Display Settings:

Format

Send to:

Choose Destination
HomoloGene:206. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001120972.1       1   MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAET   50
NP_001129302.1       1   MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAET   50
NP_001162100.1       1   MKAPAVLVPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAET   50
NP_001002963.1       1   MKAPAVLAPGILVLLFTLVQKSYGECKEALVKSEMNVNMKYQLPNFTAET   50
NP_001013017.2       1   MKAPAVLAPGILVLLFTFVQKSNGECKEALVKSRMNVNMQYQLPNFTAET   50
NP_032617.2          1   MKAPTVLAPGILVLLLSLVQRSHGECKEALVKSEMNVNMKYQLPNFTAET   50
NP_113705.1          1   MKAPTALAPGILLLLLTLAQRSHGECKEALVKSEMNVNMKYQLPNFTAET   50
NP_990543.1          1   MKPVTAYPSGIILFLFALLQRSHGQCKEAAKKSEMNLNVKYDLPNFITET   50
NP_001007125.1       1   MTIHYSEAASILIILQSLWWGLNCQCEEPIESSKLDLSVTYDLPYFVSDT   50
XP_002935001.1       1   ----MLVAVPVAFVFLSLLLKCMGQCEEAAKMAEMDLNIKHNLQSFTTDT   46


NP_001120972.1      51   PIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDC-FPCQ   99
NP_001129302.1      51   PIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDC-FPCQ   99
NP_001162100.1      51   AIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDC-FPCQ   99
NP_001002963.1      51   PIQNVVLHKHHIYLGAVNYIYVLNDKDLQKVAEYKTGPVLEHPDC-SPCQ   99
NP_001013017.2      51   SIQNVVLHKHHIYLGAINYIYVLNDKDLQKVAEYKTGPVLEHPDC-FPCQ   99
NP_032617.2         51   PIQNVVLHGHHIYLGATNYIYVLNDKDLQKVSEFKTGPVLEHPDC-LPCR   99
NP_113705.1         51   PIQNVVLHGHHIYLGATNYIYVLNDKDLQKVSEFKTGPVVEHPDC-FPCQ   99
NP_990543.1         51   PIQNVVLYKHHVYIGAVNKIYVLNET-LQNISVYKTGPILESPGC-APCE   98
NP_001007125.1      51   PIQKLLEINGTVYVGAVNRLYALSKD-LKKKHEYKTGPVHEGPDCKTPTD   99
XP_002935001.1      47   PIQNIIMFKGYIYVGAVNKIYVLNEN-LTKVSEYKTGPLLVHSHC-LPCK   94


NP_001120972.1     100   DCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHN   149
NP_001129302.1     100   DCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHN   149
NP_001162100.1     100   DCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHN   149
NP_001002963.1     100   DCSHKANLSGGVWEDNINMALLVDTYYDDQLISCGSVHRGTCQRHILPPS   149
NP_001013017.2     100   DCSHKANLSGGVWKDNINMALLVDTYYDDQLISCGSVHRGTCQRHVLPPN   149
NP_032617.2        100   DCSSKANSSGGVWKDNINMALLVDTYYDDQLISCGSVNRGTCQRHVLPPD   149
NP_113705.1        100   DCSSKANVSGGVWKDNVNMALLVDTYYDDQLISCGSVNRGTCQRHVLPPD   149
NP_990543.1         99   DCKDKANLSNSVWKDNVNMALLLETYYDDQLISCGSVSGGVCHRHIIPPD   148
NP_001007125.1     100   QCSGCENKPRNI--NNTNMALLMETFYDLELFSCGSVGNGVCSRHVL---   144
XP_002935001.1      95   NCTDNFLSPNGTWKDNVNMALFVEDFYDDQLISCGNIRRGECQRHTLHSD   144


