Display Settings:

Format

Send to:

Choose Destination
HomoloGene:3362. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001275701.1       1   MAYSWQTDPNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGK   50
XP_003952177.1       1   MAYSWQTDPNPNESHEKQYEHQEFLVVNQPHSSSQVSLGFDQIVDEISGK   50
XP_002808021.1       1   MAYSWQTDPNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGK   50
XP_534876.4          1   MAYCWKTDLNTSESHQEQHEHQEFHSVNQFLSPNQVSLGFDQLVDEISNK   50
NP_001193441.1       1   MAYYWKTDLNSSESHEKQQEHQEFPSLNQPLFSSLVSLGFDNVVEEISNK   50
NP_997566.1          1   MAYSWQTEPNRTEPQEDGSDTQQFHHTNQHLSSRQVRLGFDQLVEEINNK   50
NP_446375.1          1   MAYNWQTEPNRAEPQEGGHDHQQCHHADQHLSSRQVRLGFDQLVEELSNK   50
XP_416412.4          1   MAYFEKVPLSGNEFHEGHAGDQASYLAYHSGSYGKVYLGFDQIVDEVNNE   50
XP_002665474.3           --------------------------------------------------


NP_001275701.1      51   IPHYESE---IDENTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELS   97
XP_003952177.1      51   IPHYESE---IDENNFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELS   97
XP_002808021.1      51   IPHYESE---IDEDTFFVPIAPKWDSKGHSLNEAHQISLNEFTSKSRELS   97
XP_534876.4         51   VPLYQTD---IEENTIFVPSAPTWDSRRHSLDETHQISLNELTAKSSELS   97
NP_001193441.1      51   IPLCQRE---IEENAFFVPSALHWDSRTHSLDEIHQTSLNEFTSKSSELS   97
NP_997566.1         51   TPLSESE---KEEDTYFVPDAPNLGSKWPSIYETHPRYFSEFTSQSPDSS   97
NP_446375.1         51   TPLPEDE---K-EGTCFVPDTPNLDSKWQSIYGPHPRHFNEFTSQSPHFS   96
XP_416412.4         51   FFFYGSSHLHHPEEHFFSSDIFSLNVPEQQLCSQPSVACGELHSENFVPH   100
XP_002665474.3       1   ---MKRT-------------------------------------------   4


NP_001275701.1      98   WHQVSKAPAIGF-SPSVLPKPQNTNKECSWGSPIGKHHGADDSRFSILAP   146
XP_003952177.1      98   WHQVRKAPAIGF-SPSVLPKPQNMNKECSWGSPIGKHHGADDSRFSILAP   146
XP_002808021.1      98   WHQVRKAPAIGF-SPSVLPKPQNMNKECPWGSPRGKHHGADDSRFNILAP   146
XP_534876.4         98   CHRIRKTPVIGF-RSSVLQNPENTNKGSSWGNPTGKYQGADDYRFNILAS   146
NP_001193441.1      98   CHQVRETPVIGFSRHSVLPNPQNINKGSSWGNPIGKYHGADDYGFNILPL   147
NP_997566.1         98   QLRFGKLSAIGF-NPAVLPTHQLIHEGASWRNPSGKYHGIEYPRFDALPP   146
NP_446375.1         97   QLPFGKASAIGF-NPAVLPAHQFIHEGASWRNPTRKYHGGEDPRFSALTP   145
XP_416412.4        101   WQQGTVSPHIGF-KSSLLSDDGNFSLVDSYPYNQER----EIYRWNSSTP   145
XP_002665474.3       5   -------------DAALRDRPED------W--------------------   15


NP_001275701.1     147   SFTSLDKINLEKELENENHNYHIGFESSIPPTNSSF--SSDFMPKEENKR   194
XP_003952177.1     147   SFTSLDKINLEKELENENYNYHIGFESSIPPTNSSF--SSDFMPKEENKR   194
XP_002808021.1     147   SFTSLDKINLQKELENENRNYPIGFESSIPPTNSSF--STDFMPKEENKR   194
XP_534876.4        147   SSTSLHEINSQRELENENPNYHIGFESSIPSMYPSF--STDFMPKEENER   194
NP_001193441.1     148   SSTSLDKNNSQSQLENENHNYHIGFESSVLPIYPFL--STNLMPKEENKS   195
NP_997566.1        147   SSTGQGECNPQGQSGTKHHNYCGEHEGNLPHHHSSY--SIDSIPNREKRR   194
NP_446375.1        146   SSTGLDKCHQQGQSGTEHCNYYVEPENNVPHHYSPY--SMDSIPDSEEKG   193
XP_416412.4        146   VPNVL---NSNVERGYAYWNFQIGFD-NVDAQCPVFLDKYPFGQRRDESG   191
XP_002665474.3      16   --------------------------------------RLPALEEQEYRE   27


