Display Settings:

Format

Send to:

Choose Destination
HomoloGene:32022. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_005131.1              --------------------------------------------------
XP_529195.2              --------------------------------------------------
XP_001092844.2       1   MRMQGLLSALWDTRYVAPGAWALLKAEKRTPRKETVGRFSLWSQSTEVIK   50
XP_005642014.1           --------------------------------------------------
NP_001001139.1           --------------------------------------------------
NP_031750.2              --------------------------------------------------
NP_037060.1              --------------------------------------------------
XP_001234866.3           --------------------------------------------------
NP_001038211.1           --------------------------------------------------
XP_002939246.1           --------------------------------------------------


NP_005131.1              --------------------------------------------------
XP_529195.2              --------------------------------------------------
XP_001092844.2      51   CYRKPLCRMGKQQHPDMSTSGQESQEGQGVPGVFPVLCKWALGPQESPMA   100
XP_005642014.1           --------------------------------------------------
NP_001001139.1           --------------------------------------------------
NP_031750.2              --------------------------------------------------
NP_037060.1              --------------------------------------------------
XP_001234866.3           --------------------------------------------------
NP_001038211.1           --------------------------------------------------
XP_002939246.1           --------------------------------------------------


NP_005131.1              --------------------------------------------------
XP_529195.2              --------------------------------------------------
XP_001092844.2     101   IANVLASSKVCTYCCLVSLKMKAPASFPFHLEHWGFARVNPFNCLMACFS   150
XP_005642014.1           --------------------------------------------------
NP_001001139.1           --------------------------------------------------
NP_031750.2              --------------------------------------------------
NP_037060.1              --------------------------------------------------
XP_001234866.3           --------------------------------------------------
NP_001038211.1           --------------------------------------------------
XP_002939246.1           --------------------------------------------------


NP_005131.1              --------------------------------------------------
XP_529195.2              --------------------------------------------------
XP_001092844.2     151   AAPSHCPGSVSCHFLWVQAGTQRCWFLSLKCPHYYLGAIVPQRAPDMWHT   200
XP_005642014.1           --------------------------------------------------
NP_001001139.1           --------------------------------------------------
NP_031750.2              --------------------------------------------------
NP_037060.1              --------------------------------------------------
XP_001234866.3           --------------------------------------------------
NP_001038211.1           --------------------------------------------------
XP_002939246.1           --------------------------------------------------


NP_005131.1          1   -----------------------------MTEKTNGVK-SSPANNHNHHA   20
XP_529195.2          1   -----------------------------MTEKTNGVK-SSPANNHNHHA   20
XP_001092844.2     201   LKLPSSSKAATAPEPWPKGGDKRSGCTWRMTEKANGVK-SSPVNNHNHHA   249
XP_005642014.1       1   -----------------------------MTEKSNGVK-SSPANNHNHHA   20
NP_001001139.1       1   -----------------------------MTEKANGVK-SSPANNHNHHA   20
NP_031750.2          1   ----------------------------MMTEKSNGVK-SSPANNHNHHP   21
NP_037060.1          1   ----------------------------MMTEKSNGVK-SSPANNHNHHP   21
XP_001234866.3       1   -----------------------------MMARSNGLQLPGPC----PPL   17
NP_001038211.1       1   ---------------------------------MTCQLLLESMDLSPHRL   17
XP_002939246.1       1   -----------------------------MTGQINTQKSSTPSPVSHPRL   21


NP_005131.1         21   PPAIKANGKDDHRTSSRPHS-AADDDTSSELQRLAD-------VDAPQQG   62
XP_529195.2         21   PPAIKANGKDDHRTSSRPHS-AADDDTSSELQRLAD-------VDAPQQG   62
XP_001092844.2     250   PPAIKANGKDDHRTSSRPHS-AADDDTSSELQRLAD-------VDAHSGE   291
XP_005642014.1      21   PPAIKANGKDDPRTSSRPQS-AADDDTSSELQRLAE-------MDAPQRG   62
NP_001001139.1      21   PPAIKASGKDDHRASSRPQS-AAADDTSSELQQLAE-------MDAPQQR   62
NP_031750.2         22   PPSIKANGKDDHRAGSRPQSVAADDDTSSELQRLAE-------MDTPRRG   64
NP_037060.1         22   PPSIKANGKDDHRAGSRPQSVAADDDTSPELQRLAE-------MDTPRRG   64
XP_001234866.3      18   PTRARTDAQSTELSTSRTHS---TQDETLELHRGTPAYGGEQLAAPPFQG   64
NP_001038211.1      18   SVKTSIEDESEPADCTFSRDQSICDDTSSELQRVAT---LEQQRLNSFRD   64
XP_002939246.1      22   AIKTPSETELESAENCGSRALSVCDDTSSELQRVISQDNGDVVSHSSFRG   71


