Display Settings:

Format

Send to:

Choose Destination
HomoloGene:34999. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_699172.2          1   -------MGSEKDSESPRSTS-----------------------------   14
XP_001164659.2       1   -------MGSEKDSESPRSTS-----------------------------   14
XP_535322.4          1   -------MGSEKDSESSGPTQ-----------------------------   14
NP_001192591.1       1   -------MGSEKDSESPRSTS-----------------------------   14
NP_083495.1          1   -------MGSEKDSESPRSTS-----------------------------   14
XP_417816.4          1   -------MGSERDSESPRSSS-----------------------------   14
NP_001189369.1       1   -------MGSEKDSESPHSSV-----------------------------   14
XP_002940071.2       1   MRIGRPQAPPGRLPESQRSSCPFTRYPIRTVCACPCPYMGGSVNLPNIMR   50


NP_699172.2         15   ----------------------LHAAAPDPKCRSGGRRRR--LTLHSVFS   40
XP_001164659.2      15   ----------------------LHAAAPDPKCRSGGRRRR--LTLHSVFS   40
XP_535322.4         15   ----------------------L---PQDPRTR-----------------   22
NP_001192591.1      15   ----------------------LHAAAPDPKCRSGGRRRR--LTFHSVFS   40
NP_083495.1         15   ----------------------LHAAAPDPKCRSGGRRRR--LTFHSVFS   40
XP_417816.4         15   ----------------------IHSAA--AKCPKPGRRRR--LSFQSVFS   38
NP_001189369.1      15   ------------------------SGIPNPKCRGPGKKQG-RISFHSLFH   39
XP_002940071.2      51   LRRFRSVRLPTSWFGIFGFPDMTEGSAEPPPCP-GARRRRLLLSLPNVFP   99


NP_699172.2         41   ---ASARGRRARAKPQAEPPPPAA---Q---------PPPAPAPAAAQGP   75
XP_001164659.2      41   ---ASARGRRARAKPQAEP------------------PPPAPAPAAAQGP   69
XP_535322.4              --------------------------------------------------
NP_001192591.1      41   ---SSARGRRARAKPQAEPPPPAA---P---------PPPTP----AQAS   71
NP_083495.1         41   ---ASARGRRARTKPQAEPPPPAAPPPP---------PPPAPAPVEAQAP   78
XP_417816.4         39   AAAASAAGGRRRAKAD-----------P---------PPAAP--------   60
NP_001189369.1      40   -----SKRGPRGSKANVGTPLAQQLHQQQQIQQQQLLQPPTP--TNVSSD   82
XP_002940071.2     100   --------GRTRAAPEPSVP-------S---------PPPSP-------P   118


NP_699172.2         76   PPEALPAEPAAEAEAEAAAAAAEPGFDDEEAAEGGGPGAEEVECPLCLVR   125
XP_001164659.2      70   PPEALPAEPAAEAEAEAXX------XXXXXXDSGGGPGAEEVECPLCLVR   113
XP_535322.4         23   PCRGLTANTTGNLEHQGRT-------------------------------   41
NP_001192591.1      72   PPEALPAEPAAEAEAEAAA-TVGPGLDDEEAAEGGGSGPEEVECPLCLVR   120
NP_083495.1         79   PVEALPSEPAAEAEAEAVA----AGPEEDEAAEGG--GAEEVECPLCLVR   122
XP_417816.4         61   -----------------------------------GSGEEELECPLCLVR   75
NP_001189369.1      83   PSTADPAEPLSTSQAS-------------------LGGQELLECPLCLVR   113
XP_002940071.2     119   PPVSVPPPPSSP-----------------------GGSDSLIECPLCLVR   145


NP_699172.2        126   LPPERAPRLLSCPHRSCRDCLRHYLRLEISESRVPISCPECSERLNPHDI   175
XP_001164659.2     114   LPPERAPRLLCCPHRSCRDCLRHYLRLEISESRVPISCPECSERLNPHDI   163
XP_535322.4         42   --------------------------------RVPISCPECSERLNPHDI   59
NP_001192591.1     121   LPPERAPRLLSCPHRSCRDCLRHYLRLEISESRVPISCPECSERLNPHDI   170
NP_083495.1        123   LPPERAPRLLSCPHRSCRDCLRHYLRLEISESRVPISCPECSERLNPHDI   172
XP_417816.4         76   QPAENAPRLLSCPHRSCGACLRQYLRIEITESRVNICCPECSERLNPADI   125
NP_001189369.1     114   QPAEQLPELQGCSHRSCLCCLRQYLRIEITESRVQLSCPECAERLAPWQV   163
XP_002940071.2     146   QPPEELPELLSCRHRSCLRCLRQYLRIEISESRVNLRCPECAERLSPQHV   195


