Display Settings:

Format

Send to:

Choose Destination
HomoloGene:31147. Gene conserved in Eukaryota Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_003311.2          1   MGARTPLPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHRR   50
XP_003312952.1       1   MGARTPLPSFWVSFFAETGILFPGGTPRPMGSQHSKQHRKPGPLKRGHRR   50
XP_002799697.1       1   ----------------MEGV-----------------------------S   5
XP_005633682.1       1   -------------------------------------------------M   1
NP_001179089.1           --------------------------------------------------
NP_068685.1              --------------------------------------------------
NP_037209.1              --------------------------------------------------
XP_420992.3              --------------------------------------------------
XP_005172409.1           --------------------------------------------------
NP_495710.1              --------------------------------------------------
NP_001050117.1           --------------------------------------------------
NP_001007493.1           --------------------------------------------------


NP_003311.2         51   DRRTTRRKYWKEGREIARVLDDEGRNLRQQKLDRQRALLEQKQKKKRQEP   100
XP_003312952.1      51   DRRTTRRKYWKEGREIACVLDDEGRNLRQQKLDRQRALLEQKQKKKRQEP   100
XP_002799697.1       6   SHRTLSYSRW----SYDSVLDDEGRNLRQQKLDRQRALLEQKQKKKRQEP   51
XP_005633682.1       2   KLRGSARTSL----AISSVLDDEGSNLRQQKLDRQRALLEQKQKKKRQEP   47
NP_001179089.1       1   -MTSKPHSDW----IPYSVLDDEGSNLRQQKLDRQRALLEQKQKKKRQEP   45
NP_068685.1          1   -MTSKPHSDW----IPYSVLDDEGSNLRQQKLDRQRALLEQKQKKKRQEP   45
NP_037209.1          1   -MTSKPHSDW----IPYSVLDDEGSNLRQQKLDRQRALLEQKQKKKRQEP   45
XP_420992.3          1   -MTSRHQADW----IPYSVLDDEGSNLRQQKLDRQRALLEQKQKKKRQEP   45
XP_005172409.1       1   -MSSKHSSDW----IPYSTLDDEGTNLRQQKLDRQRALLEQKQKKKRQEP   45
NP_495710.1          1   --MTDTNSQW-----------------IEMNLQRQRKMLEDKQKQKRHQS   31
NP_001050117.1       1   ----------------YSSLRD----------------------------   6
NP_001007493.1       1   -MTSKHQSDW----IPYSVLDDESSSLRQQKLDRQRALLEQKQKKKRQEP   45


NP_003311.2        101   LMVQANADGRPRSRRARQSEEQAPLVESYLSSSGSTSYQVQEADSLASVQ   150
XP_003312952.1     101   LMVQANADGRPRSRRARQSEEQAPLVESYLSSSGSTSYQVQEADSLASVQ   150
XP_002799697.1      52   LMVQANADGRPRSRRARQSEEQAPLVESYLSSSGSTSYQVQEADSLASLQ   101
XP_005633682.1      48   LMVQANADGRPRSRRARQSEEQAPLVESYLSSSGSTSYQVQEADSLTSAQ   97
NP_001179089.1      46   LMVQANADGRPRSRRARQSEEQAPLVESYL--SGSTGYQVQEADSLASVP   93
NP_068685.1         46   LMVQANADGRPRSRRARQSEEQAPLVESYLSSSGSTSYQVQEADSIASVQ   95
NP_037209.1         46   LMVQANADGRPRSRRARQSEEQAPLVESYLSSSGSTSYQVQEADSLASVQ   95
XP_420992.3         46   LMVQSNVDSRTRARRTKHSEEQAPLVESYLNSNSSTIYHVQEAE---QED   92
XP_005172409.1      46   LMVQSNLDGRSRVRRTRQSEEQAPLVESYLSGNSSTIYH-----------   84
NP_495710.1         32   ----------AGSVRTTSTAMSMNSMKDYPTFDNSLPFSISDNSSVSV--   69
NP_001050117.1           --------------------------------------------------
NP_001007493.1      46   LMVQSNVDSRARGRRMKQSEEQAPLVESYNSSNSSTIYH-----------   84