NP_001275701.1     195   SGHVNIVEPSLMLLKGSLQPGMWESTWQKNIESIGCSIQLVEVPQSSNTS   244
XP_003952177.1     195   SGHVNIVEPSLMLLKGSLQPRMWESTWQKNIESIGCSIQLVEVPQSSNTS   244
XP_002808021.1     195   SGHVNIVEPSLMLLKGSLQPGMGESTWQKNIESIGCSIQLVEVPQGSNTS   244
XP_534876.4        195   SRNMNTVQHSLMLFEGSFLPRARESTWPKIIELTGCSSQLVEVPQGTNKD   244
NP_001193441.1     196   RRNMNVVESSLMPFQGSSLPRTWESTHPKNTELTGCSIQLVEVAQGSNMS   245
NP_997566.1        195   SGDVNLVEPSLEFSKDSFLPRTSENVSVESTEPIGCPIEIVEVPQGSNKN   244
NP_446375.1        194   SGDADLVEPSLVFSKDSFLPRASENMSVESTEPIGCPLEIVEAPQGSNKS   243
XP_416412.4        192   NGEACLTNTSRRFSIGS----TWPKSPGHDREVTGWSIQLIKANQGSNEN   237
XP_002665474.3      28   LTAAGGAAQSRRTEQDTPLPDTGDSSP-------DWSIRLVDAAQGSNSR   70


NP_001275701.1     245   LASFCNKVKKIRERYHAADVNFNSGKIWSTTTAFPYQLFSKTKFNIHIFI   294
XP_003952177.1     245   LASFCNKVKKIRERYHAADVNFNSGKIWSTTTAFPYQLFSKTKFNIHIFI   294
XP_002808021.1     245   LASFCNNVKNLLA-------------------------------NIYKMI   263
XP_534876.4        245   LASFCNKVKKIREMYHAADINSNSGKIWSTTTAFPYQLFSNTKFNINICI   294
NP_001193441.1     246   LASFCNKVKKIRETYHAADMDSNSGKIWSTTTAFPYKLFSNTKFNINIFT   295
NP_997566.1        245   LASFCNKVKKIRESYHASDINSNSGKIWAITTAYPSRLFADTKFRVKISI   294
NP_446375.1        244   LASFCNNVTKIRGLYHASDTNSNSGKIWAITTAYPSRLFADTQFRVKIST   293
XP_416412.4        238   AVSFCNTVEKIRNTYPACDLKTNTGKIWSVATKFPDHILGKIRLRISIWT   287
XP_002665474.3      71   TAALCRAAAQLL-----CERVPAAAVLWAPVAPVQESLLGSAELLFRVCV   115


NP_001275701.1     295   DNSTQPLHFMPCANYLVKDLIAEILHFCTNDQLLPKDHILSVCGSEEFLQ   344
XP_003952177.1     295   DNSTQPLHFMPCANDLVKDLIAEILHFCTNDQLLPKDHILSVCGSEEFLQ   344
XP_002808021.1     264   K-----------SNYLVKDLIAEILHFCTNDQLLPKDHILNVCGSEEFLQ   302
XP_534876.4        295   DNSTQLLHFMPNANYLVKDLIAEILHFCTNDQLFPKDHLLSVCGYEEFLQ   344
NP_001193441.1     296   DNSTKGLHFIPCANYLVKDLIAEILHFCMNDQLFPRDHLLSICGHEEFLQ   345
NP_997566.1        295   DNSAQLLLLMPHANYLVKDLIAEILLLCANEPLSPKEYLLSVCGSEEFLQ   344
NP_446375.1        294   DNSAQLLLLKPPANYLVKDLIAEILLLCANEQLSPKEYLLSICGSEEFLQ   343
XP_416412.4        288   DSSPSPLLLTQHAGCITHDLIVEILR-CTNQYPVHEECLLSVCGSDEFLQ   336
XP_002665474.3     116   PWLPEPLLYRSQLHWRVQELLEAVLLTLDQSAADAPLYLLKLCSSDQFLR   165


NP_001275701.1     345   NDHCLGSHKM---FQKDKSVIQLHLQKSREAPGKLSRKHEEDHSQFYLNQ   391
XP_003952177.1     345   NDHCLGSHKM---FXKDKSVIQLTCRK-XGAPGKLSRKHEEDHSQFYLNQ   390
XP_002808021.1     303   NDHSLGSHKM---FQKDKSVIQLHLQKSREAPGKLSRKHEEDHSQFYLNQ   349
XP_534876.4        345   NDYSLGCHKI---FQKDKSVIQLNLQKNGEVPGKLSRKHEDDHSQFYLKQ   391
NP_001193441.1     346   NDHYLGSHRV---FQKNKSVIQLHLQKKRDTPGTLSRKHEDDHSQFYLNQ   392
NP_997566.1        345   MDHSLGSHKI---FQKNKSVIQLHLQKNRDTPGKLSRKSEDDHSPFHLNQ   391
NP_446375.1        344   TDHCLGSHKI---FQKSKSVIQLHLQRSRDTPGKLSRKRDDDRSRVHLNQ   390
XP_416412.4        337   NNHSLGNHES---LRKATTDIHLHLHSTTNLKQSLARVHEDDQGRFSVNE   383
XP_002665474.3     166   SDEVLGYHECIQAYHRFSADVPVRLVLRDSIRKTLSPDEEDHEQSLHYSQ   215


