Display Settings:

Format

Send to:

Choose Destination
HomoloGene:3657. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_004983.1          1   MVAGMLGLR------------EEKSEDQDLQGLKDKPLKFKKVKKDKKEE   38
XP_521333.3          1   MAAAAAAAPSGGGGGGEEERLEEKSEDQDLQGLKDKPLKFKKVKKDKKEE   50
XP_001088566.2       1   MVAGMLGLR------------EEKSEDQDLQGLKDKPLKFKKVKKDKKED   38
XP_853488.1          1   MVAGMLGLR------------EEKSEDQDLQGLKDKPLKFKKVKKEKKED   38
NP_001193481.1       1   MVAGMLGLR------------EEKSEEQDLQGLKDKPLKFKKVKKDKKED   38
NP_034918.1          1   MVAGMLGLR------------EEKSEDQDLQGLRDKPLKFKKAKKDKKED   38
NP_073164.2          1   MVAGMLGLR------------EEKSEDQDLQGLKEKPLKFKKVKKDKKED   38
NP_997901.1          1   MAAAESGEE----------RLRGEDKNEDQEGSKDKTQKHKKSKKERHDV   40
NP_001135563.1       1   MAAAPSGEE----------RLEEKSEDQDLQGQKDKPPKLRKVKRDKKDE   40


NP_004983.1         39   KEGKHEPVQPS------AHHSAEPAEAGKAE-TSEGSGSAPAVPEASASP   81
XP_521333.3         51   KEGKHEPVQPS------AHHSAEPAEAGKAE-TSEGSGSAPAVPEASASP   93
XP_001088566.2      39   KEGKHEPVQPS------AHHSAEPAEAGKAE-TSEGSGSAPAVPEASASP   81
XP_853488.1         39   KEGKHEPLQPP------AHHSAEPAEAGKAE-TSEGSGSAPAVPEASASP   81
NP_001193481.1      39   KEGKHEPLQPA------AHHSAEPAEAGKAE-TSEGSGSAPAVPEASASP   81
NP_034918.1         39   KEGKHEPLQPS------AHHSAEPAEAGKAE-TSESSGSAPAVPEASASP   81
NP_073164.2         39   KEGKHEPLQPS------AHHSAEPAEAGKAE-TSESSGSAPAVPEASASP   81
NP_997901.1         41   EKLETTVSVPPPPSLFTQRDVGQQAEAGKSEPIDPEVGAALSAPESSASA   90
NP_001135563.1      41   EE-KQETFHPS------EHQSGEPADEGKAD-ISESAEESLAVPEASASP   82


NP_004983.1         82   KQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKA   131
XP_521333.3         94   KQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKA   143
XP_001088566.2      82   KQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKA   131
XP_853488.1         82   KQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKA   131
NP_001193481.1      82   KQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKA   131
NP_034918.1         82   KQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKA   131
NP_073164.2         82   KQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKA   131
NP_997901.1         91   KQRRSVIRDRGPMYEDPSLPQGWTRKLKQRKSGRSAGKFDVYLINPEGKA   140
NP_001135563.1      83   KQRRSVIRDRGPMYEDPTLPEGWTRKLKQRKSGRSAGKFDVYLINPNGKA   132


NP_004983.1        132   FRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKA   181
XP_521333.3        144   FRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKA   193
XP_001088566.2     132   FRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKA   181
XP_853488.1        132   FRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKA   181
NP_001193481.1     132   FRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKA   181
NP_034918.1        132   FRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKA   181
NP_073164.2        132   FRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKA   181
NP_997901.1        141   FRSKVELMAYFQKVGDTITDPNDFDFTVTGRGSPSRREKRPPKKPKMVKP   190
NP_001135563.1     133   FRSKVELIAYFQKVGDTSLDPNDFDFTVTGRGSPSRREQKQPKKSKAPKS   182