NP_699172.2        176   RLLLADPP-LMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVIAYGCASCP   224
XP_001164659.2     164   RLLLADPP-LMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVIAYGCASCP   212
XP_535322.4         60   RLLLADPP-LMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVIAYGCASCP   108
NP_001192591.1     171   RLLLADPP-LMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVIAYGCASCP   219
NP_083495.1        173   RLLLADPP-LMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVIAYGCASCP   221
XP_417816.4        126   RRLLRDSPHLVAKYEEFMLRRCLAADPDCRWCPAPDCGYAVIAYGCASCP   175
NP_001189369.1     164   ALILDDPN-LMEKYEEFLLRRCLASDPDCRWCPAPDCGFAVIASGCASCP   212
XP_002940071.2     196   RAILRDPL-LTRKYEEFLLRRCLAADPDCRWCPAPDCGYAVIAYGCASCP   244


NP_699172.2        225   KLTCEREGCQTEFCYHCKQIWHPNQTCDMARQQRAQTLRVRTKHTSGLSY   274
XP_001164659.2     213   KLTCEREGCQTEFCYHCKQIWHPNQTCDMARQQRAQTLRVRTKHTSGLSY   262
XP_535322.4        109   KLTCEREGCQTEFCYHCKQIWHPNQTCDMARQQRAQTLRVRTKHTSGLSY   158
NP_001192591.1     220   KLTCEREGCQTEFCYHCKQIWHPNQTCDMARQQRAQTLRVRTKHTSGLSY   269
NP_083495.1        222   KLTCEREGCQTEFCYHCKQIWHPNQTCDMARQQRAQTLRVRTKHTSGLSY   271
XP_417816.4        176   KLTCERDGCQTEFCYHCKQIWHPNQTCDMARQQRAQTLRVRTKHTSGLSY   225
NP_001189369.1     213   RLVCRREGCGAEFCYHCKQAWHPNQTCDSARQQRALSLRTHSNHSP--SY   260
XP_002940071.2     245   KLTCEREGCQTEFCYHCKHVWHPNQTCDMARQQRAPSLGVRRKHPSGISY   294


NP_699172.2        275   GQESGPADDIKPCPRCSAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISD   324
XP_001164659.2     263   GQESGPADDIKPCPRCSAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISD   312
XP_535322.4        159   GQESGPADDIKPCPRCSAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISD   208
NP_001192591.1     270   GQESGPADDIKPCPRCSAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISD   319
NP_083495.1        272   GQESGP-DDIKPCPRCSAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISD   320
XP_417816.4        226   GQESGPADDIKPCPRCSAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISD   275
NP_001189369.1     261   TAEQGHTDDIKPCPRCGAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISD   310
XP_002940071.2     295   GQESGSADDMKSCPRCSAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISD   344


NP_699172.2        325   LHYLSPSGCTFWGKKPWSRKKKILWQLGTLIGAPVGISLIAGIAIPAMVI   374
XP_001164659.2     313   LHYLSPSGCTFWGKKPWSRKKKILWQLGTLIGAPVGISLIAGIAIPAMVI   362
XP_535322.4        209   LHYLSPSGCTFWGKKPWSRKKKILWQLGTLIGAPVGISLIAGIAIPAMVI   258
NP_001192591.1     320   LHYLSPSGCTFWGKKPWSRKKKILWQLGTLIGAPVGISLIAGIAIPAMVI   369
NP_083495.1        321   LHYLSPSGCTFWGKKPWSRKKKILWQLGTLIGAPVGISLIAGIAIPAMVI   370
XP_417816.4        276   LHYLSPSGCTFWGKKPWSRKKKILWQLGTLIGAPVGISLIAGIAIPAMVI   325
NP_001189369.1     311   LHYLSPSGCTFWGKKPWSRKKKILWQLGTLIGAPVGITLIAGIAVPAMVI   360
XP_002940071.2     345   LHYLSPSGCTFWGKKPWSRKKKIIWQLGTLIGAPVGISLIAGIAIPAMVI   394