NP_001275701.1     392   LLEFMHIWKVSRQCLLTLIRKYDFHLKYLLKTQE----------------   425
XP_003952177.1     391   LLEFMHIWKVSRQCLLTLIRKYDFHLKYLLKTQE----------------   424
XP_002808021.1     350   LLEFMHIWKVSRQCLLTVIKKYDFHLKYLLKTQE----------------   383
XP_534876.4        392   LLEFMHIWKVSRQCLSTVIKKYDFHLKCLLKTQQ----------------   425
NP_001193441.1     393   LLEFMHIWKVSRQCLSTVIQKYDSHLKYLLKTQQ----------------   426
NP_997566.1        392   LLEFTHIWKISRQCLSTVMKKYNLHVEHLLKPQKDMEEKHLSSMVSGNQH   441
NP_446375.1        391   LLEFTHIWKISRQCLSTVMKSYNLHVEHLLKTQEDVEEKPLSSMFSCGRH   440
XP_416412.4        384   LLEYTCAWRLTRQNLFAALRKYRGQVEHLLQNEPY---------------   418
XP_002665474.3     216   VLQSAS--NHIRWSLQEKLDVYSSAVTRLMRNPTGE--------------   249


NP_001275701.1     426   ----NVYNIIEEVKKICSVLGCVETKQITDAVNELSLILQRKGENFYQSS   471
XP_003952177.1     425   ----NVDNIIEEVKKICSVLGCVETKQITDAVNELSLILQRKAENFYQSS   470
XP_002808021.1     384   ----NVDNIIEEVKNICSVLGCVETKQITDAVNELSLILQRKAENFYQSS   429
XP_534876.4        426   ----HVDNIIEDVKNICSVLGCVETKQITDAVNELNQILQRKTENFHQNS   471
NP_001193441.1     427   ----NVDNVIEEVKSICSVLGCVETKQITDAINELNLILQRKPKNLHQNS   472
NP_997566.1        442   TSQPHVNNVLEEVKNICSVLGCIETKQVSDAVKELNLILQRPSQNFHQNS   491
NP_446375.1        441   PPQPHGNDIIEDVRNICSVLGCIETKQVSDAVKELTLILQRPSQNFHQNS   490
XP_416412.4        419   ----KVDYVIEVAKAICSVLCFVETRQITSAVKKLHAVPLVKTQDSLQHV   464
XP_002665474.3     250   ----GVCVLLDSAVGVCAQL-CVSTVEMEEAAGRLKSFTKLTLDH-----   289


NP_001275701.1     472   ETSAKGLIEKVTTELSTSIYQLINVYCNSFYADFQP--VNVP-RCTSYLN   518
XP_003952177.1     471   ETSAKGLIEKVTTELSTSIYQLINVYCNSFYADFQP--VNVP-RCISYLN   517
XP_002808021.1     430   ETSAKGLIEKVTTELSTSIYQLINVYCNSFYADFQP--VNVP-RCISYLN   476
XP_534876.4        472   ETSAKGLIERVTTALSRSIYQLISVYCCSFYADFQP--LNVP-NDISYLN   518
NP_001193441.1     473   DTSAKGLIEKVTTELSTSICQLIDIHCSSFCADFQP--LHAPLYSVSCVN   520
NP_997566.1        492   ETSKKGFIERVTAELSRSIYQLIDVYCSSFCTDFQP--VHTP-GGVSHVH   538
NP_446375.1        491   ETSKKGFIENVTSELSRSLHQLVDVYCSSFCTDFRP--ARAP-GGVSRDH   537
XP_416412.4        465   E--AQALTEAAVTELSMAISHLIHVYSSSFDTDFQV--ANIP-RSPSRAD   509
XP_002665474.3     290   ----SGDLHTAVVALHRSLLKLLQIFFRSFDLDFSVWGTHTHSHTPPSDV   335


NP_001275701.1     519   PGLPSHLSFTVYAAHNIPETWVHSYKAFSFTCWLTYAGKKLCQVRNYRNI   568
XP_003952177.1     518   PGLPSHLSFTVYAAHNIPETWVHR--------------------------   541
XP_002808021.1     477   PGLPSHLSFTVYAAHNIPETWVHR--------------------------   500
XP_534876.4        519   PGLHSHLSFTVYAVHNIPETWVHSYKAFSFSCCLTYAGKKLCQVRSYRNI   568
NP_001193441.1     521   LGLHSHLSFTVYAAHNIPETWVHR--------------------------   544
NP_997566.1        539   AGLQSHLSFTVCSLHNVPETWAHSYKAFSFSCWLTYAGKKLCQVKSCRPL   588
NP_446375.1        538   AGLHSHLSFTVCSLHNVPETWAHSYKAFSFSCWLTYAGKKLCQVKSCRSL   587
XP_416412.4        510   ISLDSQLSFTVYAAHNIPEAWVNRYKLFSFSCLLTYAGKTICQVKICKNI   559
XP_002665474.3     336   QNHRGVLQLSLTSLHTLQPGWRNGYDHLRMSVSVTHSGRNLAEPVQCENI   385


