPAANVGPYGSGDSAPLNEAMAVLQHHDAVSGTSRQHVANDY   464
NP_776986.2        415   NQLEALA-GPAANVGPYGSGDSAPLNEAMAVLQHHDAVSGTSRQHVANDY   463
NP_034894.2        413   NQLEALV-GPEANVGPYGSGDSAPLQEAMAVLQHHDAVSGTARQNVVNDY   461
NP_955436.1        413   NQLEALV-GPEAKVGPYGSGDSAPLNEAMAVLQHHDAVTGTARQNVVNDY   461
NP_001014354.1     394   NQLEVLG-GPTSTSGPFGEGDSDTMRRAMGVAQHHDAVSGTEKQHVANDY   442
NP_609408.1        396   KQLSALAPKKPEEFDPH----LTFMRETLGIMQHHDAITGTEKEKVALDY   441
XP_557731.3        484   KQLTALAPSRQTHMEPH----LNMLREAMGVMQHHDAITGTEKQHVANDY   529
NP_508811.1        383   KQLDVIA-----NLGPEDDSDIEILREASALVQHHDAVTGTAKENVTRDY   427
NP_196902.2        382   RQLEFFK-GR-SQKGPN----TDSLADALAIAQHHDAVSGTSKQHVANDY   425
NP_001067993.1     386   RQLEFFK-GR-SNSDLT----TDSLADALALAQHHDAVTGTEKQHVANDY   429
NP_001072469.1     389   NQMEALS-GLEARNGPYGQSSSTVMRRAMGVAQHHDAVTGTAKQHVNNDY   437


NP_000519.2        462   ARQLAAGWGPCEVLLSNALARLRGFKD------------HFTFCQQLNIS   499
XP_003316198.2     463   ARQLAAGWGPCEVLLSNALARLRGFKD------------HFTFCRQLNIS   500
XP_002801133.1     387   ARQLAAGWGSCEVLLSNALARLRGFKD------------HLTFCRQLNIS   424
XP_005632890.1     465   ARQLAAGWGPCEVLLSNSLARLSGSKE------------DFTYCRDLNIS   502
NP_776986.2        464   ARQLSEGWRPCEVLMSNALAHLSGLKE------------DFAFCRKLNIS   501
NP_034894.2        462   ARQLAAGWGPCEVLVSNALARLSHYKQ------------NFSFCRELNIS   499
NP_955436.1        462   AKQLAAGWGPCEVLVSNALARLSLYKQ------------NFSFCREINIS   499
NP_001014354.1     443   ARRLATGWAHCEVLVSNSLAVLSGSEA------------PRVFCENLNIS   480
NP_609408.1        442   AKRMSVAFRACGATTRNALNQLTVQSKDNVKDTSAKYVFEFKTCALLNIT   491
XP_557731.3        530   ARMLNRAVRACGANTKAALNQIHPTTD------IPQYTFAFESCHLLNVS   573
NP_508811.1        428   EKQLAKGVSEVEVVINDFMKKMNPDGL----------DPKLVLCPLINET   467
NP_196902.2        426   AKRLAIGYVEAESVVATSLAHLTKVD--------PTLNPTFQQCLLLNIS   467
NP_001067993.1     430   AKRLSIGYTQAEKLVSSSLSCLSQSGS---KSHCPSQTTNFEQCPLLNIT   476
NP_001072469.1     438   SLRLSEGWDSCQVVISNSLSSLTGTKE------------NFAFCNLLNIS   475