NP_004983.1        182   PGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPG   231
XP_521333.3        194   PGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPG   243
XP_001088566.2     182   PGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPG   231
XP_853488.1        182   PGTGRGRGRPKGSGTARPKAATSEGVQVKRVLEKSPGKLLVKMPFQASPG   231
NP_001193481.1     182   PGTGRGRGRPKGSGTTRPKAAASEGVQVKRVLEKSPGKLLVKMPFQAAPG   231
NP_034918.1        182   PGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPGKLVVKMPFQASPG   231
NP_073164.2        182   PGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPGKLLVKMPFQASPG   231
NP_997901.1        191   --SGRGRGRPKGSGKVRQ---ATEGVAVKRVIEKSPGKLLVKMPF----V   231
NP_001135563.1     183   SGTGRGRGRPKGSVKVKS-PVKSEGVQVKRVIEKSPGKLLVKMPF----S   227


NP_004983.1        232   GKAEGGGATTSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSV------   275
XP_521333.3        244   GKAEGGGATTSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSV------   287
XP_001088566.2     232   GKAEGGGATTSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSV------   275
XP_853488.1        232   SKAEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSV------   275
NP_001193481.1     232   SKAEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSV------   275
NP_034918.1        232   GKGEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSV------   275
NP_073164.2        232   GKGEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSV------   275
NP_997901.1        232   APKTEPGAPLGQAPVAKARRGRKRKSEQDPPSTPKKRGRKPATVSQSTVG   281
NP_001135563.1     228   GSKEESDATTSEQVLVIKRPGRKRKSDTDPSAAPKKRGRKPGSVS-----   272


NP_004983.1        276   ---------VAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETV----   312
XP_521333.3        288   ---------VAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETV----   324
XP_001088566.2     276   ---------VAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETV----   312
XP_853488.1        276   ---------VAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETV----   312
NP_001193481.1     276   ---------VAAATAEAKKKAVKESSIRSVQETVLPIKKRKTRETV----   312
NP_034918.1        276   ---------VAAAAAEAKKKAVKESSIRSVHETVLPIKKRKTRETV----   312
NP_073164.2        276   ---------VAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETV----   312
NP_997901.1        282   TGSAAAYAAAAILTAEAKKKALKESSAKPVQERALPIKKRKTRETLEELE   331
NP_001135563.1     273   --------LAAAAAEAAKKKAIKESSIKPLLETVLPIKKRKTRETI----   310


NP_004983.1        313   --SIEVKEVVKPLL----VSTLGEKSGKGLKTCKSPGRKSKESSPKGRSS   356
XP_521333.3        325   --SIEVKEVVKPLL----VSTLGEKSGKGLKTCKSPGRKSKESSPKGRSS   368
XP_001088566.2     313   --SIEVKEVVKPLL----VSTLGEKSGKGLKTCKSPGRKSKESSPKGRSS   356
XP_853488.1        313   --SIEVKEVVKPLL----VSTLGEKSGKGLKTCKSPGRKSKESSPKGRSS   356
NP_001193481.1     313   --SIEVKEVVKPLL----VSTLGEKSGKGLKTCKSPGRKSKESSPKGRSG   356
NP_034918.1        313   --SIEVKEVVKPLL----VSTLGEKSGKGLKTCKSPGRKSKESSPKGRSS   356
NP_073164.2        313   --SIEVKEVVKPLL----VSTLGEKSGKGLKTCKSPGRKSKESSPKGRSS   356
NP_997901.1        332   ASTTSATETFEKRLTASTVTPTGEEAETGQKPHKHPSRKHKEADPGSSSS   381
NP_001135563.1     311   --SVDVKDTVKPEL----LTPVIEKSIKGQKPAKSPESRSTEGSPKIKTG   354