NP_003311.2        151   LGATRPTAPASAKRTKAAATAGGQGGAARKEKKGKHKGTSGPAALAEDKS   200
XP_003312952.1     151   LGATRPTAPASAKRTKAAATAGGQGGAARKEKKGKHKGTSGPAALAEDKS   200
XP_002799697.1     102   LGATRPTAPASAKRTKAAATAGGQGGAARKEKKGKHKGTSGPATLAEDKS   151
XP_005633682.1      98   LGAARPTAPASAKRTKAAAATGGQGGASRKEKKGKHKGTSGPAVLAEEKS   147
NP_001179089.1      94   LGTAHPTAPASAKRTKAAAAAGGQGGASRKERKGKHKGSGGPAALAEDKS   143
NP_068685.1         96   LGATRPPAPASAKKSKGAAASGGQGGAPRKEKKGKHKGTSGPATLAEDKS   145
NP_037209.1         96   PGATRPPAPASAKKTKGAAASGGQGGAPRKEKKGKHKGTSGPATLAEDKS   145
XP_420992.3         93   VKVVVDAQAPKSTKKAKAASASCQTGSARKEKKGKHKGIDGPAAFQDDVQ   142
XP_005172409.1      85   -------------------------------------VQEA----EQEEV   93
NP_495710.1         70   -------------------------------------SMNTPLIPTQDPI   82
NP_001050117.1           --------------------------------------------------
NP_001007493.1      85   -------------------------------------GIDGPAAFQDEAS   97


NP_003311.2        201   EAQGPVQILTVGQSDHAQDAGETAAGGGERPSGQDLRATMQRKGISSSMS   250
XP_003312952.1     201   EAQGPVQILTVGQSDHAQDAGETAAGGGERPSGQDLRATMQRKGISSSMS   250
XP_002799697.1     152   EAQGPVQILTVGQSDHAQDAGETAAGGGERPSGQDLRATMQRKGISSSMS   201
XP_005633682.1     148   EAPGPVQILTVGRSDHAQDAGETAAGGGAQPSGQDLRATMQRKGVSSSMS   197
NP_001179089.1     144   EARGPVQILTVGQSDQAQDAGETATGGGTRPGGQDIRATMQRKGISSSMS   193
NP_068685.1        146   EAQGPVQILTVGQSDHDKDAGETAAGGGAQPSGQDLRATMQRKGISSSMS   195
NP_037209.1        146   EAQGPVQILTVGQSDHAKDAGETAAGGGAQPSGQDLRATMQRKGISSSMS   195
XP_420992.3        143   KAGSQVQILTVGQSSHDEDDGEKMASGQQQQSKQDLKTAMQKKGISSSMN   192
XP_005172409.1      94   KAVAEVQAPRSAKKSKPPTSTPQTGSAKKEK-KG------KHKGISSSMN   136
NP_495710.1         83   AQPRMQSMPR----QQPQQVQESLISIGDYP-DNDINAKLSKVNLTSCV-   126
NP_001050117.1           --------------------------------------------------
NP_001007493.1      98   SPGSQVQILTVGQSGHEEEATETAASGQQQG-KQDLRITMQKKGISSSMN   146


NP_003311.2        251   F----DEDEEDEEENSSSSSQLNSNTRPSSATSRKSVREAASAPSPTAPE   296
XP_003312952.1     251   F----DEDEEDEEENSSSSSQLNSNTRPSSATSRKSVREAASAPSPTAPE   296
XP_002799697.1     202   F----EEDEEDEEENSSSSSQLNSNTRPSSATSRKSVREAASAPSPTAPE   247
XP_005633682.1     198   F----EEEEEEEDENSSSSSQLNSNTRPSSATSRKSTREAASAPSPTAPE   243
NP_001179089.1     194   FEEEEEEEEEEEDENSSSSSQLNSNTRPSSATSRKSTREAASAPSPTAPE   243
NP_068685.1        196   F-----DEDEDEDENSSSSSQLNSNTRPSSATSRKSIREAASAPSPAAPE   240
NP_037209.1        196   F-----DEEEDEDENSSSSSQLNSNTRPSSATSRKSTREAASAPSPAAPE   240
XP_420992.3        193   F----DEEEDEEDADSSSSSQLNSNTRPGSATSKKSSKEVASAPSPSTNE   238
XP_005172409.1     137   F----DEEEDEDDLVSSSSSQLNSNTRPGSATSKKSSKEATSASTPLANE   182
NP_495710.1        127   -----VSDDEDEDKRSYADSPWNT--------------DVVADRIPSEVL   157
NP_001050117.1           --------------------------------------------------
NP_001007493.1     147   F----DEEEDEEDEDSSSSSQLNSSTRPGSATSKKSSKETVSAPSPPSNE   192