NP_001275701.1     569   PDKKLFFFLVNWNETINFPLEIKSLPRESMLTVKLFGIACATNNANLLAW   618
XP_003952177.1     542   ---------------INFPLEIKSLPRESMLTVKLFGIACATNNANLLAW   576
XP_002808021.1     501   ---------------INFPLEIKSLPRESMLTVKLFGIACATNNANLLAW   535
XP_534876.4        569   PFKKLFFLLVNWNETINFPLEIKSLPRESMLTIRLFGIVCATNNANLLAW   618
NP_001193441.1     545   ---------------INFPLEIKSLPRESMLTIKLFGITYAT-NADLLAW   578
NP_997566.1        589   PVTKSFSLLVNWNEIINFPLEIKSLPRESMLVIKLFGIDSATHSTNLLAW   638
NP_446375.1        588   PVTKSFSFSVNWNEIINFPLEIKSLPRESMLVIKLFGIDSATHSANLLAW   637
XP_416412.4        560   PVRKSFFFLTDWNEKINFPLRIKALPRETMLTIKLLGLNSASKTTEMLAW   609
XP_002665474.3     386   STSLQLHGRIHCNRQLVFPLAVRDLPYESVLCFSLLGCKQG-RCADPLCW   434


NP_001275701.1     619   TCLPLFPKEKSILGSMLFSMTLQSEPPVEMITPGVWDVSQPSPVTLQIDF   668
XP_003952177.1     577   TCLPLFPKEKSILGSMLFSMTLQSEPPIEMIAPGVWDVSQPSPVTLQIDF   626
XP_002808021.1     536   TCLPLFPKEKSILGSMLFSMTLQSEPPVEMIAPGVWDVSQPSPVTLQIDF   585
XP_534876.4        619   TCLPLFPKDKSILGSVLSSMTLQNEPPIEMIVPGVWDISQPSSVILQIDF   668
NP_001193441.1     579   TCFPLFPKHRSILGSALFSMTLQSEPPMEMIAPGVWDVSQPSPVTLQIDF   628
NP_997566.1        639   TCLPLFPRQESVLGSRLFSVTLQSEPPIEMIAPGVWDGSQPSPLTLQIDF   688
NP_446375.1        638   TCLPLFPKEKSPLGSRLLSMTLQSEPPIEMMAPGVWDGSQPTPLTLQIDF   687
XP_416412.4        610   TCCPLYQKEQLIHGTVLLSMKLYSMLPAAMITPAMCSTDAPTSVTLQIEF   659
XP_002665474.3     435   AVLPLFSDRTLAHGTLLLSMNTQETNSCPASAALSDTHRQPSGVILQVDF   484


NP_001275701.1     669   PATG-WEYMKPDSEENRSNLEEPLKECIKHIARLSQKQTPLLLSEEKKRY   717
XP_003952177.1     627   PATG-WEYMKPDSEENRSNLEEPLKECIKHIARLSQKQTPLLLSEEKKRY   675
XP_002808021.1     586   PATG-WEYVKPDSEENGSNLEEPPKECLKHIARLSQKQTPLLLSEEKKRY   634
XP_534876.4        669   PATE-LEYMKFDSEENRSNLEEPPKECLKHIARLSQKQSPLLLSEEKKRY   717
NP_001193441.1     629   PATE-WEYMKLDSEENGSDLEEPPKECLKHIARLSQKQTPILLSEEKRRY   677
NP_997566.1        689   PDAG-WEYLKPESEENRTDHEEPPRECLKHIAKLSQKKSPLLLSEEKRRY   737
NP_446375.1        688   PAAT-WEYVKPETEENRTDHQEPPRECLKHIARLSQKQPPLLLSVEKRRY   736
XP_416412.4        660   PETD-LEFINPEPEERRDDLAEPTEECMKHIARLSQAHSLLLLSEQQKRI   708
XP_002665474.3     485   PDSELWRYERVLADTRSVQQWSVCEELESRIRAVCQKHCVSLMSENEKAF   534


NP_001275701.1     718   LWFYRFYCNNENCSLPLVLGSAPGWDERTVSEMHTILRRWTFSQPLEALG   767
XP_003952177.1     676   LWFYRFYCNNENCSLPLVLGSAPGWDERTVSEMHTILRRWTFSQPLEALG   725
XP_002808021.1     635   LWFYRFYCNNENCSLPLVLGSAPGWDERTVSEMHTILRRWTFSQPLEALG   684
XP_534876.4        718   LWFYRFYCNNENCSLPLVLGSAPGWDVRTVSEIHTILRRWQFSCPLEALG   767
NP_001193441.1     678   LWFYRFYCNNENCSLPLVLGSAPGWDERTVSEMHTILRRWKFSHPLEALG   727
NP_997566.1        738   LWFYRLYCNNENSSLPLVLGSAPGWDEETVSEMHAILRRWTFSHPWEALG   787
NP_446375.1        737   LWFYRFYCNNENSSLPLVLGSAPGWDEGTVSEMHAVLRRWTFSHPLEALG   786
XP_416412.4        709   LWFYRYYCNNQNCSLPLVLGSAPSWDRTTVSEMYSVMRKWRFSNPVEALG   758
XP_002665474.3     535   LWSKRQSCSSRNALLHLLLGSAPLWAPRDLPELYAVLEHWGPVSHAEALF   584


