Display Settings:

Format

Send to:

Choose Destination
HomoloGene:20437. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001836.2          1   --------MGPRLSVWLLLLPAALLLHEEHSR-AAAKGGCAGSGCGKCDC   41
XP_003314261.2       1   --------MGPRLSVWLLLLPAALLLHEEHSR-AAAKGGCAGSGCGKCDC   41
XP_001088660.2       1   --------MGPRLSVWLLLLPAALLLHEEHSR-AAAKGGCAGSGCGKCDC   41
XP_005634201.1       1   MAGSRQEWKRPRVG------LSHPLIHTWSHIFSSFQGGCAGSGCGKCDC   44
NP_001159983.1       1   --------MGPRLGVWLMLLLAALLLHEESSR-AAAKGGCAGSGCGKCDC   41
NP_034061.2          1   --------MGPRLSVWLLLLFAALLLHEERSR-AAAKGDCGGSGCGKCDC   41
NP_001128481.1       1   --------MGPRLSVWLLLPLAALLLHEERSR-AAAKGDCGGSGCGKCDC   41
NP_001155871.1       1   --------------MWRWLGFGLLLSAELS---AVSAAGC--SGCGKCDC   31
XP_694040.5          1   ----------MRLPCVTVFLLAVFLSIDE----STAKGGCSGSSCGGCDC   36
XP_002933064.2       1   -------------MSWRLLCALLILLGLIG---TSDSAACSGCGTSKCDC   34


NP_001836.2         42   HGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKG   91
XP_003314261.2      42   HGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKG   91
XP_001088660.2      42   HGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKG   91
XP_005634201.1      45   HGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKG   94
NP_001159983.1      42   HGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKG   91
NP_034061.2         42   HGVKGQKGERGLPGLQGVIGFPGMQGPEGPHGPPGQKGDAGEPGLPGTKG   91
NP_001128481.1      42   HGVKGQKGERGFPGLQGVIGFPGMQGPEGPHGPPGQKGDAGEPGLPGTKG   91
NP_001155871.1      32   SGVKGQKGERGLPGLQGVIGFPGMQGPEGPPGPPGLKGDTGEPGLPGTKG   81
XP_694040.5         37   SGVKGAKGEVGLPGLMGLVGFPGMQGHEGPPGSMGPKGDRGEIGAPGIKG   86
XP_002933064.2      35   SGVKGQKGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKG   84


NP_001836.2         92   TRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLP   141
XP_003314261.2      92   TRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLP   141
XP_001088660.2      92   TRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLP   141
XP_005634201.1      95   TRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGEPGPLGPPGLP   144
NP_001159983.1      92   TRGPSGVPGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPVGPPGLP   141
NP_034061.2         92   TRGPPGAAGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLP   141
NP_001128481.1      92   TRGPPGAAGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLP   141
NP_001155871.1      82   TRGPPGPSGFPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPVGPPGLP   131
XP_694040.5         87   SRGLPGQAGFPGRPGIPGLPGLEGAPGPQGIPGCNGTKGERGFDGIPGIT   136
XP_002933064.2      85   TRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLP   134


NP_001836.2        142   GFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGERGFPGIPGTPGPPGLPG   191
XP_003314261.2     142   GFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGERGFPGIPGTPGPPGLPG   191
XP_001088660.2     142   GFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGERGFPGLPGNPGPPGLPG   191
XP_005634201.1     145   GFAGNPGPPGLPGMKGDPGEIIGHVPGTLLKGERGFPGPPGTPGSPGLPG   194
NP_001159983.1     142   GFAGNPGPPGLPGMKGDPGEILGHIPGTLLKGERGYPGQPGAPGSPGLPG   191
NP_034061.2        142   GFSGNPGPPGLPGMKGDPGEILGHVPGTLLKGERGFPGIPGMPGSPGLPG   191
NP_001128481.1     142   GFSGNPGPPGLPGMKGDPGEILGHVPGTLLKGERGFPGIPGAPGSPGLPG   191
NP_001155871.1     132   GLTGSIGPPGPPGIKGDPGEVIGILPPSVLKGDKGFPGQPGLPGPPGTPG   181
XP_694040.5        137   GLLGPPGIPGIKGGKGDPGGVIGL--PIPLKGDRGLPGQHGFPGQKGNAG   184
XP_002933064.2     135   GIIGYPGSPGQPGPKGEPGDITG-IDVSMIKGEKGFPGINGIPGTPGLPG   183