NP_000519.2        500   ICPLSQTA----ARFQVIVYNPLGRKVNWMVRLPVSEGVFVVKDPNGRTV   545
XP_003316198.2     501   ICPLSQTA----ARFQVIVYNPLGRKVNWMVRLPVSEGVFVVKDPNGRTV   546
XP_002801133.1     425   ICPLSQTA----ARFQVIVYNPLGRKVNWMVRLPVSEGVFVVKDPNGRTV   470
XP_005632890.1     503   VCPLTQTA----KSFQVTIYNPLGRKVDWMVRLPVSERVFDVRDPNGTIV   548
NP_776986.2        502   ICPLTQTA----ERFQVIVYNPLGRKVDWMVRLPVSKHVYLVKDPGGKIV   547
NP_034894.2        500   ICPVSQTS----ERFQVTLYNPLGRKVDQMVRLPVYEGNFIVKDPHDKNI   545
NP_955436.1        500   ICPASQTS----EHFRVIIYNPVGRKVDLMVRLPVSEGIFLVKDPNDRRI   545
NP_001014354.1     481   VCPLTESS----HKFSMNVYNPLGRTVRWPVRLPVNGSVYNVTDANGKAV   526
NP_609408.1        492   SCPVSEAN----DRFALTLYNPLAHTVNEYVRIPVPYSNYRIIDNKGVTL   537
XP_557731.3        574   KCELTETK----DSFTVTLYNPLAHAGHEYVRLPVTGGRYIVRDYRNVEV   619
NP_508811.1        468   ICKPINGS----SEFSVVIFNSNGRYFNGTIRIPYSQKTAVLRDAHKNVL   513
NP_196902.2        468   YCPSSEVNLSDGKSLIVLAYNPLGWKRVDIVRLPVVGGDVSVHDSEGHEV   517
NP_001067993.1     477   YCPPSEMDLSQGKSLVVLVYNSLGWKREDVLRIPVISDSIVVHDSEGREV   526
NP_001072469.1     476   VCHVTETA----NNFKVYLYNPLGRSVTWTVRLPVNGHAYKVIGPNDETV   521


NP_000519.2        546   PSDVVIFPSSDSQAH----------------PPELLFSA-SLPALGFSTY   578
XP_003316198.2     547   PSDVVIFPSSDSQAH----------------PPELLFSA-SLPALGFSTY   579
XP_002801133.1     471   PSDVVIYPSSDSQAH----------------PPELLFSA-SLPALGFSTY   503
XP_005632890.1     549   PSDVVILPSSDGL--------------------ELLFSA-SVPALGFSIY   577
NP_776986.2        548   PSDVVTIPSSDSQ--------------------ELLFSA-LVPAVGFSIY   576
NP_034894.2        546   SSNVVMVPSYYSETY----------------QWELLFPA-SVPALGFSTY   578
NP_955436.1        546   SSNVVMVPSAYSKTY----------------QWELLFPA-SVPALGFSIY   578
NP_001014354.1     527   DSEVIPLSKSRKEVRQNRGFA----------KSELVFQV-EAPPLGYSTY   565
NP_609408.1        538   ESQAVPIPQVLIDIKHRNSTA----------KYEIVFLATNIPALGYRTY   577
XP_557731.3        620   SSQIVPIPQSVLNLSYRFSNA----------TSELVFLANELPPLGFKSY   659
NP_508811.1        514   ESQIVETFQIDQLKDTDRL------------PYEIHVFV-RVPPLGYTTV   550
NP_196902.2        518   ESQLVPFTDEYVALRKYHVEAYLGQSPTQVPKYWLVFSV-TVPPLGFTTY   566
NP_001067993.1     527   ESQLLPIANASLYMREKHVKAYLGMLPAAKPKFWLAFPV-SVPPLGFNTY   575
NP_001072469.1     522   PSEVVDVSDFTKALRFQQGGA----------ERELIFQG-QIPAVGFSSF   560


NP_000519.2        579   SVAQVPRWKPQARAPQPIPRRSWS----------------PALTIENEHI   612
XP_003316198.2     580   SVAQVPRWKPQARAPQPIPRRSWS----------------PALTIENEHI   613
XP_002801133.1     504   SVAQVPRWKPQARAPQPIPRRSWS----------------PALTIENEHI   537
XP_005632890.1     578   SVTQVPGRRPHAHSRQPRSQKSWS----------------RVLDIQNEYI   611
NP_776986.2        577   SVSQMPNQRP---------QKSWS----------------RDLVIQNEYL   601
NP_034894.2        579   SVAKMSDLNHQAHNLLSRPRKHKSH---------------HVLVIENKYM   613
NP_955436.1        579   SVNKMSGHNHQAHNLTARPKKSKS----------------RVLVIENKYI   612
NP_001014354.1     566   IVSMVQDQPPV--------SRSKNA---------------VPSSIQNKFL   592
NP_609408.1        578   YVEK-LDSTEGNTRSKALPKRTSSV-----------------TVIGNSHI   609
XP_557731.3        660   FVTRAIDSLDDFLHEAPAPASPPAADQTLAKQQETAQWHSQEVTIGNKYL   709
NP_508811.1        551   FVEKGSK----PERVHFNNRKKFN----------------TNVEIQNEYL   580
NP_196902.2        567   TISTAKKTDGYSSKSYVSNILKGEQ---------------SIINIGHGHL   601
NP_001067993.1     576   FISSGKKSASVSLMSTLHSSQGSEN---------------SNMQIGQGQL   610
NP_001072469.1     561   TVGKLS----LPDRFVIKGKRGKK----------------QPDKIQNQYY   590