NP_001120972.1     150   HTADIQSEVHCIFSPQI-EEPSQCPDCVVSALGAKVLSSVKDRFINFFVG   198
NP_001129302.1     150   HTADIQSEVHCIFSPQI-EEPSQCPDCVVSALGAKVLSSVKDRFINFFVG   198
NP_001162100.1     150   HTADIQSEVHCIFSPQI-EEPNQCPDCVVSALGAKVLSSVKDRFINFFVG   198
NP_001002963.1     150   NIADIQSEVHCMYSSQADEEPSQCPDCVVSALGTKVLISEKDRFINFFVG   199
NP_001013017.2     150   NTADIESEVHCMYSPQADEETNQCPDCVVSALGTKVLLSEKDRFINFFVG   199
NP_032617.2        150   NSADIQSEVHCMFSP--EEESGQCPDCVVSALGAKVLLSEKDRFINFFVG   197
NP_113705.1        150   NAADIQSEVHCMFSPLAEEESGQCPDCVVSALGAKVLLSEKDRFINFFVG   199
NP_990543.1        149   NPADIESEVHCMYSPQVDGEADNCPDCVVSTLGTKVLVTEKDRFVNFFVG   198
NP_001007125.1     145   EDGPLGAEVTCMYTKKNEGSSHGCPDCLAGPAGTQILNIMSGRVVRFFVA   194
XP_002935001.1     145   KPWDIASNVHCLYSSQMIEDKDNCPDCIVSTTGSKILVTVRDRFVKFFVG   194


NP_001120972.1     199   NTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIK   248
NP_001129302.1     199   NTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIK   248
NP_001162100.1     199   NTINSSYFPHHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIK   248
NP_001002963.1     200   NTINSSDHPDHSLHSISVRRLKETQDGFKFLTDQSYIDVLPEFRDSYPIK   249
NP_001013017.2     200   NTINSSYLPDYILHSISVRRLKETQDGFKFLTDQSYIDVLPELRDSYPIK   249
NP_032617.2        198   NTINSSYPPGYSLHSISVRRLKETQDGFKFLTDQSYIDVLPEFQDSYPIK   247
NP_113705.1        200   NTINSSYPPDYSLHSISVRRLKETQDGFKFLTDQSYIDVLGEFRDSYPIK   249
NP_990543.1        199   NTMTSAFQPPHVLHSISVRRLKETQDGFEFLTDQSYIDILPQFRDSYPIK   248
NP_001007125.1     195   NSEPLESNGPRLHHTISIRKMRETQDGFEFFSEQSYMDLAPSLRGNYPLH   244
XP_002935001.1     195   STLTGQ---PSTIHSVSVRRLKETQDGFEYLTDQSYIDVLPQLRDIYPIK   241


NP_001120972.1     249   YVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLEC   298
NP_001129302.1     249   YVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLEC   298
NP_001162100.1     249   YIHAFESNNFIYFLTVQRETLNAQTFHTRIIRFCSLNSGLHSYMEMPLEC   298
NP_001002963.1     250   YVHAFESNHFIYFLTVQRETLDAQTFHTRIIRFCSVDSGLHSYMEMPLEC   299
NP_001013017.2     250   YVHAFESNHFIYFLTVQRETLDAQTFHTRIIRFCSADSGLHSYMEMPLEC   299
NP_032617.2        248   YIHAFESNHFIYFLTVQKETLDAQTFHTRIIRFCSVDSGLHSYMEMPLEC   297
NP_113705.1        250   YIHAFESNHFIYFLTVQKETLDAQTFHTRIIRFCSVDSGLHSYMEMPLEC   299
NP_990543.1        249   YVHAFEHDHFVYFLTVQRESLDSQTFHTRIIRFCTLDSEMRSYMEMPLEC   298
NP_001007125.1     245   YVYSFQSGPYVYFLTVQREGGNSKAFHTRIVRMCSSDSEILRYVEMPFEC   294
XP_002935001.1     242   YIYTFESNNFVYFLTVQRESIDSQAYHTRIVRVCSSDSELRSYIEMPLEC   291


NP_001120972.1     299   ILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQ   348
NP_001129302.1     299   ILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQ   348
NP_001162100.1     299   ILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQ   348
NP_001002963.1     300   ILTEKRRKRSTREEVFNILQAAYVSKPGAHLAKQIGANLNDDILYGVFAQ   349
NP_001013017.2     300   ILTEKRRKRSTKQEVFNILQAAYVSKPGAQLARQIGASLNDDILYGVFAQ   349
NP_032617.2        298   ILTEKRRKRSTREEVFNILQAAYVSKPGANLAKQIGASPSDDILFGVFAQ   347
NP_113705.1        300   ILTEKRRKRSTREEVFNILQAAYVSKPGANLAKQIGASPYDDILYGVFAQ   349
NP_990543.1        299   IFTEKRRKRSIRKEVFNILQAAYVSKPGAALAHEMGLGLIDDILYGVFAQ   348
NP_001007125.1     295   IYSERRRKKRSAQVVFNVLQAAHVAKVGYDFQQEMGLKEGEDVLFAAFAR   344
XP_002935001.1     292   IFTEKRRKRSTAGAVFNILQAAYLGRAGEDLAEEMGVKPDDDILYAVFAQ   341