NP_001275701.1     768   LLTSSFPDQEIRKVAVQQLDNLLNDELLEYLPQLVQAVKFEWNLESPLVQ   817
XP_003952177.1     726   LLTSSFPDQEIRKVAVQQLDNLLNDELLEYLPQLVQAVKFEWNLESPLVQ   775
XP_002808021.1     685   LLTSSFTDQEIRKVAVQQLDTLLNDELLEYLPQLVQAVKFEWNLESPLVQ   734
XP_534876.4        768   LLTSSFPDQEIRKVAVRQLDNLLNDELLEYLPQLVQAVKFEWNLESPLVQ   817
NP_001193441.1     728   LLTSSFPDQEIRNVAVQQLDNLLNDELLEYLPQLVQAVKFEWNLESPLVQ   777
NP_997566.1        788   LLTSRFPDQDIREVAVQQLDTLLTDELLDCLPQLVQAVKFEWNLESPLVE   837
NP_446375.1        787   LLTSRFPDQDIREVAVQQLDNFLTDELLDCLPQLVQAVKFEWSLESPLVE   836
XP_416412.4        759   LLAFSFPDKDIRRTAVQQIENLSNDELLEYLPQLVQVLKFEWSLEGPLVK   808
XP_002665474.3     585   LISHQFHDQRVRSAAVQCFQQMSDSELEEFLPQLVQALKSEWEIDGPLVK   634


NP_001275701.1     818   LLLHRSLQSIQVAHRLYWLLKNAENEAYFKSWYQKLLAALQFCAGKALND   867
XP_003952177.1     776   LLLHRSLQSIQVAHRLYWLLKNAENEAYFKSWYQKLLAALQFCAGKALND   825
XP_002808021.1     735   LLLHRSLQSIQVAHRLYWLLKDAENEAYFKSWYQKLLAALQFCAGKALSD   784
XP_534876.4        818   LLLHRSLQSIQIAHRLYWLLKDAQNETYFKSWYQKLLAALQFCSGKALSD   867
NP_001193441.1     778   LLLHRSLQSVQIAHRLYWLLKDAQNEAYFKIWYQKLLAALQFCAGKALRD   827
NP_997566.1        838   LLPRRPLQSIRVAHCLYWLLRDAQGEAYFKSWYQELLAALQFCAGEALNE   887
NP_446375.1        837   LLLHRSLQSIRVAHRLFWLLRDAQGEDYFKSWYQELLAALQFCAGEALIE   886
XP_416412.4        809   LLLNRSLQSIQVAHQLYWLLKNAQNEVHFKVWYRKLLAALQFTAGKALNN   858
XP_002665474.3     635   LLLSRSMSSVRIAHQLYWLLLDALQDTLFSSFLSKVVCVLKHCCGRALRL   684


NP_001275701.1     868   EFSKEQKLIKILGDIGERVKSASDHQRQEVLKKEIGRLEEFFQDVNTCHL   917
XP_003952177.1     826   EFSKEQKLIKILGDIGEKVKSASDHQRQEALKKEISRLEEFFQDVNTCHL   875
XP_002808021.1     785   EFSKEQKLIKILGDIGEKVKSANDHQRQEVLKKEIGRLEEFFQDVNTCHL   834
XP_534876.4        868   EFSKEKKLIKILGDIGEKVKSASDPQRQEVLKKEIGRLEEFFQCIKTCHL   917
NP_001193441.1     828   EFSKEQKLIKILGDIGEKVKTASDPQRQEVLKKELGRLEEFFWCTKTCHL   877
NP_997566.1        888   ELSKEQKLVKLLGDIGEKVKSASDPQRKDVLKKEIGSLEEFFKDIKTCHL   937
NP_446375.1        887   ELSKEQKLVKLLGDIGEKVKSAGDAQRKDVLKKEIGSLEEFFKDIKTCHL   936
XP_416412.4        859   EFSKEEKLIRILEDTAEKVKVASDAKRKEVLKMELNRLQQFFQEVKVCRL   908
XP_002665474.3     685   ELQQEQRLLDLLTLLAQSVRTADRPKRKELLMRERWKLVSFFADGVSCRL   734


NP_001275701.1     918   PLNPALCIKGIDHDACSYFTSNALPLKITFINANPMGKNISIIFKAGDDL   967
XP_003952177.1     876   PLNPALCIKGIDHDACSYFTSNALPLKITFINANPMGKNISIIFKAGDDL   925
XP_002808021.1     835   PLNPALCIKGIDHDACSYFTSNALPLKITFINANPMGKNISLIFKAGDDL   884
XP_534876.4        918   PLNPALCIKGIDRDACSYFTSHALPLKITFINANPMGKNISIIFKAGDDL   967
NP_001193441.1     878   PLNPALCVQGIDGDACSYFTSNALPLKITFINANPMGKNISVIFKAGDDL   927
NP_997566.1        938   PLNPALCIKGIDRDACSYFTSNASPLKITFINANPMGKNISVIFKAGDDL   987
NP_446375.1        937   PLNPALCVKGIDRDACSYFTSNALPLKITFINANPMGKNISVIFKAGDDL   986
XP_416412.4        909   PLNPALVVQGIEADSCSYFTSNAFPLKIRFINANAPSGNINIIFKIGDDL   958
XP_002665474.3     735   PLDPALLLRGVNTEAFKVFNSNAAPIEVSFITADPLGQNYSIICKTGDNL   784