NP_699172.2        375   GIPVYVGRKIHSRYEGRKTSKHKRNLAITGGVTLSVIASPVIAAVSVGIG   424
XP_001164659.2     363   GIPVYVGRKIHSRYEGRKTSKHKRNLAITGGVTLSVIASPVIAAVSVGIG   412
XP_535322.4        259   GIPVYVGRKIHSRYEGRKTSKHKRNLAITGGVTLSVIASPVIAAVSVGIG   308
NP_001192591.1     370   GIPVYVGRKIHSRYEGRKTSKHKRNLAITGGVTLSVIASPVIAAVSVGIG   419
NP_083495.1        371   GIPVYVGRKIHSRYEGRKTSKHKRNLAITGGVTLSVIASPVIAAVSVGIG   420
XP_417816.4        326   GIPVYVGRKIHSRYEGKKTSKHKRNLAITGGVTLSVIASPVIAAVSVGIG   375
NP_001189369.1     361   GIPVYIGRKIHSHYEGKKTSHHRRNLAITGGVALSIITAPVIAAVSVGIG   410
XP_002940071.2     395   GIPVYVGRKIHGRFENKKTSKHKKNLAVTGGVILSVIASPVVAAVSVGIG   444


NP_699172.2        425   VPIMLAYVYGVVPISLCRGGGCGVSTANGKGVKIEFDEDDGPITVADAWR   474
XP_001164659.2     413   VPIMLAYVYGVVPISLCRGGGCGVSTANGKGVKIEFDEDDGPITVADAWR   462
XP_535322.4        309   VPIMLAYVYGVVPISLCRGGGCGVSTANGKGVKIEFDEDDGPITVADAWR   358
NP_001192591.1     420   VPIMLAYVYGVVPISLCRGGGCGVSTANGKGVKIEFDEDDGPITVADAWR   469
NP_083495.1        421   VPIMLAYVYGVVPISLCRGGGCGVSTANGKGVKIEFDEDDGPITVADAWR   470
XP_417816.4        376   VPIMLAYVYGVVPISLCRGGGCGVSTANGKGVKIEFDEDDGPITVADAWR   425
NP_001189369.1     411   VPIMLAYVYGVVPISLCRGGGCGVSRGKGRGVRIDFDEDDGPITVADAWR   460
XP_002940071.2     445   VPIMLAYVYGVVPVSLCRGGGCGVSTAN--GVKIDF-EEDGPITVADAWR   491


NP_699172.2        475   ALKNPSIGESSIEGLTSVLSTSGSPTDGLSVMQGPYSETASFAALSGGTL   524
XP_001164659.2     463   ALKNPSIGESSIEGLTSVLSTSGSPTDGLSVMQGPYSETASFAALSGGTL   512
XP_535322.4        359   ALKNPSIGESSIEGLTSVLSTSGSPTDGLSVMQGPYSETASFAALSGGTL   408
NP_001192591.1     470   ALKNPSIGESSIEGLTSVLSTSGSPTDGLSVMQGPYSETASFAALSGGTL   519
NP_083495.1        471   ALKNPSIGESSIEGLTSVLSTSGSPTDGLSVMQGPYSETASFAALSGGTL   520
XP_417816.4        426   ALKNPSIGESSIEGLTSVLSTSGSPTDGLSVMQSNYSETASFAALSGGTL   475
NP_001189369.1     461   ALKSPSLGESSLEGAASGLSTT-SPSEGLSVAPGGLGDTPHF-----NTL   504
XP_002940071.2     492   ALKNPSIGESSMEGLTSVLSTSGSPTDGLSVLQGNYSETASFAALSGGTL   541


NP_699172.2        525   SGGILSSGKGKYSRLEVQ-ADVQKEIFPKDTASLGAISDNASTRAMAGSI   573
XP_001164659.2     513   SGGILSSGKGKYSRLEVQ-ADVQKEIFPKDTASLGAISDNASTRAMAGSI   561
XP_535322.4        409   SGGILSSGKGKYSRLEVQ-ADVQKEIFPKDTASLGAISDNASTRAMAGSI   457
NP_001192591.1     520   SGGILSSGKGKYSRLEVQ-ADVQKEIFPKDTASLGAISDNASTRAMAGSI   568
NP_083495.1        521   SGGILSSGKGKYSRLEVQ-ADVQKEIFPKDTASLGAISDSASTRAMAGSI   569
XP_417816.4        476   SGGVLSGGKGKYSRLEVQ-ADVQKEIFPKDSVSLGAISDNASTRAMAGSI   524
NP_001189369.1     505   AGGALGARTGKYSRLEVQGTELGKEVAGRETGSLGAASDCASTRGMAGSI   554
XP_002940071.2     542   TGGMLSGGRAKYCRLEVQ-ADVQKETCQKDSVSLGAVSDSASTRAMAGSI   590