NP_001120972.1     349   SKPDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCF   398
NP_001129302.1     349   SKPDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCF   398
NP_001162100.1     349   SKPDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCF   398
NP_001002963.1     350   SKPDSAEPMNRSAVCAFPIKYVNEFFNKIVNKNNVRCLQHFYGPNHEHCF   399
NP_001013017.2     350   SKPDSSEPMNRSAVCAFPVKYVNEFFNKIVNKNNVRCLQHFYGPNHEHCF   399
NP_032617.2        348   SKPDSAEPVNRSAVCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCF   397
NP_113705.1        350   SKPDSAEPMNRSAVCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCF   399
NP_990543.1        349   TNQIPQEPTNRSAVCAVSVRTINEFFNKIVDKQNMKCLQHFYGKDSKYCL   398
NP_001007125.1     345   SKPDSPEPTASSAVCLISITDINEFFKVFIQKGYTRKLHHFPGSEEK-TF   393
XP_002935001.1     342   SKLDSSEANNRSAVCAVSVKTINEFFNNAADKQNTKCLEHFYEKDNRLCI   391


NP_001120972.1     399   -NRTLLRNSSGCEARRDEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIK   447
NP_001129302.1     399   -NRTLLRNSSSCEARRDEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIK   447
NP_001162100.1     399   -NRTLLRNSSGCEARRDEYRAEFTTALQRVDLFMGQFSEVLLTSISTFVK   447
NP_001002963.1     400   -NRTLLRNSSGCEARNDEYRTEFTTALQRVDLFMGQFNQVLLTSISTFIK   448
NP_001013017.2     400   -NRTLLRNSSGCEVRNDEYRTEFTTALPRVDLFTGQFNQVLLTSISTFIK   448
NP_032617.2        398   -NRTLLRNSSGCEARSDEYRTEFTTALQRVDLFMGRLNQVLLTSISTFIK   446
NP_113705.1        400   -NRTLLRNSSGCEVRSDEYRTEFTTALQAVDLFMGRLNHVLLTSISTFIK   448
NP_990543.1        399   -NRAFSRNASYCRAQDDEYRLEVTTPLQRVDLFMGQFNNILLTSISVFTK   447
NP_001007125.1     394   -NQTFVGDSFSCGKHERGYRLEVTSTNPRRDYFHGRFRNVLLTSIAVVPI   442
XP_002935001.1     392   NNKKFLRNASYCSTPIDEYRVEVTTVLRRLDLFMDQFRNVLLTSISVFTQ   441


NP_001120972.1     448   GDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLN   497
NP_001129302.1     448   GDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLN   497
NP_001162100.1     448   GDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHPLN   497
NP_001002963.1     449   GDLTIANLGTSEGRFMQVVVSRSGLSTPHVNFRLDSHPVSPEAIVEHPLN   498
NP_001013017.2     449   GDLTIANLGTSEGRFMQVVVSRSGSLTPHVNFHLDSHPVSPEVIVEHPLN   498
NP_032617.2        447   GDLTIANLGTSEGRFMQVVLSRTAHLTPHVNFLLDSHPVSPEVIVEHPSN   496
NP_113705.1        449   GDLTIANLGTSEGRFMQVVLSRTAHFTPHVNFLLDSHPVSPEVIVEHPSN   498
NP_990543.1        448   GNLTIANLGTSEGRFMQIVVSRSEPTAPHVSFQLDSHAVSPQVVVEQSAA   497
NP_001007125.1     443   QNHTVVSLGTAEGRVIQVVVSRFGKTEPHVDFRLDMLPVSSEMALLSPQH   492
XP_002935001.1     442   GRLTIANLGTSEGRFMQVVISRTGQPKPHVNFLLEPRPVSPEVVINPASE   491