NP_001275701.1     968   RQDMLVLQLIQVMDNIWLQEGLDMQMIIYRCLSTGKDQGLVQMVPDAVTL   1017
XP_003952177.1     926   RQDMLVLQIIQVMDNIWLQEGLDMQMIIYRCLSTGKDQGLVQMVPDAVTL   975
XP_002808021.1     885   RQDMLVLQIIQVMDNIWLQEGLDMQMIIYRCLSTGKDQGLVQMVPDAVTL   934
XP_534876.4        968   RQDMLVLQIIQVMDNIWLQEGLDMQMIIYRCLSTGKGQGLVQMVPDAITL   1017
NP_001193441.1     928   RQDMLVLQIIQVMDNIWLQEGLDMQMVIYRCLSTGKGQGLVQMVPDAVTL   977
NP_997566.1        988   RQDMLALQIIQVMDNAWLQEGLDMQMITYGCLSTGRAQGFIEMVPDAVTL   1037
NP_446375.1        987   RQDMLVLQIIQVMDNVWLQEGLDMQMIIYGCLATGKAQGFIEMVPDAVTL   1036
XP_416412.4        959   RQDMLVLQIVRVMDNIWLQEGLDMQMIIYRCLSTGKGQGLVQMVPDATTL   1008
XP_002665474.3     785   RQDMLVLQIVRVLDRMWKQEGLDMRMVTYRCISTGPDRGLVEVVGDAVTL   834


NP_001275701.1    1018   AKIHRHSGLIGPLKENTIKKWFSQHNHLKADYEKALRNFFYSCAGWCVVT   1067
XP_003952177.1     976   AKIHRHSGLIGPLKENTIKKWFSQHNHLKADYEKALRNFFYSCAGWCVVT   1025
XP_002808021.1     935   AKIHRHSGLIGPLKENTIKKWFSQHNHLKTDYEKALRNFFYSCAGWCVVT   984
XP_534876.4       1018   AKIHRHSGLIGPLKENTIKKWFSQHNHLKADYEKALRNFFYSCAGWCVVT   1067
NP_001193441.1     978   AKIHRCFGPIGPLKENTIKKWFSQHNPLKADYEKVLRNFFYSCAGWCVVT   1027
NP_997566.1       1038   AKIHLHSGLIGPLKENTIKKWFSQHNHLKEDYEKALRNFFYSCAGWCVVT   1087
NP_446375.1       1037   AKIHLHSGLIGPLKENTIKKWFSQHNHLKEDYEKALRNFFYSCAGWCVVT   1086
XP_416412.4       1009   AKIHRESGLIGPLKENTIRKWFRHHHRLESSYQEAIRNFFHSCAGWCVVT   1058
XP_002665474.3     835   AQIHQEWGLSGALREDTLEKWFHMRNKTKEDYEKAVMNFLHSCAGWCVAT   884


NP_001275701.1    1068   FILGVCDRHNDNIMLTKSGHMFHIDFGKFLGHAQTFGGIKRDRAPFIFTS   1117
XP_003952177.1    1026   FILGVCDRHNDNIMLTKSGHMFHIDFGKFLGHAQTFGGIKRDRAPFIFTS   1075
XP_002808021.1     985   FILGVCDRHNDNIMLTKSGHMFHIDFGKFLGHAQTFGGIKRDRAPFIFTS   1034
XP_534876.4       1068   FILGVCDRHNDNIMLTKSGHMFHIDFGKFLGHAQTFGGIKRDRAPFIFTS   1117
NP_001193441.1    1028   FILGVCDRHNDNIMLTKSGHMFHIDFGKFLGHAQTFGGIKRDRAPFIFTS   1077
NP_997566.1       1088   FILGVCDRHNDNIMLTKSGHMFHIDFGKFLGHAQTFGGIKRDRAPFIFTS   1137
NP_446375.1       1087   FILGVCDRHNDNIMLTKSGHMFHIDFGKFLGHAQTFGGIKRDRAPFIFTS   1136
XP_416412.4       1059   FILGVCDRHNDNIMLTNSGHMFHIDFGRFLGHAQTFGSIRRDRAPFIFTS   1108
XP_002665474.3     885   FVLGICDRHNDNIMLTHSGHMFHIDFGKIMGNAQKFGSIKRDRTPFIFTP   934


NP_001275701.1    1118   EMEYFITEGGKNPQHFQDFVELCCRAYNIIRKHSQLLLNLLEMMLYAGLP   1167
XP_003952177.1    1076   EMDYFITEGGKNPQHFQDFVELCCRAYNIIRKHSQLLLNLLEMRMYSG-P   1124
XP_002808021.1    1035   EMEYFITEGGKNPQHFQDFVELCCRAYNIIRKHSQLLLNLLEMMLYAGLP   1084
XP_534876.4       1118   EMEYFITEGGKNPQHFQDFVELCCQAYNIVRRHSRLLLNLLEMMLHAGLP   1167
NP_001193441.1    1078   EMEYFITEGGKNPQHFQDFVELCCRAYNIVRRHSRLLLNLLEMMLHAGLP   1127
NP_997566.1       1138   EMEYFITEGGKNIQHFQDFVELCCRAYNIVRKHSQLILSLLEMMLHAGLP   1187
NP_446375.1       1137   EMEYFITEGGKNTQHFQDFVELCCRAYNIVRKHSQLLLSLLEMMLHAGLP   1186
XP_416412.4       1109   EMEYFITEGGKSPQRFQEFVELCCRAYNIVRKHSQLLLNLLEMMLHAGLP   1158
XP_002665474.3     935   EMQRFITGGGENPQRFHRFVELCCDAYNRLRRHTALLLALLQPMLNAGMP   984