NP_004983.1        357   SA-----------SSPPKKEHHHHHHHSESPKAPVPLLPPLPPPPPEPES   395
XP_521333.3        369   SA-----------SSPPKKEHHHHHHHSESPKAPVPLLPPLPPPPPEPES   407
XP_001088566.2     357   SA-----------SSPPKKEHHHHHHHSESPKAPVPLLPPLPPPPPEPES   395
XP_853488.1        357   SA-----------SSPPKKEHHHHHHHSEPPKAPAPLLPPPPPPPPEPQS   395
NP_001193481.1     357   SA-----------SSPPKKEHHHHHHHVEPPKAPAPLLLPPPPPPPEPQS   395
NP_034918.1        357   SA-----------SSPPKKEHHHHHHHSESTKAPMPLLP--SPPPPEPES   393
NP_073164.2        357   SA-----------SSPPKKEHHHHHHHAESPKAPMPLLP--PPPPPEPQS   393
NP_997901.1        382   GTTASGVAPKSHKKRDQRGQHFKHHHHHHHHHHQHQHLQASTPSTYTPQA   431
NP_001135563.1     355   LP-----------KKELQQHHHHHHHHHHHHHSESKA----SATSPEPET   389


NP_004983.1        396   SEDPTSPP-------EPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQP   438
XP_521333.3        408   SEDPTSPP-------EPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQP   450
XP_001088566.2     396   SEDPTSPP-------EPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQP   438
XP_853488.1        396   SEDPASPP-------EPQDLSSGVCKEEKMARGGSLESDGCPKEPAKTQP   438
NP_001193481.1     396   SEDPASPP-------EPQDLSSSVCKEEKMPRAGSLESDGCPKEPAKTQP   438
NP_034918.1        394   SEDPISPP-------EPQDLSSSICKEEKMPRGGSLESDGCPKEPAKTQP   436
NP_073164.2        394   SEDPISPP-------EPQDLSSSICKEEKMPRAGSLESDGCPKEPAKTQP   436
NP_997901.1        432   HQLSLGHSTHGGLENEPQDLSTSRPKAEHVACREEARTGSSSSRDSQNAS   481
NP_001135563.1     390   SKDSIGAP-------EPQDLSVKIYKEEKLP-----ESDGCAQEPAKTQP   427


NP_004983.1        439   AVA--------TAATAAEKYKHRGEGERKDIV-SSSMPRPNREEPVDSRT   479
XP_521333.3        451   AVA--------TAATAAEKYKHRGEGERKDIV-SSSMPRPNREEPVDSRT   491
XP_001088566.2     439   AVA--------TAATAAEKYKHRGEGERKDIV-SSSMPRPNREEPVDSRT   479
XP_853488.1        439   TVA--------TAATAADKYKHRGEGERKDIV-SSSMPRPNREEPVDSRT   479
NP_001193481.1     439   ALA--------TAAPATEKYKHRGEGERKDIV-SSSMPRPNREEPVDSRT   479
NP_034918.1        437   MVA--------TTTTVAEKYKHRGEGERKDIV-SSSMPRPNREEPVDSRT   477
NP_073164.2        437   MVAAAATTTTTTTTTVAEKYKHRGEGERKDIV-SSSMPRPNREEPVDSRT   485
NP_997901.1        482   KMA---------SMTVTGESK-----ELRDIVPPSAVPRPSREETVESRT   517
NP_001135563.1     428   ----------------ADKCRNRAEGERKDIV--SSVPRPTREEPVDTRT   459


NP_004983.1        480   PVTERVS   486
XP_521333.3        492   PVTERVS   498
XP_001088566.2     480   PVTERVS   486
XP_853488.1        480   PVTERVS   486
NP_001193481.1     480   PVTERVS   486
NP_034918.1        478   PVTERVS   484
NP_073164.2        486   PVTERVS   492
NP_997901.1        518   PVSEPVS   524
NP_001135563.1     460   TVTERVS   466


Protein Acc. Gene Organism
NP_004983.1 MECP2 H.sapiens
XP_521333.3 MECP2 P.troglodytes
XP_001088566.2 MECP2 M.mulatta
XP_853488.1 MECP2 C.lupus
NP_001193481.1 MECP2 B.taurus
NP_034918.1 Mecp2 M.musculus
NP_073164.2 Mecp2 R.norvegicus
NP_997901.1 mecp2 D.rerio
NP_001135563.1 mecp2 X.tropicalis


Support Center