NP_001120972.1     498   QNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCH--DKC   545
NP_001129302.1     498   QNGYTLVVTGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCH--DKC   545
NP_001162100.1     498   QNGYTLVVTGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCH--DKC   545
NP_001002963.1     499   QNGYTLVVTGKKITRIPLNGLGCEHFQSCSQCLSAPPFVQCGWCH--DRC   546
NP_001013017.2     499   QNGYTLVVTGKKITKIPLNGLGCEHFQSCSQCLSAPSFVQCGWCH--DKC   546
NP_032617.2        497   QNGYTLVVTGKKITKIPLNGLGCGHFQSCSQCLSAPYFIQCGWCH--NQC   544
NP_113705.1        499   QNGYTLVVTGKKITKIPLNGLGCGHFQSCSQCLSAPYFIQCGWCH--NRC   546
NP_990543.1        498   ADGYTLVVTGKKITKVPLNGPGCHHFQSCSQCLLAPAFMRCGWCG--QQC   545
NP_001007125.1     493   HNGSLLLITGDKVSKLPVIGPGCEQLWTCSSCLLAPGFMGCGWCRTSNRC   542
XP_002935001.1     492   ESGYTLVNTGMQLTKVPLVVLTCGHLKSCSHCLSSPS-VNCGWCK--NRC   538


NP_001120972.1     546   VRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNK   595
NP_001129302.1     546   VRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNK   595
NP_001162100.1     546   VRSEECPSGTWTQQICLPAIYKVFPTSAPLEGGTRLTICGWDFGFRRNNK   595
NP_001002963.1     547   VHLEECPTGAWTQEVCLPAIYEVFPTSAPLEGGTVLTVCGWDFGFRRNNK   596
NP_001013017.2     547   VRLEECSSGTWTQETCLPTIYKVFPTSAPLEGGTTLTVCGWDFGFKRNNK   596
NP_032617.2        545   VRFDECPSGTWTQEICLPAVYKVFPTSAPLEGGTVLTICGWDFGFRKNNK   594
NP_113705.1        547   VHSNECPSGTWTQEICLPAVYKVFPTSAPLEGGTMLTICGWDFGFKKNNK   596
NP_990543.1        546   LRAPECNGGTWTQETCLPRVYEILPSSAPLEGGTKLTLCGWDFGFSKNNR   595
NP_001007125.1     543   TRAPRCPQSQWIQDSCPLLITSISPSSAPLRGQTNITICGKNFGFNKKDR   592
XP_002935001.1     539   TRKQECLNEEWIQETCPPAVYEVFPSSAPLEGGTQLTICGSDFVLSKNNN   588


NP_001120972.1     596   FDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHG   645
NP_001129302.1     596   FDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHG   645
NP_001162100.1     596   FDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHG   645
NP_001002963.1     597   FDLKKTKVFLGNESCTLTLSESTTNMLKCTVGPAVNEHFNISIIISNGRG   646
NP_001013017.2     597   FDLKKTRVLLGNESCTLTLTESTTNMLKCTVGPAMNEHFNMSIVISNSRG   646
NP_032617.2        595   FDLRKTKVLLGNESCTLTLSESTTNTLKCTVGPAMSEHFNVSVIISNSRE   644
NP_113705.1        597   FDLRKTKVLLGNESCTLTLSESTTNTLKCTVGPAMSEHFNVSVIVSNSRE   646
NP_990543.1        596   FELRNTVVHIGGQICALEAKSSNKNKLECTAPAAKNASFNISSSVSVGHG   645
NP_001007125.1     593   FDTKLVDVVVAGTKCKLERKDSNNNRLVCGLDYVNWSSLDSVITVRSGKE   642
XP_002935001.1     589   FDLKNTMVIIGKKRCKIEGKFSNQNKLVCRIDSSASSVFNISSSVSNGKQ   638


NP_001120972.1     646   TTQYSTFSYVDPVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGK   695
NP_001129302.1     646   TTQYSTFSYVDPVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGK   695
NP_001162100.1     646   TTQYSTFSYVDPIITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGK   695
NP_001002963.1     647   TAQYSTFSYVDPIITSISPSYGPKNGGTLLTLTGKYLNSGNSRHISMGGK   696
NP_001013017.2     647   SVEYSAFSYVDPIITSISPNYGPKTGGTLLTLTGKHLNSGNSRHISIGGK   696
NP_032617.2        645   TTQYSAFSYVDPVITSISPRYGPQAGGTLLTLTGKYLNSGNSRHISIGGK   694
NP_113705.1        647   TTQYSAFSYVDPVITSISPRYGPHAGGTLLTLTGKYLNSGNSRHISIGGK   696
NP_990543.1        646   KTLFNTFSYVNPIITSISPTYGPKSGGTLLTIAGKYLNSGKSRRIFVGEK   695
NP_001007125.1     643   QAQKDGFSFVNPVIIEIFPEFGPQSGGTMLTISGSFLDSGNVQTVTVGNA   692
XP_002935001.1     639   VVNFTTFSYVNPIITSIMPSHGPKAGRTLITMKGQYLNSGKEQKVIIGKE   688