NP_005131.1         63   RSGFRRIVRLVGIIREWANKNFREEEPRPDSFLERFRGPELQTVTTQEGD   112
XP_529195.2         63   RSGFRRIVRLVGIIRQWANKNFREEEPRPDSFLERFRGPELQTVTTQEGD   112
XP_001092844.2     292   GVGFPQVVRLVGIIREWANKNFREEEPRPDSFLERFRGPELQTVTTQQGD   341
XP_005642014.1      63   RGGFHRIVRLVGVIREWANKNFREEEARPDSFLERFRGPELQTVTTQQGD   112
NP_001001139.1      63   RGGFRRIARLVGVLREWAYRNFREEEPRPDSFLERFRGPELHTVTTQQGD   112
NP_031750.2         65   RGGFRRIVRLVGIIRDWANKNFREEEPRPDSFLERFRGPELQTVTTHQGD   114
NP_037060.1         65   RGGFQRIVRLVGVIRDWANKNFREEEPRPDSFLERFRGPELQTVTTHQGD   114
XP_001234866.3      65   RQALARIVRLVMVLRDWASKSLQEEQQRPDPFLERFQGPELQTVPADAIS   114
NP_001038211.1      65   RGALSRLVNMVVTLREWAHKSLQEEEERPDSFLERFRGPELQIATSRLSI   114
XP_002939246.1      72   RGALSRIVRFVVVLRDWAHRSLRDQDQRPDSFLDRFRGPEVQANDKQPAK   121


NP_005131.1        113   GKGD-KDGEDKGTKKK----FELFVLDPAGDWYYCWLFVIAMPVLYNWCL   157
XP_529195.2        113   GKGD-KDGEDKGTKKK----FELFVLDPAGDWYYCWLFVIAMPVLYNWCL   157
XP_001092844.2     342   GKGD-KDGKDKGTKKK----FELFVLDPAGDWYYCWLFVIAMPVLYNWCL   386
XP_005642014.1     113   GKGD-KDGEGKGTKKK----FELFVLDPAGDWYYRWLFVIAMPVLYNWCL   157
NP_001001139.1     113   GKGD-KDGEGKGTKKK----FELFVLDPAGDWYYRWLFLIALPVLYNWCL   157
NP_031750.2        115   GKGD-KDGEGKGTKKK----FELFVLDPAGDWYYRWLFVIAMPVLYNWCL   159
NP_037060.1        115   DKGG-KDGEGKGTKKK----FELFVLDPAGDWYYRWLFVIAMPVLYNWCL   159
XP_001234866.3     115   GPED-EEAEEKTKKKK----WQSFVVDPARDWYYRWLAVIAVPVLYNWCL   159
NP_001038211.1     115   SRHDIQDGNTSAKTKKK---SDVFILSPADDLYYRWLFVIASAVLYNWCF   161
XP_002939246.1     122   DEKE-QDKVEQDKKKNDRKVCELFVVDPSGKWYYRWLLVITLPVLYNWFL   170


NP_005131.1        158   LVARACFSDLQKGYYLVWLVLDYVSDVVYIADLFIRLRTGFLEQGLLVKD   207
XP_529195.2        158   LVARACFSDLQKGYYLVWLVLDYVSDVVYIADLFIRLRTGFLEQGLLVKD   207
XP_001092844.2     387   LVARACFSDLQKDYYLVWLVLDYVSDVVYIADIFIRLRTGFLEQGLLVKD   436
XP_005642014.1     158   LVARACFSDLQKGYYLVWLVLDYFSDVVYITDLFIRLRTGFLEQGLLVKD   207
NP_001001139.1     158   LVARACFSDLQKGYYIVWLVLDYVSDVVYIADLFIRLRTGFLEQGLLVKD   207
NP_031750.2        160   LVARACFSDLQRNYFVVWLVLDYFSDTVYIADLIIRLRTGFLEQGLLVKD   209
NP_037060.1        160   LVARACFSDLQRNYFVVWLVLDYFSDTVYIADLIIRLRTGFLEQGLLVKD   209
XP_001234866.3     160   LVARACFSDLQKTYVVLWLVLDYISDCIYIGDIVIRLRTGFLEQGLLVKD   209
NP_001038211.1     162   VVARACFNELQTRNFILWLFLDYLSDVIYILDTCVRLRTGFLEQGLLVKD   211
XP_002939246.1     171   LVVRACFDDLQTSYVALWFTLDYICDVIYIADIVIRFRTGFLEQGLLVRD   220