NP_000519.2        613   RATFDPDTGLLMEIMNMNQQLLLPVRQTFFWYNASIGDN-E---SDQASG   658
XP_003316198.2     614   RATFDPDTGLLMEIMNMNQQLLLPVRQTFFWYNASIGDN-E---SDQ---   656
XP_002801133.1     538   RATFDPDTGLLMEIMNMNQRLLLPVRQTFFWYNASVGDN-E---SDQASG   583
XP_005632890.1     612   RARFDPDTGFLVELENLEQNLLLPVRQAFYWYNASVGNN-L---STQVSG   657
NP_776986.2        602   RARFDPNTGLLMELENLEQNLLLPVRQAFYWYNASTGNN-L---SSQASG   647
NP_034894.2        614   RATFDSGTGLLMKIENLEQNLSLPVSQGFFWYNASVGDE-E---SSQASG   659
NP_955436.1        613   RATFDSDTGLLRKIENLEQNISLPVRQGFFWYNASAGDE-E---SPQASG   658
NP_001014354.1     593   KVTFDSTTGLLSSLTNLETQQTIRLTQNFFWYNASAGNNKE---SHQPSG   639
NP_609408.1        610   QLGFDTN-GFLSEVT--ADGLTRLVSQEFLFYEGAVGNNAE--FLNRSSG   654
XP_557731.3        710   NVSFDSN-GFLSTIT--IDGVTNRLRQTFVYYEGALGNNEE--FRNRSSG   754
NP_508811.1        581   IAGFDSQ-GYLSYITEKATKKKRSIRQEFFYYEGIDSKD------DQPSG   623
NP_196902.2        602   KLSFSTDQGTAINYVNGRTSMTEPVKQTFSYYSAYNGSNDKEPLIPQNSG   651
NP_001067993.1     611   KLQYNAAGALSL-YSNSKTQVEANFEQKYKYYIGQDGNGSD----PQASG   655
NP_001072469.1     591   RVDFDPETGLISGIHNLEKKISLPLKQSFYWYNASVGNE-E---SSQPSG   636


NP_000519.2        659   AYIFRPNQQKPLPVSRWAQIHLVKT-PLVQEVHQNFSAWCSQVVRLYPGQ   707
XP_003316198.2           --------------------------------------------------
XP_002801133.1     584   AYIFRPNQQKPLPVSRWAQIRLVKT-PLVQEVHQNFSAWCSQVVRLYPGQ   632
XP_005632890.1     658   AYIFRPNRQEPLIVSHWAQTRVVKT-PLVQEVHQNFSAWCSQVVRLYPGQ   706
NP_776986.2        648   AYIFRPNQNKPLFVSHWAQTHLVKA-SLVQEVHQNFSAWCSQVVRLYPRQ   696
NP_034894.2        660   AYIFRPNVGKPIPVSRWAQISLVKT-ALVQEVHQNFSAWCSQVIRLYKGQ   708
NP_955436.1        659   AYIFRPSHRKPLPVSHWAQVTLVKT-NLVQEVHQNFSAWCSQVIRLYEGQ   707
NP_001014354.1     640   AYIFRPNSSDPFIISKTAEIQAVSLYNSVQEVTQRFSPWVSQVVRLYEDR   689
NP_609408.1        655   AYIFRPNENKIHFATDQVEIEVYKG-DLVHEVHQKFNDWISQVVRVYNKD   703
XP_557731.3        755   AYIFRPNGTE-KTVTENVQLKVVKG-GTVQEVHQVFSEWISQVVRVYADE   802
NP_508811.1        624   AYIFRPKTQQPIALTSKLALEVVPG-AIINEVRQKVSPFVSQQIRLPRGK   672
NP_196902.2        652   AYVFRPNGTFPINPEGQVPLTVIHG-PLVDEVHQQINPWISQITRVYKGK   700
NP_001067993.1     656   AYIFRPNGTVPIKTDGQVPLTVLRG-SILDEVHQQINPWIYQINRVYKGK   704
NP_001072469.1     637   AYIFRPNNSDSVPVSQHVRSYLVQN-SLVQEVHQNFSSWCSQVVRLYRDQ   685