NP_003311.2        297   QPVDVEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHL---   343
XP_003312952.1     297   QPVDVEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHL---   343
XP_002799697.1     248   QPVDVEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHM---   294
XP_005633682.1     244   PSADVEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHL---   290
NP_001179089.1     244   PSVDVEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHL---   290
NP_068685.1        241   PPVDIEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHL---   287
NP_037209.1        241   PPVDIEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHL---   287
XP_420992.3        239   PLIDVD--DLEEFAVRPAPQGATVKCRITRDKKGMDRGMYPTYYLHL---   283
XP_005172409.1     183   PSIDVD--DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHL---   227
NP_495710.1        158   PDYNFIKNNLAKFVEDPAVEHCLYKCSITRQKSGVDKGMFPTYFLHLEEF   207
NP_001050117.1       7   --------------VQPGPRDGTLKCFIRRNRTT------QTYYLYIGLT   36
NP_001007493.1     193   PSIDVE--DLEEFSMRPAPQGVTIKCRITRDKKGMDRGMYPTYYLHL---   237


NP_003311.2        344   DREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMG   393
XP_003312952.1     344   DREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMG   393
XP_002799697.1     295   DREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMG   344
XP_005633682.1     291   DREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMG   340
NP_001179089.1     291   DREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMG   340
NP_068685.1        288   DREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMG   337
NP_037209.1        288   DREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMG   337
XP_420992.3        284   EREHGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMG   333
XP_005172409.1     228   EREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMG   277
NP_495710.1        208   DTDKRQKIFLLAARKRKKSTTANYLLSTDPTNLSREGEGYCAKVRSNALG   257
NP_001050117.1      37   EALADDGKFLLAARKCRKPTCTDYLISLDMSDMSKGSNTYIGKLRSNFLG   86
NP_001007493.1     238   EREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMG   287


NP_003311.2        394   TKFTVYDN------GVNPQKASSSTLESGTLRQELAA-------VCYETN   430
XP_003312952.1     394   TKFTVYDN------GVNPQKASSSTLESGTLRQELAA-------VCYETN   430
XP_002799697.1     345   TKFTVYDN------GVNPQKASSSTLESGTLRQELAA-------VCYETN   381
XP_005633682.1     341   TKFTVYDN------GVNPQKASSSTLESGTLRQELAA-------VCYETN   377
NP_001179089.1     341   TKFTVYDN------GVNPQKASASTLESGTLRQELAA-------VCYETN   377
NP_068685.1        338   TKFTVYDN------GVNPQKASSSTLESGTLRQELAA-------VCYETN   374
NP_037209.1        338   TKFTVYDN------GVNPQKASSSTLESGTLRQELAA-------VCYETN   374
XP_420992.3        334   TKFTVYDN------GVNPMKTTSS-LEASVLRQELAA-------ICYETN   369
XP_005172409.1     278   TKFTVYDS------GMNPVKTTSS-LEAGNLRQELAA-------ICYETN   313
NP_495710.1        258   TQFTVYDS------GQNPKKTTNH----AAIRQELAA-------VIYETN   290
NP_001050117.1      87   TKFTVYDAHPPYDGAVVSKSRSARVVGLNQVSPRVPAGNYPVSHISYELN   136
NP_001007493.1     288   TKFTVYDN------GVNPGKTTSS-LEASNLRQELAA-------ICYETN   323