NP_001120972.1     696   TCTLKSVSNSILECYTPAQTISTEFAVKLKIDLANRETSI-FSYREDPIV   744
NP_001129302.1     696   TCTLKSVSNSILECYTPAQTISTEFAVKLKIDLANRETSI-FSYREDPIV   744
NP_001162100.1     696   TCTLKSVSNSILECYTPAQTISTEFAVKLKIDLANRETSI-FSYREDPIV   744
NP_001002963.1     697   TCTLKSVSDSILECYTPAQATATEFPIKLKIDLANREMNS-FSYQEDPIV   745
NP_001013017.2     697   TCTLKSVSHSILECYTPAQSAPTEFSVKLKIDLANREVNS-FIYREDPIV   745
NP_032617.2        695   TCTLKSVSDSILECYTPAQTTSDEFPVKLKIDLANRETSS-FSYREDPVV   743
NP_113705.1        697   TCTLKSVSDSILECYTPGHTVSAEFPVKLKIDLADRVTSS-FSYGEDPFV   745
NP_990543.1        696   PCSLKSTSESSVECYTPAQRIPQEYRVRVGIDGAIRDAKGYFTYREDPVV   745
NP_001007125.1     693   TCVLQSVSATMLTCRTPPQPSPSQHKVQLHIDGVIFEAPVSYTYNKNPHI   742
XP_002935001.1     689   MCKIKSVSSAAIECYTPVQRTTGTYLVALKIDNADRESSTRFTYMEDPSV   738


NP_001120972.1     745   YEIHPTKSFISTWWKEPLNIVSFLFCFASGGSTITGVGKNLNSVSVPRMV   794
NP_001129302.1     745   YEIHPTKSFI------------------SGGSTITGVGKNLNSVSVPRMV   776
NP_001162100.1     745   YEIHPTKSFI------------------SGGSTITGVGKNLHSVSVPRMV   776
NP_001002963.1     746   YAIHPTKSFI------------------SGGSTITAVGKNLNSVSVLRMV   777
NP_001013017.2     746   YEIHPTKSFI------------------SGGSTITGVGKNLNSVSVLRMV   777
NP_032617.2        744   YEIHPTKSFI------------------SGGSTITGIGKTLNSVSLPKLV   775
NP_113705.1        746   SEIHPTKSFI------------------SGGSTITGIGKNLNSVSTPKLV   777
NP_990543.1        746   LKIHPAKSFL------------------SGGSTITAQGINLNSVCFPRMV   777
NP_001007125.1     743   SSVQPKHSFI------------------SGGSTVTVNGFYLHSALQPQMV   774
XP_002935001.1     739   SNIKPVKSFL------------------SGGSSITAYGRNLNAVASPQMV   770


NP_001120972.1     795   INVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGI   844
NP_001129302.1     777   INVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGI   826
NP_001162100.1     777   INVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGI   826
NP_001002963.1     778   IDVHETRRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGI   827
NP_001013017.2     778   INVHEAGRNFTVACQHRSNSEIICCTTPSIEQLNLQLPLKTKAFFMLDGI   827
NP_032617.2        776   IDVHEVGVNYTVACQHRSNSEIICCTTPSLKQLGLQLPLKTKAFFLLDGI   825
NP_113705.1        778   IEVHDVGVNYTVACQHRSSSEIICCTTPSLQQLDLQLPLKTKAFFLLDGI   827
NP_990543.1        778   ITVPKLGMNFSVACSHRSSSEIICCTTPSLKAFNLQPPFVTKVFFIFDGV   827
NP_001007125.1     775   LTAATEGKLFQVTCSHDEDKRNILCITPSLKGLSVQPPVATKMTFVLDGF   824
XP_002935001.1     771   IRLSKPELSYNMSCIHRSTSELICCSTPSLKELNLEPPITTQVFFILDGV   820