NP_000519.2        708   RHLELEWSVGPIP--VGDTWGKEVISRFDTPLETKGRFYTDSNGREILER   755
XP_003316198.2           --------------------------------------------------
XP_002801133.1     633   RHLELEWSVGPIP--VGDTWGKEVISRFDTPLETKGRFYTDSNGREILER   680
XP_005632890.1     707   RHLELEWTVGPIP--VGDGWGKEVISRFDTVLETKGLFYTDSNGREILER   754
NP_776986.2        697   RHLELEWTVGPIP--VGDGWGKEVISRFDTALATRGLFYTDSNGREILER   744
NP_034894.2        709   RHLELEWTVGPIP--VRDDWGKEVISRFDTPMKTKGQFFTDSNGREILKR   756
NP_955436.1        708   RHLELEWTVGPIP--VKDDWGKEVISRFNTPMRTRGQFFTDSNGREILKR   755
NP_001014354.1     690   RELELEWTVGPVP--VEDGLGKEVITRLDTDIQSSGYFYTDSNGREVLER   737
NP_609408.1        704   SYAEFEWLVGPIP--IDDGIGKEVITRFNSDIASDGIFRTDSNGREMIKR   751
XP_557731.3        803   SHVEFEWMVGPIP--VEDGVGKEIVSRFYTAAQSSGVFWTDANGREMMRR   850
NP_508811.1        673   NYIEFEWIVGPIPKETKNPITKEFVTRYTTEVHSKNQSFTDSNGRQAMER   722
NP_196902.2        701   EHVEVEFIVGNIP--IDDGIGKEVVTQISSSLKSNKTFYTDSSGRDYIKR   748
NP_001067993.1     705   DYVETEFIVGPIP--VDDGNGKELSTEVVTNMATNKTFYTDSSGRDFIKR   752
NP_001072469.1     686   RYIELEWTVGPVP--IGDEWGKEVISLIETNLKTDGVFYTDSNGRQILKR   733


NP_000519.2        756   RRDYRPTWKLNQTEPVAGNYYPVNTRIYITDGNMQLTVLTDRSQGGSSLR   805
XP_003316198.2           --------------------------------------------------
XP_002801133.1     681   RRDYRPTWKLNQTEPVAGNYYPVNTRIYITDGKMQLTVLTDRSQGGSSLR   730
XP_005632890.1     755   RRDYRPTWKLNQTEPVAGNYYPVNSRIYIRDGHVQLTVLTDRSQGGSSLR   804
NP_776986.2        745   RRNYRPTWKLNQTEPVAGNYYPVNSRIYITDGNMQLTVLTDRSQGGSSLR   794
NP_034894.2        757   RDDYRPTWTLNQTEPVAGNYYPVNTRIYITDGQMQLTVLTDRSQGGSSLQ   806
NP_955436.1        756   RDDFRPTWTLNQTEPVAGNYYPVNTRIYITDGHMQLTVLTDRSQGGSSLL   805
NP_001014354.1     738   RKDYRPTWDLKQTEPIAGNYYPINSRAYIKDDKRQLTVVTDRSQGASSIY   787
NP_609408.1        752   KINHRDTWSVKINEAVAGNYYPITTKIDVEDDTARMAILTDRAQGGSSLK   801
XP_557731.3        851   VRNHRDTWNVDLEEKISGNYYPVTAKIALEDENLRLAVLNDRAQGGSSLE   900
NP_508811.1        723   FFDGATSFEYSDTEPIAGNYYPITSFGYIKDENAQFSVITDRAQGMVA-S   771
NP_196902.2        749   IRDYRSDWKLDVNQPIAGNYYPINHGIYLQDSKKEFSVMVDRAFGGSSIV   798
NP_001067993.1     753   IRDYRSEWKIEVHQPIAGNYYPVNLGIYVEDGSRELSILVDRSVGGASIK   802
NP_001072469.1     734   RRDSRETWKLNQTEPIAGNYYPVNSRIYIKGKNTQVTVLTDRSQGGSSIR   783