NP_005131.1        208   TKKLRDNYIHTLQFKLDVASIIPTDLIYFAVDIHSPEVRFNRLLHFARMF   257
XP_529195.2        208   TKKLRDNYIHTLQFKLDVASIIPTDLIYFAVDIHSPEVRFNRLLHFARMF   257
XP_001092844.2     437   TKKLRDNYIHTLQFKLDVASIIPTDLIYFAVGIHSPEVRFNRLLHFARMF   486
XP_005642014.1     208   SKKLRDNYIHTLQFKLDVASIIPTDLIYFAVGIHRPELRFNRLLHFARMF   257
NP_001001139.1     208   TKKLRDNYIHTMQFKLDVASIIPTDLIYFAVGIHNPEVRFNRLLHFARMF   257
NP_031750.2        210   PKKLRDNYIHTLQFKLDVASIIPTDLIYFAVGIHSPEVRFNRLLHFARMF   259
NP_037060.1        210   PKKLRDNYIHTLQFKLDVASIIPTDLIYFAVGIHSPEVRFNRLLHFARMF   259
XP_001234866.3     210   LKKLRDNYIYTLQFKLDVLSILPTDLAYFAVGLHHPELRFNRLLHFSRMF   259
NP_001038211.1     212   LIKLRESYFHTLQFKLDLLSIIPTDLGYIVIGIHVPELRLNRLMRFSRLF   261
XP_002939246.1     221   PKTLSNNYIRTLQFKLDIISILPTDLGYFAVGIHRPELRFNRLLHFPRMF   270


NP_005131.1        258   EFFDRTETRTNYPNIFRISNLVLYILVIIHWNACIYYAISKSIGFGVDTW   307
XP_529195.2        258   EFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYAISKSIGFGVDTW   307
XP_001092844.2     487   EFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYAISKSIGFGVDTW   536
XP_005642014.1     258   EFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYAISKSIGFGVDTW   307
NP_001001139.1     258   EFFDRTETRTSYPNIFRISNLILYILIIIHWNACIYYAISKSIGFGVDTW   307
NP_031750.2        260   EFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYAISKSIGFGVDTW   309
NP_037060.1        260   EFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYVISKSIGFGVDTW   309
XP_001234866.3     260   EFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYAISKAIGFGEDSW   309
NP_001038211.1     262   EFFDRTETRTSYPNLFRICNLVLYILVIIHWNACIYFAISKSLGFGSDQW   311
XP_002939246.1     271   ECFDQTETRTSYPNIFRIFNLVLYILLIIHWNGCIYYAFSKAIGFGADSW   320


NP_005131.1        308   VYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDF   357
XP_529195.2        308   VYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDF   357
XP_001092844.2     537   VYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDF   586
XP_005642014.1     308   VYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDF   357
NP_001001139.1     308   VYPNITDPEYGYLSREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDF   357
NP_031750.2        310   VYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDF   359
NP_037060.1        310   VYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDF   359
XP_001234866.3     310   VYPNVTDPEYGYLTREYVYCLYWSTLTLTTIGETPPPVRDEEYLFVIFDF   359
NP_001038211.1     312   VYPNISDPKFGTLTRGYVYCLYWSTLTLTTIGEMPAPVQDEEYLFVVFDF   361
XP_002939246.1     321   VYPNLTDPKHGYLAREYVYCLYWSTLTLTTIGDTPQPMTDTEYLFVIFDF   370


NP_005131.1        358   LIGVLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKGMEA   407
XP_529195.2        358   LIGVLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKEMEA   407
XP_001092844.2     587   LIGVLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKEMEA   636
XP_005642014.1     358   LIGVLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKEMEA   407
NP_001001139.1     358   LIGVLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKEMEA   407
NP_031750.2        360   LIGVLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKDMEA   409
NP_037060.1        360   LIGVLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKDMEA   409
XP_001234866.3     360   LIGVLIFATIVGNVGSMISNMNATRAEFQAKIDAIKHYMQFRKVSKDMET   409
NP_001038211.1     362   LVGVLIFATIVGNVGAMISNMNATRAEFQGQIDAIKHYMKFRKVSKELEA   411
XP_002939246.1     371   LVGVLIFATIVGNVGSMISNMNATRTEFQSKIDAIKHYMQFRRVSKDLEA   420