NP_001120972.1     845   LSKYFDLIYVHNPVFKPFEKPVMISMGNENVLEIKGNDIDPEAVK-GEVL   893
NP_001129302.1     827   LSKYFDLIYVHNPVFKPFEKPVMISMGNENVLEIKGNDIDPEAVK-GEVL   875
NP_001162100.1     827   LSKYFDLIYVHNPVFKPFEKPVMISMGNENVLEIKGNDIDPEAVK-GEVL   875
NP_001002963.1     828   HSKYFDLIYVHNPVFKPFEKPVMISIGNENVLEIKGNDIDPEAVK-GEVL   876
NP_001013017.2     828   HSKYFDLIYVHNPVFKPFEKPVMISVGNENVLEIKGNDIDPEAVK-GEVL   876
NP_032617.2        826   LSKHFDLTYVHNPVFEPFEKPVMISIGNENVVEIKGNNIDPEAVK-GEVL   874
NP_113705.1        828   LSKHFDLTYVHDPMFKPFEKPVMISMGNENVVEIKGDDIDPEAVK-GEVL   876
NP_990543.1        828   SSLYFDFDYVNNPVFKHFEKPVLISRSNPNVLEIKGNHIDSEAVK-GEVL   876
NP_001007125.1     825   STDQYDLLYVEDPKFEEFQKPTVTPRGKKNILEIKVPPVNQEAVKNGEVL   874
XP_002935001.1     821   ISNYFELSYVNNPIFETFEKPVVFPIGNKNILEIKGDHIDSEAVR-GEVL   869


NP_001120972.1     894   KVGNKSCENIHLHSEAVLCTVPNDLLKLN-SELNIEWKQAISSTVLGKVI   942
NP_001129302.1     876   KVGNKSCENIHLHSEAVLCTVPNDLLKLN-SELNIEWKQAISSTVLGKVI   924
NP_001162100.1     876   KVGNKSCENIHLHSEAVLCTVPNDLLKLN-SELNIEWKQAISSTVLGKVI   924
NP_001002963.1     877   KVGNKSCETIYSDSKAVLCKVPNDLLKLN-NELNIEWKQAVSSTVLGKVI   925
NP_001013017.2     877   KVGNKSCENIHSHSEAVLCTVPSDLLKLN-SELNIEWKQAISSTVLGKVI   925
NP_032617.2        875   KVGNQSCESLHWHSGAVLCTVPSDLLKLN-SELNIEWKQAVSSTVLGKVI   923
NP_113705.1        877   KVGNKSCENLHWHSEALLCTVPSDLLKLNGGELNIEWKQAVSSTVLGKVI   926
NP_990543.1        877   KVGNKSCENLLLQSETILCTVPSDLLKSN-SELNIEWKQEVLSTVIGKVL   925
NP_001007125.1     875   RVSNRTCESVTLVGNTLECTVPMELQTAA-KELEVEWKQATSSVILGRVI   923
XP_002935001.1     870   KVGNKSCEIIQSKSDSVSCSVPTDLFKSN-SELKIEFLQGVSSIIIGKVM   918


NP_001120972.1     943   VQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQIKDLGSELVRYDAR   992
NP_001129302.1     925   VQPDQNFTGLIAGVVSISIALLLLLGFFLWLKKRKQIKDLGSELVRYDAR   974
NP_001162100.1     925   VQPDQNFTGLIAGVVSISIALLLLLGLFLWLKKRKQIKDLGSELVRYDAR   974
NP_001002963.1     926   VQPDQNFTGLIAGVISISTIVLLLLGLFLWLKRKKQIKDLGSELVRYDAR   975
NP_001013017.2     926   VQPDQNFTGLIVGVVSISIILLLLLGLFLWLKKRKQIKDLGSELVRYDAR   975
NP_032617.2        924   VQPDQNFAGLIIGAVSISVVVLLLSGLFLWMRKRKH-KDLGSELVRYDAR   972
NP_113705.1        927   VQPDQNFAGLIIGAVSISVVVLLVSGLFLWLRKRKH-KDLGSELVRYDAR   975
NP_990543.1        926   IRQDQNFTGLIAGVVSTSVLIYIFLVFFLWRRKKKQIKDLGSDLVRYDGR   975
NP_001007125.1     924   LAQDQDYRILITGGVCVSILLLLLIAVFVWIKRKKHIDDLAKTMVWYDGR   973
XP_002935001.1     919   VTQDQNFTGIITGVVSCVVLLLIIFGVLIWMKKRKQLKDLGGDMVLYDGR   968