NP_001275701.1    1168   ELSGI-QDLKYVYNNLRPQDTDLEATSHFTKKIKESLECFPVKLNNLIHT   1216
XP_003952177.1    1125   ELSGILLTRKYVYNNLRPQEHNXEATSHFTKKIKESLECFPVKLNNLIHT   1174
XP_002808021.1    1085   ELSGI-QDLKYVYNNLRPQDTDLEATSHFTKKIKESLECFPVKLNNLIHT   1133
XP_534876.4       1168   ELGGI-QDLKYVYNNLRPQDTDLEATSHFTKKIKESLECFPVKLNNLIHT   1216
NP_001193441.1    1128   ELSGI-QDLKYVYNNLRPQDTDLEATSHFTKKIKESLECFPVKLNNLIHT   1176
NP_997566.1       1188   ELRGI-EDLKYVHNNLRPQDTDLEATSHFTKKIKESLECFPVKLNNLIHT   1236
NP_446375.1       1187   ELRGI-EDLKYVHDNLRPQDTDLEATSHFTTKIKQSLECFPVKLNNLIHT   1235
XP_416412.4       1159   ELNSI-QDLKYVYDNLRPQDSDLQATSYFTRKIKESLECFPVKLNNLIHT   1207
XP_002665474.3     985   EMKDV-QDLQYVHNNLRPEDSELEATSYFTRKIKESMESLPVKLNFLIHN   1033


NP_001275701.1    1217   LAQMSAISPAK-STSQTFPQESCLLSTTRSIERATILGFS-KKSSNLYLI   1264
XP_003952177.1    1175   LAQMSAISPAR-STSQTFPQESCLLSTTRSIERATILGFS-KKSSNLYLI   1222
XP_002808021.1    1134   LAQMSAISPAK-STSQTFPQESCLLSTTRLIQTATILGFS-KKSSNLYLI   1181
XP_534876.4       1217   LAQMTSINPAK-SASQNFSQESCMLNATRSIQRATILGFS-KKTSHLYLI   1264
NP_001193441.1    1177   LAQMTAISPAK-LTSQTFSQESCMSGASRSIQRATVLGFS-KKTSHLYLI   1224
NP_997566.1       1237   LAQMPALSLAK-PAPQTLLQESCILNKTRTIQRVTILGFS-KTHSNLYLM   1284
NP_446375.1       1236   LAQMPAFSLAR-PAPQTPPQECCVLNKTRTIQRVTILGFS-KTHSNLYLI   1283
XP_416412.4       1208   LAHMSLAGSAKFPSQETVPQEWMMLNAEKSIARATILGFN-KKSDYLYLV   1256
XP_002665474.3    1034   MVQLSSKRPEGLSQSQT--------SSSNNIQQAEIQKYTVKGKDVMYEL   1075


NP_001275701.1    1265   QVTHSNNETSLTEKSFEQFSKLHSQLQKQFASLTLPEFPHWWHLPFTNSD   1314
XP_003952177.1    1223   QVTHSNNETSLTEKSFEQFSKLHSQLQKQFASLTLPEFPHWWHLPFTNSD   1272
XP_002808021.1    1182   QVTHSNNETSLIEKSFDQFSKLHSQLQKQFASLTLPEFPHWWHLPFTNSD   1231
XP_534876.4       1265   QVTHSNNETSFSEKSFDQFSKLHSELQKQFASLTLPEFPHWWHLPFTNSN   1314
NP_001193441.1    1225   QVTHSNNETSLTEKSFDQFAKLHSQLQKQFASLTLPEFPHWWHLPFTNSD   1274
NP_997566.1       1285   EVTCSDNRRSLTKKSFEQFYRLHSQMQKQFSSLALPEFPHWWHLPFTDSD   1334
NP_446375.1       1284   EVTRSDNRKNLAKKSFEQFYRLHSQIQKQFPLLTLPEFPHWWHLPFTDSH   1333
XP_416412.4       1257   QVVQTCSLVTFVEKSFDQFSELHSNLQKQFPSHALPEFPHSWHIPFTDLE   1306
XP_002665474.3    1076   KVTIEDGFV-ISQKSFSQLESLHKLLQKHFIESTLPKFPSWFNMSFTPG-   1123