NP_005131.1        408   KVIRWFDYLWTNKKTVDEREILKNLPAKLRAEIAINVHLSTLKKVRIFHD   457
XP_529195.2        408   KVIRWFDYLWTNKKTVDEQEILKNLPAKLRAEIAINVHLSTLKKVRIFHD   457
XP_001092844.2     637   KVIRWFDYLWTNKKTVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFHD   686
XP_005642014.1     408   KVIKWFDYLWTNKKSVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFQD   457
NP_001001139.1     408   KVIRWFDYLWTNKKSVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFQD   457
NP_031750.2        410   KVIKWFDYLWTNKKTVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFQD   459
NP_037060.1        410   KVIKWFDYLWTNKKTVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFQD   459
XP_001234866.3     410   KVIKWFDYLWTNKKAVDEREVLKSLPDKLRAEIAINVHLETLKKVRIFQD   459
NP_001038211.1     412   RVIKWFDYLWTNKKTIDEQDVLKNLPNKLRAEIAINVHLETLKKVRIFQD   461
XP_002939246.1     421   KVILWFDYLWTNKKTVDEREVLKNLPDKLRAEIAINVHLDTLKKVRIFQN   470


NP_005131.1        458   CEAGLLVELVLKLRPQVFSPGDYICRKGDIGKEMYIIKEGKLAVVADDGV   507
XP_529195.2        458   CEAGLLVELVLKLRPQVFSPGDYICRKGDIGKEMYIIKEGKLAVVADDGV   507
XP_001092844.2     687   CEAGLLVELVLKLRPQVFSPGDYICRKGDIGKEMYIIKEGRLAVVADDGV   736
XP_005642014.1     458   CEAGLLVELVLKLRPQVFSPGDYICRKGDIGKEMYIIKEGKLAVVADDGV   507
NP_001001139.1     458   CEAGLLVELVLKLRPQVFSPGDYICRKGDIGKEMYIIKEGKLAVVADDGV   507
NP_031750.2        460   CEAGLLVELVLKLRPQVFSPGDYICRKGDIGKEMYIIKEGKLAVVADDGV   509
NP_037060.1        460   CEAGLLVELVLKLRPQVFSPGDYICRKGDIGKEMYIIKEGKLAVVADDGV   509
XP_001234866.3     460   CEAGLLVELVLKLRPQVFSPGDYICRKGDIGKEMYIIKEGKLAVVADDGT   509
NP_001038211.1     462   CEAGLLVELVLKLRPQVFSPGDYICRKGDIGKEMYIIKEGCLAVVADDGV   511
XP_002939246.1     471   CEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVGEDGI   520


NP_005131.1        508   TQYALLSAGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDLM   557
XP_529195.2        508   TQYALLSAGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDLM   557
XP_001092844.2     737   TQYALLSAGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDLM   786
XP_005642014.1     508   TQYALLSAGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDLM   557
NP_001001139.1     508   TQYALLSAGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDLM   557
NP_031750.2        510   TQYALLSAGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDLM   559
NP_037060.1        510   TQYALLSAGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDLM   559
XP_001234866.3     510   TQYALLTAGGCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKEDLM   559
NP_001038211.1     512   TQYAHLTAGSCFGEISILNIRGSKMGNRRTANIRSIGYSDLFCLSKGDLM   561
XP_002939246.1     521   THYAVLTSGSCFGEISILNIEGSKMGNRRTASIRSIGYSDLFCLSKDDLM   570


NP_005131.1        558   EAVTEYPDAKKVLEERGREILMKEGLLDENEVATSME-VDVQEKLGQLET   606
XP_529195.2        558   EAVTEYPDAKKVLEERGREILMKEGLLDENEVATSME-VDVQEKLGQLET   606
XP_001092844.2     787   EAVTEYPDAKKVLEERGREILMKEGLLDENEVATSME-VDVQEKLGQLET   835
XP_005642014.1     558   EAVTEYPDAKKVLEERGREILMKEGLLDETEVAASMD-IDVQEKLEQLET   606
NP_001001139.1     558   EAVTEYPDAKRVLEERGREILMKEGLLDENEVAASME-VDVQEKLEQLET   606
NP_031750.2        560   EAVTEYPDAKKVLEERGREILMKEGLLDENEVAASME-VDVQEKLEQLET   608
NP_037060.1        560   EAVTEYPDAKKVLEERGREILMKEGLLDENEVAASME-VDVQEKLEQLET   608
XP_001234866.3     560   EVVTEYPDAKKVLEERGREILIKEGLLDESAEEESMEGKSVEEKLDRLTL   609
NP_001038211.1     562   EAVMEYPDAKKVLEEKGRQILIKEGLLEEVE-ADGIGVEDIEKRVERMED   610
XP_002939246.1     571   EALVEYPDAKKILEERGREILIKEGLLDETKEKISVKGKSSEERLELVES   620