NP_000519.2        806   DGSLELMVHRRLLKDDGRGVSEPLMEN---GS---GAWVRGRHLVLLDTA   849
XP_003316198.2           --------------------------------------------------
XP_002801133.1     731   DGSLELMVHRRLLKDDERGVSEPLMEN---GS---GAWVRGRHLVLLDTA   774
XP_005632890.1     805   DGSVELMVHRRLLKDDGRGVGEPLLEE---GS---GLWVRGRHLVLLDKA   848
NP_776986.2        795   DGSLELMVHRRLLKDDARGVGEPLNKE---GS---GLWVRGRHLVLLDKK   838
NP_034894.2        807   DGSLELMVHRRLLVDDDRGVSEPLLET---DT---GDKVRGRHLVLLSSV   850
NP_955436.1        806   DGSLELMVHRRLLVDDERGVAEPLLET---DT---GDKVRGRHLVILSSV   849
NP_001014354.1     788   NGSLEIMLHRRLLYDDFRGVGEPLSEPGEFAH---GLVARGRLLLTLSPP   834
NP_609408.1        802   DGSLELMVHRRLLKDDAFGVGEALNET-EYGD---GLIARGKHHLFFGKS   847
XP_557731.3        901   DGSLELMVHRRLLHDDAFGVEEALNEK-AFGQ---GLVARGKHWVVFG-A   945
NP_508811.1        772   DGVVEIMLHRRCFYDDHFGVEEALDEPGKDGA---GLVAMGKHIVLFTDV   818
NP_196902.2        799   DGQVELMLHRRLLLDDSRGVAENLNETVCVQDKCTGLTIQGKYYYRIDPY   848
NP_001067993.1     803   DGQIELMLHRRLLHDDGRGVAEALNETTCFDNQCEGLVIQGKYYLKIDPQ   852
NP_001072469.1     784   DGSLELMVHRRLLRDDYRGVGEPLLENGLLGE---GIVVRGRHLLLLDHA   830


NP_000519.2        850   QAAA-----AGHRLLAEQEVLAPQVVLAPGGGAAYNLGAPPRTQ-FSGL-   892
XP_003316198.2           --------------------------------------------------
XP_002801133.1     775   QAAA-----AGHRLLAEQEVLAPQVVLAPGGGAAYNLGAPPRTQ-FSGL-   817
XP_005632890.1     849   QTAA-----TGHRLQAEKEVLAPQVVLAPGGGAPYHLGVAPRKQ-FSGL-   891
NP_776986.2        839   ETAA-----ARHRLQAEMEVLAPQVVLAQGGGARYRLEKAPRTQ-FSGL-   881
NP_034894.2        851   SDAA-----ARHRLLAEQEVLAPQVVLSLGGSSPYHSRATPKTQ-FSGL-   893
NP_955436.1        850   SDAA-----ARHRLLAEQEVLAPQVVLAHGGSSPYHSQA-PKMQ-FSAL-   891
NP_001014354.1     835   EAAA-----DLHRPLAQSMVLQPLLSFQDGAPSP-----GTKLE-FSGL-   872
NP_609408.1        848   TDREGVSLKGIERLTQLEKLLPTWKFFSNMEDYSADEWQTAFTNIFSGI-   896
XP_557731.3        946   KKPTSPTPEARERFLQNRVLLPNWLFFSDVGEVKYEDWQKQYTNIYSAL-   994
NP_508811.1        819   KAST-----SQLRPLAIDNFHQPVLAFNK----NPEKFEFNRLLEYSGL-   858
NP_196902.2        849   GEGA-----KWRRTFGQEIYSPLLLAFAQQDDGKPMSFGAAS---FSGID   890
NP_001067993.1     853   GEGA-----RWRRTFGQEIYSPLLIAFAEQDGGNWVNSHVTK---FSAMD   894
NP_001072469.1     831   DEAA-----DTHRTLALQQYMSPQVVLSSGDGIPYSQSGTPKRK-FSAL-   873