NP_001836.2        192   LQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPKGDKGDQGVSGPPG   241
XP_003314261.2     192   LQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPKGDKGDQGVSGPPG   241
XP_001088660.2     192   LQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPKGDKGDQGVSGPPG   241
XP_005634201.1     195   LQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPKGDKGDQGVSGPPG   244
NP_001159983.1     192   LQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPKGEKGDQGVSGPPG   241
NP_034061.2        192   LQGPVGPPGFTGPPGPPGPPGPPGEKGQMGSSFQGPKGDKGEQGVSGPPG   241
NP_001128481.1     192   LQGPVGPPGFTGPPGPPGPPGPPGEKGQMGSSFQGPKGDKGEQGVSGPPG   241
NP_001155871.1     182   FQGPMGPPGIPGEPGPPGPPGPPGEKGYMGLGFQGPKGEKGEQGVQGPPG   231
XP_694040.5        185   QQGPVGPPGPYGPPGRPGDPGQKGEPGDK-LTFIGEKGEKGQRGLTGPPG   233
XP_002933064.2     184   TPGPMGPIGPPGSAGPPGSHGAPGPKGEMGISFYGPKGERGDRGPPGAPC   233


NP_001836.2        242   VPGQA-QVQEKGD--FATKGEKGQKGEPGFQGMPGV------GEKGEPGK   282
XP_003314261.2     242   VPGQA-QVQEKGD--FATKGEKGQKGEPGFQGMPGV------GEKGEPGK   282
XP_001088660.2     242   VPGQA-QVQEKGD--FATKGEKGQKGEPGFQGMPGV------GEKGEPGK   282
XP_005634201.1     245   VPGQA-QVQEKGD--FATKGEKGQKGEPGFQGMPGV------GEKGEPGK   285
NP_001159983.1     242   LPGQA-QVITKGD--TAMRGEKGQKGEPGFPGLPGF------GEKGEPGK   282
NP_034061.2        242   VPGQA-QVKEKGD--FAPTGEKGQKGEPGFPGVPGY------GEKGEPGK   282
NP_001128481.1     242   VPGQA-QVKEKGD--FAPTGEKGQKGEPGFQGTPGY------GEKGEPGK   282
NP_001155871.1     232   PPGPAPHMKEKGS--EIIKGEKGEPGEKGEQGVPGLPGSGYRGEKGEPGK   279
XP_694040.5        234   PPGRSEEYEGPATTLYLP-GPPGETGSTGDKGDKGSCAPHQHGIKGEPGP   282
XP_002933064.2     234   KPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQ---SFKGEKGEPGP   280


NP_001836.2        283   PGPRGKPGKDGDKGEKGSPGFPGEPGYPGLIGRQGPQGEKGEAGPPGPPG   332
XP_003314261.2     283   PGPRGKPGKDGDKGEKGSPGFPGEPGYPGLIGRQGPQGEKGEAGPPGPPG   332
XP_001088660.2     283   PGPRGKPGKDGDKGEKGSPGFPGEPGYPGLIGRQGPQGEKGEAGPPGPPG   332
XP_005634201.1     286   PGPRGKPGKDGEKGEKGSPGFPGDSGYPGLPGREGFKGDKGEAGPPGPPG   335
NP_001159983.1     283   PGPRGKPGKDGEKGEKGSPGFPGDSGYPGQPGQDGLKGEKGEAGPPGLPG   332
NP_034061.2        283   QGPRGKPGKDGEKGERGSPGIPGDSGYPGLPGRQGPQGEKGEAGLPGPPG   332
NP_001128481.1     283   PGPRGKPGKDGEKGEKGSPGFPGESGYPGLPGRQGPQGEKGEPGLPGPPG   332
NP_001155871.1     280   PGPRGKPGKDGEPGPKGEPGLPGGFGIPGRPGEPGAKGEKGDQGPQGPPG   329
XP_694040.5        283   PGPIGKPGKDGQSGEK------GEIGFPGNPGLDGFKGDKGERGPPG---   323
XP_002933064.2     281   LGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPG   330