NP_005131.1        607   NMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSD-----   651
XP_529195.2        607   NMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSD-----   651
XP_001092844.2     836   NMETLYTRFGRLLAEYTGAQQKLKQRITILETKMKQNNEDDYLSD-----   880
XP_005642014.1     607   NMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSD-----   651
NP_001001139.1     607   NMDTLYTRFARLLAEYTGAQQKLKQRITVLETKMKQNNEDDSLSD-----   651
NP_031750.2        609   NMETLYTRFARLLAEYTGAQQKLKQRITVLETKMKQNHEDDYLSD-----   653
NP_037060.1        609   NMDTLYTRFARLLAEYTGAQQKLKQRITVLETKMKQNHEDDYLSD-----   653
XP_001234866.3     610   NLDTLHTRLGRLLTEYSDAQMKLKQRITVLESQMRQQDLEDFFSDSSDSL   659
NP_001038211.1     611   TIEILQTRFARLLAQYTATQQHLKQRLTTLECR-TNHSGSGFLSD-----   654
XP_002939246.1     621   NLDILHTRFARLLREYSNAQQTLKQRVTLLELKLRDIHGGEVSSD-----   665


NP_005131.1              --------------------------------------------------
XP_529195.2              --------------------------------------------------
XP_001092844.2           --------------------------------------------------
XP_005642014.1           --------------------------------------------------
NP_001001139.1           --------------------------------------------------
NP_031750.2              --------------------------------------------------
NP_037060.1              --------------------------------------------------
XP_001234866.3     660   SETQVLGPEQHHQPYFQHFIQNSISASAHLLFCSNASSHHSSAWLHPIPR   709
NP_001038211.1           --------------------------------------------------
XP_002939246.1           --------------------------------------------------


NP_005131.1        652   -------------------------------------------GMNSPEL   658
XP_529195.2        652   -------------------------------------------GMNSPEL   658
XP_001092844.2     881   -------------------------------------------GMSSPEL   887
XP_005642014.1     652   -------------------------------------------GITSPEP   658
NP_001001139.1     652   -------------------------------------------GMNSPEP   658
NP_031750.2        654   -------------------------------------------GINTPEP   660
NP_037060.1        654   -------------------------------------------GINTPEP   660
XP_001234866.3     710   RATAHLLLLHRHLGTKLLKETSLFLSVHMESPWGTGGCLFGGRGSGEPIL   759
NP_001038211.1     655   -------------------------------------------GNESTID   661
XP_002939246.1     666   -------------------------------------------GQESAD-   671


NP_005131.1        659   AAADEP---------------------------------   664
XP_529195.2        659   AAADKP---------------------------------   664
XP_001092844.2     888   AAADKP---------------------------------   893
XP_005642014.1     659   AVADKP---------------------------------   664
NP_001001139.1     659   P-AEKP---------------------------------   663
NP_031750.2        661   AVAE-----------------------------------   664
NP_037060.1        661   TAAE-----------------------------------   664
XP_001234866.3     760   PVDARCGPSPGRNLCCGRFVCGAVLEPFISPDAYLMPKW   798
NP_001038211.1     662   GDGTNSEVNIHL---------------------------   673
XP_002939246.1     672   --EGKC---------------------------------   675


Protein Acc. Gene Organism
NP_005131.1 CNGA2 H.sapiens
XP_529195.2 CNGA2 P.troglodytes
XP_001092844.2 LOC704486 M.mulatta
XP_005642014.1 CNGA2 C.lupus
NP_001001139.1 CNGA2 B.taurus
NP_031750.2 Cnga2 M.musculus
NP_037060.1 Cnga2 R.norvegicus
XP_001234866.3 CNGA2 G.gallus
NP_001038211.1 cnga5 D.rerio
XP_002939246.1 cnga2 X.tropicalis


Support Center