NP_000519.2        893   -RRDLPPSVHLLTLASWGPEMVLLRLEHQFAVGEDSGRNLSAPVTLNLRD   941
XP_003316198.2           --------------------------------------------------
XP_002801133.1     818   -RRELPPSVHLLTLASWGPEMLLLRLEHQFAVGEDSGRNLSAPVTLNLRD   866
XP_005632890.1     892   -RRELPPSVHLLTLARWDRTRLLLRLEHQFAVGEGSG-NLSSPVTLDLKD   939
NP_776986.2        882   -RRELPPSVRLLTLARWGPETLLLRLEHQFAVGEDSGRNLSSPVTLDLTN   930
NP_034894.2        894   -RQELPPQVHLLTLARWGPKMLLLRLEHQFALKEDSDRNLSSPVTLNVQN   942
NP_955436.1        892   -RRELPPQVHLLTLARWGPKMLLLRLEHQFAVKEDSNRNLSSPVTLNLQN   940
NP_001014354.1     873   -QAALPPAVHLLTVSQWDQDSVLVRLEHQYQAKE--SKTHSQPVTVNLQK   919
NP_609408.1        897   -SLVLPKPVHLLTLEPWHENQLLVRFEHIMENGE--DASYSQPVQFNVKN   943
XP_557731.3        995   -SLSLPLNVHLLTFEPWKENSILVRFEHLLEKDE--DPMYSKPVRFNIQD   1041
NP_508811.1        859   -KFELPIGIHLLTLEKWHKKSSLIRFENIYHGEE--GNSIKE---FDPTH   902
NP_196902.2        891   PSYSLPDNVALLTLQELDDGNVLLRLAHLYEVEE--DKELSGVASVELKK   938
NP_001067993.1     895   PAYSLPDNVALLTLQELEDGTVLLRLAHLYEAGE--HKDLSALASVDLKR   942
NP_001072469.1     874   -NGELPQNGHLLTFAMHAADKILLRLEHPFQSQE--SKNNSQPITINLNT   920


NP_000519.2        942   LFSTFTITRLQETTLVANQLREAA--SRLKWTTNT---------------   974
XP_003316198.2     657   ----------------------AA--SRLKWTTNT---------------   667
XP_002801133.1     867   LFSTFTITRLQETTLVANQLREAA--SRLKWTTNT---------------   899
XP_005632890.1     940   LFSAFTITYLQETTLAANQPRASA--SRLKWTPNT---------------   972
NP_776986.2        931   LFSAFTITNLRETTLAANQLLAYA--SRLQWTTDT---------------   963
NP_034894.2        943   LFQTFTINYLQETTLAANQPLSRA--SRLKWMTNT---------------   975
NP_955436.1        941   LFKTFTINYLQETTLAANQPLSRV--SRLKWMTDT---------------   973
NP_001014354.1     920   LFSTLQVLGASEMSLGANQWKEDM--IRLHWNTDA---------------   952
NP_609408.1        944   VLSAFDVEGIRETTLDGNAWLDES--RRLQFAPDPEEAAFNTYATFSQPA   991
XP_557731.3       1042   VFRQFSIEEVREMTLAANQLREDS--TRLKFKPDP------SYIMYSS--   1081
NP_508811.1        903   IFTNFDIVSFKELLLGANRVVGKN--------------------------   926
NP_196902.2        939   LFPGKKIGKLTEMSLSANQERSTMEKKRLVWKVEG---------------   973
NP_001067993.1     943   VFPDKKIVKIVETSLSANQERSAMEKKRLKWKVEG---------------   977
NP_001072469.1     921   LFSSVSLSNFEETTLGANMEKSRL--KRLQWRTRT---------------   953