NP_001120972.1     993   VHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQV   1042
NP_001129302.1     975   VHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQV   1024
NP_001162100.1     975   VHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQV   1024
NP_001002963.1     976   VHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQV   1025
NP_001013017.2     976   VHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNASQNGSCRQV   1025
NP_032617.2        973   VHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGACRQV   1022
NP_113705.1        976   VHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGACRQV   1025
NP_990543.1        976   VHTPHLDRLVSARSVSPTTEMVSSESVDYRSTFLEDQFPSMSQNGSCRPA   1025
NP_001007125.1     974   AHIPHLDMLANARSVSPTDEMVSHESVDYRTTLLEDQNLPLSQTESCRPH   1023
XP_002935001.1     969   VHTPHLDRLVSARSISPTTEMVSSESVDYRSTVQEDPFPNSSQNGSCRPA   1018


NP_001120972.1    1043   QYPLT--DMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIG   1090
NP_001129302.1    1025   QYPLT--DMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIG   1072
NP_001162100.1    1025   QYPLT--DMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIG   1072
NP_001002963.1    1026   QYPLT--DLSPMLTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIG   1073
NP_001013017.2    1026   QYPLT--DLSPILTSGDSDISSPLLQNTIHIDLSALNPELVQAVQHVVIG   1073
NP_032617.2       1023   QYPLT--DLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIG   1070
NP_113705.1       1026   QYPLT--DLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIG   1073
NP_990543.1       1026   QYPHS--DLSPILSSGDSDLASPLLQTNVHIDISALNPDLVKEVQHVVIG   1073
NP_001007125.1    1024   LYAHSHVDLSPMLGPMEGDLASPLLPSTAPIDLGSLHPELLKXVQHVVIA   1073
XP_002935001.1    1019   QYAHR--DLSPILSSGDSDIASPLLHSYVHIDISALSTDLMKEVEHMVIR   1066


NP_001120972.1    1091   PSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVS   1140
NP_001129302.1    1073   PSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVS   1122
NP_001162100.1    1073   PSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVS   1122
NP_001002963.1    1074   PSSLIVHFNEVIGRGHFGCVYHGTLLDNDDKKIHCAVKSLNRITDIGEVS   1123
NP_001013017.2    1074   PSSLIVHFNEVIGRGHFGCVYHGTLLDNDDKKIHCAVKSLNRITDIGEVS   1123
NP_032617.2       1071   PSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIEEVS   1120
NP_113705.1       1074   PSSLIVHFNEVIGRGHFGCVYHGTLLDSDGKKIHCAVKSLNRITDIEEVS   1123
NP_990543.1       1074   ADSLMVHFSEVIGRGHFGCVSHGTLLDNDGRKIHCAVKSLNRITDLEEVA   1123
NP_001007125.1    1074   REDLLLHVNEIIGRGHFGCVFHGTLLEPDGQKQHCAIKSLNRITDIEEVS   1123
XP_002935001.1    1067   VDRLIVHFNKVIGRGHFGCVYHGTLLDIDGKNVHCAVKSLNRITDIEEVS   1116


NP_001120972.1    1141   QFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNE   1190
NP_001129302.1    1123   QFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNE   1172
NP_001162100.1    1123   QFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNE   1172
NP_001002963.1    1124   QFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNE   1173
NP_001013017.2    1124   QFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNE   1173
NP_032617.2       1121   QFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNE   1170
NP_113705.1       1124   QFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNE   1173
NP_990543.1       1124   QFLKEGIIMKDFTHPNVLSLLGICLPNEGSPLVVLPYMKHGDLRNFIRNE   1173
NP_001007125.1    1124   QFLKEGIIVKDFSHPNVLSLLGICLPSEGSPLVVLPYMKHGDLRNFIRDE   1173
XP_002935001.1    1117   QFLKEGIIMKDFSHPNVLSLLGICLPNEGSPLVVLPFMKHGDLRNFIRNE   1166