NP_001836.2        333   IVIGTG------PL---GEKGERGYPGT-----PGPRGEPGPK-------   361
XP_003314261.2     333   IVSKSAVPGSVRAL---GEEGED--PGAVRTLGGGGRGAWGCENTGGRRE   377
XP_001088660.2     333   IVIGTG------PL---GEKGERGYPGT-----PGPRGEPGPK-------   361
XP_005634201.1     336   IAIGPG------PL---GEKGERGYPGA-----PGLRGEPGPK-------   364
NP_001159983.1     333   TVIGTG------PL---GEKGEPGYPGG-----PGAKGETGPK-------   361
NP_034061.2        333   TVIGTM------PL---GEKGDRGYPGA-----PGLRGEPGPK-------   361
NP_001128481.1     333   TVVGTR------PL---GEKGERGYPGS-----PGLRGEPGPK-------   361
NP_001155871.1     330   RIIDAG------PIDTFGEKGDPGVSGL-----PGLKGQKGEK-------   361
XP_694040.5        324   -----------------YGAGSPGPPGP-----PGLPGAEGET-------   344
XP_002933064.2     331   IVVSNG------EIEV-CEKGDRGLPGF-----PGSKGDKGLK-------   361


NP_001836.2        362   ---GFPGLPGQPGP---------PGL------------PVPGQAGA---P   384
XP_003314261.2     378   RTLGLAPILAQSGAFLLSVLTTFPSLWNVPQLEIRLQDKIPSSCCAQPQP   427
XP_001088660.2     362   ---GFPGLPGQPGP---------PGP------------PLPGLAGA---P   384
XP_005634201.1     365   ---GFPGLQGQPGP---------PG-------------------------   377
NP_001159983.1     362   ---GFPGIPGQPGP---------PGF------------PTPGLIGA---P   384
NP_034061.2        362   ---GFPGTPGQPGP---------PGF------------PTPGQAGA---P   384
NP_001128481.1     362   ---GYPGSPGQPGP---------PGF------------AVPGQTGA---P   384
NP_001155871.1     362   ---GFPGAQGIPGI---------PGR------------PVPDMVGS---P   384
XP_694040.5        345   ---GFQGEPGAPGP---------PGR------------YIEGPPGP---P   367
XP_002933064.2     362   ---GAQGFPGIPGS---------PGV------------PLPGSTGP---P   384


NP_001836.2        385   GFPGERGEKGDR----G--------------------------FPGTSL-   403
XP_003314261.2     428   CLPGPRGSSGDRLDVSGSVPLWSALFPLLSMLLFIPAKSSCVLFPSTVLF   477
XP_001088660.2     385   GFPGERGEKGDR----G--------------------------FPGASL-   403
XP_005634201.1     378   ---------EHP----W--------------------------LIGLEY-   387
NP_001159983.1     385   GFPGDRGEKGEP----G--------------------------LPGVSL-   403
NP_034061.2        385   GFPGERGEKGDQ----G--------------------------FPGVSL-   403
NP_001128481.1     385   GFPGERGEKGER----G--------------------------SPGVSL-   403
NP_001155871.1     385   GVPGQRGEKGEK----G--------------------------SPGFPI-   403
XP_694040.5        368   GFPGEIGKKGEK----G--------------------------ADGRSF-   386
XP_002933064.2     385   GFPGERGEKGQH----G--------------------------LPGLAL-   403


NP_001836.2        404   ------PGPSGRDGLPGPPGSPGP--PGQP-------------------G   426
XP_003314261.2     478   LTLSSSQPDAGSRSWPPVLGRLVPWLPGEEEKGDEDFWYFLQDHYNSDNS   527
XP_001088660.2     404   ------PGPSGRDGLPGPPGSPGP--PGQP-------------------G   426
XP_005634201.1     388   ------SRTA--------SGPPSG--QERL-------------------G   402
NP_001159983.1     404   ------PGPSGRDGLPGPPGPPGP--PGQP-------------------G   426
NP_034061.2        404   ------PGPSGRDGAPGPPGPPGP--PGQP-------------------G   426
NP_001128481.1     404   ------PGPSGRDGAPGPPGPPGP--PGQP-------------------G   426
NP_001155871.1     404   ------PGPPGRDGFPGPPGLPGP--PGPP-------------------G   426
XP_694040.5        387   ------PGPKGTDGQPGPPGPPGP--------------------------   404
XP_002933064.2     404   ------QGPKGRDGFPGPPGLPGP--P----------------------G   423