NP_000519.2        975   ---------------------------------------GP---TPHQTP   982
XP_003316198.2     668   ---------------------------------------GP---TPHQTP   675
XP_002801133.1     900   ---------------------------------------GP---TPHQTP   907
XP_005632890.1     973   ---------------------------------------GP---TAQPSP   980
NP_776986.2        964   ---------------------------------------GP---TPHPSP   971
NP_034894.2        976   ---------------------------------------GP---TSYPEP   983
NP_955436.1        974   ---------------------------------------GP---ISYPAP   981
NP_001014354.1     953   ---------------------------------------LP------PTA   957
NP_609408.1        992   ESVHLLSAEKPMLGVKYADEALPAGQLGAESNRIRRETETR---QEKKDE   1038
XP_557731.3       1082   ---------------------------------IKRDVSTP---LPSPSP   1095
NP_508811.1        927   --------------------------------------------KESGSS   932
NP_196902.2        974   -----------------------------------EGSYGEEKKAKRGRE   988
NP_001067993.1     978   -----------------------------------PPA---DEKIVRGGP   989
NP_001072469.1     954   ---------------------------------------GSPLQMDSPRA   964


NP_000519.2        983   YQL-----------------DPANITLEPMEIRTFLASVQWK-EVDG---   1011
XP_003316198.2     676   YQL-----------------DPANITLEPMEIRTFLASVQWK-EVDG---   704
XP_002801133.1     908   YQL-----------------DPANITLEPMEIRTFLASVQWK-EVDG---   936
XP_005632890.1     981   PRL-----------------DPTTITLEPMEIRTFLASVQWK-E-HG---   1008
NP_776986.2        972   SRP-----------------VSATITLQPMEIRTFLASVQWE-E-DG---   999
NP_034894.2        984   SKL-----------------DPTSVTLKPMEIRTFLASVQWQ-EHRPA--   1013
NP_955436.1        982   SRL-----------------DPTSITLQPMQIRTFLASVQWQ---RLI--   1009
NP_001014354.1     958   RDP-----------------SSWEVTLKPMEIRTFLLRVRLL--------   982
NP_609408.1       1039   GRSSKSTEGPYNSFKSDSSNQEYIIELSPMEIRTFIVYLTPA--------   1080
XP_557731.3       1096   PNVLAGRSPLMDELSRNVADDGFEIMLKPMEIRTFVFQLEYKP-------   1138
NP_508811.1        933   FRS-----------------------FEKSKILTFEIEVERKMSKL----   955
NP_196902.2        989   IDP-----------------RKLEMELYPMEIRTVLIHLELPSSHSRINR   1021
NP_001067993.1     990   VDP-----------------SKLVVDLGPMEIRTFLINFAPQSGKQLM--   1020
NP_001072469.1     965   PVV-----------------DPSNITLSPMEIRTFLANVRYKAALHGR--   995


NP_000519.2              ---
XP_003316198.2           ---
XP_002801133.1           ---
XP_005632890.1           ---
NP_776986.2              ---
NP_034894.2              ---
NP_955436.1              ---
NP_001014354.1           ---
NP_609408.1              ---
XP_557731.3              ---
NP_508811.1              ---
NP_196902.2       1022   FDA   1024
NP_001067993.1           ---
NP_001072469.1           ---


Protein Acc. Gene Organism
NP_000519.2 MAN2B1 H.sapiens
XP_003316198.2 MAN2B1 P.troglodytes
XP_002801133.1 LOC716173 M.mulatta
XP_005632890.1 MAN2B1 C.lupus
NP_776986.2 MAN2B1 B.taurus
NP_034894.2 Man2b1 M.musculus
NP_955436.1 Man2b1 R.norvegicus
NP_001014354.1 man2b1 D.rerio
NP_609408.1 LM408 D.melanogaster
XP_557731.3 AgaP_AGAP008584 A.gambiae
NP_508811.1 aman-1 C.elegans
NP_196902.2 AT5G13980 A.thaliana
NP_001067993.1 Os11g0525600 O.sativa
NP_001072469.1 man2b1 X.tropicalis


Support Center