NP_001120972.1    1191   THNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVAD   1240
NP_001129302.1    1173   THNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVAD   1222
NP_001162100.1    1173   THNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVAD   1222
NP_001002963.1    1174   THNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVAD   1223
NP_001013017.2    1174   THNPTVKDLIGFGLQVAKGMEYLASKKFVHRDLAARNCMLDEKFTVKVAD   1223
NP_032617.2       1171   THNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVAD   1220
NP_113705.1       1174   THNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVAD   1223
NP_990543.1       1174   THNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVAD   1223
NP_001007125.1    1174   SHNPTVKDLMGFGLQVAKGMEYLASKKFVHRDLAARNCMLDESYTVKVAD   1223
XP_002935001.1    1167   THNPTVKDLIGFGLQVAKGMEYLASKKFVHRDLAARNCMLDEHFTVKVAD   1216


NP_001120972.1    1241   FGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVL   1290
NP_001129302.1    1223   FGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVL   1272
NP_001162100.1    1223   FGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVL   1272
NP_001002963.1    1224   FGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVL   1273
NP_001013017.2    1224   FGLARDVYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVL   1273
NP_032617.2       1221   FGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVL   1270
NP_113705.1       1224   FGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVL   1273
NP_990543.1       1224   FGLARDVYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVL   1273
NP_001007125.1    1224   VGLARDVYDKEYYSVHNKHGVKLPVKWMALESLQTHKFTTKSDVWSFGVL   1273
XP_002935001.1    1217   FGLARDVYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGIL   1266


NP_001120972.1    1291   LWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHP   1340
NP_001129302.1    1273   LWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHP   1322
NP_001162100.1    1273   LWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHP   1322
NP_001002963.1    1274   LWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHP   1323
NP_001013017.2    1274   LWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHP   1323
NP_032617.2       1271   LWELMTRGAPPYPDVNTFDITIYLLQGRRLLQPEYCPDALYEVMLKCWHP   1320
NP_113705.1       1274   LWELMTRGAPPYPDVNTFDITIYLLQGRRLLQPEYCPDALYEVMLKCWHP   1323
NP_990543.1       1274   LWELMTRGAPPYPDVNSFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHP   1323
NP_001007125.1    1274   LWELMTRGAPPYSDVNSFDITVFLLQGRRLLQPEFCPDALYNVMIECWHP   1323
XP_002935001.1    1267   LWELMTRGAPPYPDVNSFDITIYLLQGRRLLQPEYCPDPLFEVMLKCWHP   1316


NP_001120972.1    1341   KAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSE   1390
NP_001129302.1    1323   KAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSE   1372
NP_001162100.1    1323   KAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSE   1372
NP_001002963.1    1324   RAELRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQ   1373
NP_001013017.2    1324   KAELRPSFSELVSRISVIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQ   1373
NP_032617.2       1321   KAEMRPSFSELVSRISSIFSTFIGEHYVHVNATYVNVKCVAPYPSLLPSQ   1370
NP_113705.1       1324   KAEMRPSFSELVSRISSIFSTFIGEHYVHVNATYVNVKCVAPYPSLLPSQ   1373
NP_990543.1       1324   KPEMRPAFSELVSKISTIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQ   1373
NP_001007125.1    1324   KPERRPTFLELVSRISAIFSSFSGEHYILLNTTYVNIDKMTPYPSLISSQ   1373
XP_002935001.1    1317   RPELRPTFSELVSRISSIFSTFIGEHYVLFNATYVNIKCAAPYPSLLSPE   1366


NP_001120972.1    1391   DNADDEVDTRPASFWETS   1408
NP_001129302.1    1373   DNADDEVDTRPASFWETS   1390
NP_001162100.1    1373   DNADDEVDT---------   1381
NP_001002963.1    1374   DNIDGEGDT---------   1382
NP_001013017.2    1374   DNVSGEDDDDT-------   1384
NP_032617.2       1371   DNIDGEGNT---------   1379
NP_113705.1       1374   DNIDGEANT---------   1382
NP_990543.1       1374   DNTDMDVDT---------   1382
NP_001007125.1    1374   SNLDRDCCT---------   1382
XP_002935001.1    1367   DNTECSIDT---------   1375


Protein Acc. Gene Organism
NP_001120972.1 MET H.sapiens
NP_001129302.1 MET P.troglodytes
NP_001162100.1 MET M.mulatta
NP_001002963.1 MET C.lupus
NP_001013017.2 MET B.taurus
NP_032617.2 Met M.musculus
NP_113705.1 Met R.norvegicus
NP_990543.1 MET G.gallus
NP_001007125.1 met D.rerio
XP_002935001.1 met X.tropicalis


Support Center