NP_003311.2        431   VLGFKGPRKMSVIVPGM--NMVHE-----RVSIRPRNEHETL--LARWQN   471
XP_003312952.1     431   VLGFKGPRKMSVIVPGM--NMVHE-----RVSIRPRNEHETL--LARWQN   471
XP_002799697.1     382   VLGFKGPRKMSVIVPGM--NMVHE-----RVSIRPRNEHETL--LARWQN   422
XP_005633682.1     378   VLGFKGPRKMSVIVPGM--NMVHE-----RVSIRPRNEHETL--LARWQN   418
NP_001179089.1     378   VLGFKGPRKMSVIVPGM--TMVHE-----RVSIRPRNEHETL--LARWQN   418
NP_068685.1        375   VLGFKGPRKMSVIVPGM--NMVHE-----RVCIRPRNEHETL--LARWQN   415
NP_037209.1        375   VLGFKGPRKMSVIVPGM--NMVHE-----RVCIRPRNEHETL--LARWQN   415
XP_420992.3        370   VLGFKGPRKMSVIIPGM--NMDHE-----RVSIRPRNEHETL--LARWQN   410
XP_005172409.1     314   VLGFKGPRKMSVIIPGM--NMDHE-----RVSIRPRNEHESL--LARWQN   354
NP_495710.1        291   VLGFKGPRKMTIVMPGI--EPPTENRPAVRCPVRPIQDKHTL--LERYRL   336
NP_001050117.1     137   VLGARGPRRMNCIMDSIPTSAVQEGGKAPTQTEFPLSGLDSFPSISFFRS   186
NP_001007493.1     324   VLGFKGPRKMSVIIPGM--NMDHE-----RVSIRPRNEHETL--LSRWQN   364


NP_003311.2        472   KNT-------------ESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVK   508
XP_003312952.1     472   KNT-------------ESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVK   508
XP_002799697.1     423   KNT-------------ESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVK   459
XP_005633682.1     419   KNT-------------ESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVK   455
NP_001179089.1     419   KNT-------------ESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVK   455
NP_068685.1        416   KNT-------------ESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVK   452
NP_037209.1        416   KNT-------------ESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVK   452
XP_420992.3        411   KNT-------------ESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVK   447
XP_005172409.1     355   KST-------------ESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVK   391
NP_495710.1        337   NDL-------------DSLKILSNKSPQWNDETQSYVLNFHGRVTQASVK   373
NP_001050117.1     187   KSARIDSATSQLSTQKEEKLVLKNKSPRWHEQLQCWCLNFRGRVTVASVK   236
NP_001007493.1     365   KNT-------------ESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVK   401


NP_003311.2        509   NFQII-------HGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIAL   551
XP_003312952.1     509   NFQII-------HGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIAL   551
XP_002799697.1     460   NFQII-------HGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIAL   502
XP_005633682.1     456   NFQII-------HGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIAL   498
NP_001179089.1     456   NFQII-------HGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIAL   498
NP_068685.1        453   NFQII-------HGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIAL   495
NP_037209.1        453   NFQII-------HGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIAL   495
XP_420992.3        448   NFQII-------HDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIAL   490
XP_005172409.1     392   NFQII-------HDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIAL   434
NP_495710.1        374   NFQII-------HQSSPEYIVMQFGRISDDEFTMDFRYPLSAVQAFGIAM   416
NP_001050117.1     237   NFQLVASDENGPTNQEQDKVILQFGKIGKDLFTMDYRYPISAFQSFAICL   286
NP_001007493.1     402   NFQII-------HDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIAL   444


NP_003311.2        552   SSFDSKLACE   561
XP_003312952.1     552   SSFDSKLACE   561
XP_002799697.1     503   SSFDSKLACE   512
XP_005633682.1     499   SSFDSKLACE   508
NP_001179089.1     499   SSFDSKLACE   508
NP_068685.1        496   SSFDSKLACE   505
NP_037209.1        496   SSFDSKLACE   505
XP_420992.3        491   SSFDSKLACE   500
XP_005172409.1     435   SSFDSKLACE   444
NP_495710.1        417   TSFHGKLACE   426
NP_001050117.1     287   SSFDTKIACE   296
NP_001007493.1     445   SSFDSKLACE   454


Protein Acc. Gene Organism
NP_003311.2 TUB H.sapiens
XP_003312952.1 TUB P.troglodytes
XP_002799697.1 TUB M.mulatta
XP_005633682.1 TUB C.lupus
NP_001179089.1 TUB B.taurus
NP_068685.1 Tub M.musculus
NP_037209.1 Tub R.norvegicus
XP_420992.3 TUB G.gallus
XP_005172409.1 tub D.rerio
NP_495710.1 tub-1 C.elegans
NP_001050117.1 Os03g0351400 O.sativa
NP_001007493.1 tub X.tropicalis


Support Center