NP_699172.2        574   ISSYNPQDRECNNMEIQVDIEAKPSHYQLVSGSSTEDSLHVHAQMAEN--   621
XP_001164659.2     562   ISSYNPQDRECNNMEIQVDIEAKPSHYQLVSGSSTEDSLHVHAQMAEN--   609
XP_535322.4        458   ISSYNPQDRECNNMEIQVDIEAKPSHYQLVSGSSTEDSLHVHAQMAEN--   505
NP_001192591.1     569   ISSYNPQDRECNNMEIQVDIEAKPSHYQLVSGSSTEDSLHVHAQMAEN--   616
NP_083495.1        570   ISSYNPQDRECNNMEIQVDIEAKPSHYQLVSGSSTEDSLHVHAQVAEK--   617
XP_417816.4        525   ISSYNPQDRECNNMEIQVDIEAKPSHYQLASGSSTEDSLHVHTQMAENEE   574
NP_001189369.1     555   TSSYTLPDREGTNLEIQVDIETKPSHLCLTTE---EDLAPPTAAMAP---   598
XP_002940071.2     591   ISSYNPQEREVNNVEIQVHIEAKPSRYQLMSESSTEESLHAAAPLVE---   637


NP_699172.2        622   EEEGSGG-----GGSEEDPPCRHQSC----------EQKDCLASKPWDIS   656
XP_001164659.2     610   EEEGSGG-----GGSEEDPPCRHQSC----------EQKDCLASKPWDIS   644
XP_535322.4        506   EEEGSGR--GGSGSNEEDPSCKHQSC----------EQKDCLASKVWDIS   543
NP_001192591.1     617   EEEGGGGSSGSSGNGEEDPPCKHQSC----------EQKDCLASKPWDIS   656
NP_083495.1        618   EEEGNGA-GGGSGGSEDDPPYKHQSC----------EQKDCLASKAWDIS   656
XP_417816.4        575   EEEEEGEEEEEEEDGEQEQTCKHQSC----------EQKDCVASKTWDIT   614
NP_001189369.1     599   ------------GVGEEPQDCSSRRSRTVMDSPLGLSPGMSLREGLRDVT   636
XP_002940071.2     638   --------------GEDEEACRNQVA----------A---C------DIT   654


NP_699172.2        657   LAQPESIRSDLESSDAQSDDVPDITSDECGSPRSHTAA-CPSTPRAQGAP   705
XP_001164659.2     645   LAQPESIRSDLESSDTQSDDVPDITSDECGSPRSHTAA-CPSTPRAQGAP   693
XP_535322.4        544   LAQPESIRSDLESSDTQSDDVPDITSDECGSPRSHTAA-CPSTPRAPGAP   592
NP_001192591.1     657   LAQPESIRSDLESSDTQSDDVPDITSDECGSPRSQAAA-CPSTPRAPGAP   705
NP_083495.1        657   LAQPESIRSDLESSDTQSDDVPDITSDECGSPRSHAAA-CPSTPQVHGAP   705
XP_417816.4        615   LAQPESIRSDLESSDSQSDDVPDLTSDECASPRSHSAAPCPQTPSARGAE   664
NP_001189369.1     637   LAQPESIRSDLEMSDTQSDDIAELTSDDCDSPHPKSCHGAPPQATCR-AL   685
XP_002940071.2     655   LAQPESIRSDLESSDAQSDDVPDLASEEYDSPHL-----FPPSPSNHLQE   699


NP_699172.2        706   SPSAHM-----NLSALAEG---QTVLKPEGGEARV   732
XP_001164659.2     694   SPSAHM-----NLSALAEG---QTVLKPEGGEARV   720
XP_535322.4        593   SPSAHM-----NLSAPAEG---KTILKPEGAEARV   619
NP_001192591.1     706   SPSAHM-----NLSAPAEG---KTILRPEDAEARV   732
NP_083495.1        706   SPSAHK-----NLAAPAEG---QTVLKSEEYEVE-   731
XP_417816.4        665   SPSAPL-----SHCAHAEGCRLDEMVTLECIEARV   694
NP_001189369.1     686   NPTDSL------HC-------------PDNVILYV   701
XP_002940071.2     700   SPPHRMCAQEEGLCAREEG-----LSKVEFIEVRV   729


Protein Acc. Gene Organism
NP_699172.2 RNF19B H.sapiens
XP_001164659.2 RNF19B P.troglodytes
XP_535322.4 RNF19B C.lupus
NP_001192591.1 RNF19B B.taurus
NP_083495.1 Rnf19b M.musculus
XP_417816.4 RNF19B G.gallus
NP_001189369.1 rnf19b D.rerio
XP_002940071.2 rnf19b X.tropicalis


Support Center