NP_001275701.1    1315   HRRFRDLNHYMEQILNVSHEVTNSDCVLSFFLSEAVQQTVEESSPVYLGE   1364
XP_003952177.1    1273   HRRFRDLNHYMEQILNGSHEVTNSDCVLSFFLSEAVQQTVEESSLVYLGE   1322
XP_002808021.1    1232   HKRFGDLNHYMEQILNGSCEVTNSDCVLSFFLSEAVQQTVEESSLVYLGE   1281
XP_534876.4       1315   HKRFRDLNHYMEQILNGSYEVANSDCVLSFFLSEPVQQTIEESSLLDLGE   1364
NP_001193441.1    1275   HKRFRDLNHYMEQILNGSYEVANSDCVLSFFLSEPVEQAVKESSAVDLGE   1324
NP_997566.1       1335   HKRIRDLSHYVEQVLRGSYEVANSDCVLSFFLSEHIQPTLEDSPFVDPGE   1384
NP_446375.1       1334   HERIRDLSHYVEQVLHGSYEVANSDCVLSFFLSEHIQQTLEDSPFVDPGD   1383
XP_416412.4       1307   HKRVKDLNLYLKQLLSGSRKLANNELVLSFFLNWSKHTLAEAASSVTSGP   1356
XP_002665474.3    1124   -RKMTLLNKYLKELFEGPCR--GNEYVCSLFLDGPDADLRSETN------   1164


NP_001275701.1    1365   KFPDKKPKVQLVISYEDVKLTILVKHMKNIHLPDGSAPSAHVEFYLLPYP   1414
XP_003952177.1    1323   KFPDKKPKVQLVISYKDVKLTILVKHMKNIHLPDGSAPSAHVEFYLLPYP   1372
XP_002808021.1    1282   KFPDKKPKVQLVISYEDVKLTILVKYMKNIHLPDGSAPSAHVEFYLLPYP   1331
XP_534876.4       1365   KFPDKMPMVQLVISHEDAKLTILVKHMKNIHLPDGSAPSAHVEFYLLPYP   1414
NP_001193441.1    1325   KFADKKPKVQLVISYKDAKLTILVKHMKNIHLPDGSAPSAHVEFYLLPYP   1374
NP_997566.1       1385   NSLDKSPKVQLLMTYEDSRLTILVKHLKNIHLPDGSVPSAHVEIYLLPHP   1434
NP_446375.1       1384   HSPDKSPQVQLLMTYEDTKLTILVKHLKNIHLPDGSAPSAHVEIYLLPHP   1433
XP_416412.4       1357   QSTDGTPGVQLVISYEGTHLTVMLKHMRNIRLPDGSAPSAHAEFYLLPDP   1406
XP_002665474.3    1165   --AQIRPQIQLFLSYKDQKLSVLIKHLKNIRLSNGSCPDAYVVTRLRPDP   1212


NP_001275701.1    1415   SEVRRRKTKSVPKCTDPTYNEIVVYDEVTELQGHVLMLIVKSKTVFVGAI   1464
XP_003952177.1    1373   SEVRRRKTKSVPKCTDPTYNEIVVYDEVTELQGHVLMLIVKSKTVFVGAI   1422
XP_002808021.1    1332   SEVRRRKTKSVPKCTDPTYNEIVVYDEVTELQGHVLMLIVKSKTVFVGAI   1381
XP_534876.4       1415   SEVRRRKTKSVPKCTDPTYNEIVVYNEVTELRGHVLMLIVKSKTVFVGAI   1464
NP_001193441.1    1375   SEARRRKTKSVPKCTDPTYNEIVVYDEVTELQGHVLMLIVKSKTTFVGAI   1424
NP_997566.1       1435   SEVRRKKTKCVPKCTDPTYNEIVVYDEVLGLQGHVLMLIVKSKTVFVGAV   1484
NP_446375.1       1434   SEVRRKKTKCVPKCTDPTYNEIVVYDDVSGLQGHVLMLIVKSKTVFVGAV   1483
XP_416412.4       1407   GEVNRRKTRTVPKTTNPTYNEIVVYNKVMQLEGHILKLVVKSKGTFVGAV   1456
XP_002665474.3    1213   HEKTKRKTKAVRNNDHPTFNELIEYRNVLKLHGLVLEVTVKSRKAFVAAT   1262


NP_001275701.1    1465   NIRLCSVPLDKEKWYPLGNSII   1486
XP_003952177.1    1423   NIRLCSVPLDEEKWYPLGNSII   1444
XP_002808021.1    1382   NIQLCSVPLDEEKWYPLGNSII   1403
XP_534876.4       1465   NIQLYSVPLNEEKWYPLGNCII   1486
NP_001193441.1    1425   NIQLCSVTLNEEKWYPLGNSII   1446
NP_997566.1       1485   NIQLCSVPLNEEKWYPLGNSII   1506
NP_446375.1       1484   NIQLCSVPLNEEKWYPLGNSII   1505
XP_416412.4       1457   NIQLSRVQLNEEKWYPLGNSVI   1478
XP_002665474.3    1263   NVVLGERVLEQEKWFPLGFSEV   1284


Protein Acc. Gene Organism
NP_001275701.1 PIK3C2G H.sapiens
XP_003952177.1 PIK3C2G P.troglodytes
XP_002808021.1 PIK3C2G M.mulatta
XP_534876.4 PIK3C2G C.lupus
NP_001193441.1 PIK3C2G B.taurus
NP_997566.1 Pik3c2g M.musculus
NP_446375.1 Pik3c2g R.norvegicus
XP_416412.4 PIK3C2G G.gallus
XP_002665474.3 LOC100330514 D.rerio


Support Center