NP_001836.2        427   YTNGIVECQPGPPGDQGPPGIPGQPGFIGEIGEKGQKGESCLICDID--G   474
XP_003314261.2     528   ISDGIVECQPGPPGDQGPPGIPGQPGFIGEIGEKGQKGESCLICDID--G   575
XP_001088660.2     427   YTNGIVECQPGPPGDQGPPGIPGQPGLIGEIGEKGQKGESCLICDTT--G   474
XP_005634201.1     403   RSYGIVECQPGPPGDQGPPGIPGQPGLTGEVGEKGQKGDSCLVCDMA--G   450
NP_001159983.1     427   HTNGIVECQPGPPGDQGPPGIPGQPGLTGEVGEKGQKGDSCLVCDTA--E   474
NP_034061.2        427   HTNGIVECQPGPPGDQGPPGTPGQPGLTGEVGQKGQKGESCLACDTE--G   474
NP_001128481.1     427   HTNGIVECQPGPPGDQGPPGIPGQPGLTGEVGQKGQKGESCLACDTE--G   474
NP_001155871.1     427   VTDGIDQCQQGQPGAPGVPGPPGQHGFPGEMGEKGEKGETCALCDKV--G   474
XP_694040.5        405   ---INEECDV----TKGAPGPPGPPGLQGEVGQKGDQGETCTECNAF--G   445
XP_002933064.2     424   AIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPG   473


NP_001836.2        475   YRGPPGPQGPPGEIGFPGQPGAKGDRGLPGRDGVAGVPGPQGTPGLIGQP   524
XP_003314261.2     576   YRGPPGPQGPPGEIGFPGQPGAKGDRGLPGRDGVAGVPGPQGTPGLIGQP   625
XP_001088660.2     475   YRGPPGPQGPPGEIGFPGQPGAKGDRGLPGRDGVAGVPGPQGTPGLIGQP   524
XP_005634201.1     451   LRGPPGPQGPPGEIGFPGQPGAKGDRGLPGRDGLEGLPGPQGVPGLMGQP   500
NP_001159983.1     475   LRGPPGPQGPPGEIGFPGQPGAKGDRGLPGRDGLEGLPGPQGAPGLMGQP   524
NP_034061.2        475   LRGPPGPQGPPGEIGFPGQPGAKGDRGLPGRDGLEGLPGPQGSPGLIGQP   524
NP_001128481.1     475   LRGPPGPQGPPGEIGFPGQPGAKGDRGLPGRDGLEGLPGPQGSPGLIGQP   524
NP_001155871.1     475   PPGLPGPQGLPGPAGFPGQSGFKGDRGLPGLDGLPGVPGPPGAPGLIGLP   524
XP_694040.5        446   PPGLPGPQGPKGLQGFPGPAGIKGEKGLPGPSGPAGNAGFNGAPGLMGKP   495
XP_002933064.2     474   LPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSP   523


NP_001836.2        525   GAKGEPGEFYFDLRLKGDKGDPGFPGQPGMTGRAGSPGRDGHPGLPGPKG   574
XP_003314261.2     626   GAKGEPGEIYFDLRLKGDKGDPGFPGQPGMPGRAGSPGRDGHPGLPGPKG   675
XP_001088660.2     525   GAKGEPGEIYFDLRLKGDKGDPGFPGQPGMPGRAGSPGRDGRPGLPGPKG   574
XP_005634201.1     501   GAKGEPGEIYFDARLKGDKGDPGFPGQPGMPGRAGSPGRDGHPGLPGPKG   550
NP_001159983.1     525   GAKGEPGEIYFDIRLKGDKGDPGFPGQPGMPGRAGSPGRDGQPGLPGPRG   574
NP_034061.2        525   GAKGEPGEIFFDMRLKGDKGDPGFPGQPGMPGRAGTPGRDGHPGLPGPKG   574
NP_001128481.1     525   GAKGEPGEIFFDMRLKGDKGDPGFPGQPGMPGRAGTPGRDGHPGLPGPKG   574
NP_001155871.1     525   GAKGEPGDFTYDSILKGEKGDPGFPGQPGIPGREGTPGKDGLPGPQGPKG   574
XP_694040.5        496   GAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKG   545
XP_002933064.2     524   GAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKG   573


NP_001836.2        575   SPGSVGLKGERGPPGGVGFPGSRGDTGPPGPPGYGPAGPIGDKGQAGFPG   624
XP_003314261.2     676   SPGSVGLKGERGPPGGVGFPGSRGDTGPPGPPGYGPTGPIGDKGQAGFPG   725
XP_001088660.2     575   SPGSVGLKGERGPPGGVGFPGSRGDTGPPGPPGYGPTGPIGDKGQAGFPG   624
XP_005634201.1     551   SPGSVGLKGERGPPGGVGFPGSRGDIGPPGPPGFGPIGPVGDKGQAGFPG   600
NP_001159983.1     575   SPGSVGLKGERGPPGGVGFPGSRGDIGPPGPPGFGPIGPIGDKGQIGFPG   624
NP_034061.2        575   SPGSIGLKGERGPPGGVGFPGSRGDIGPPGPPGVGPIGPVGEKGQAGFPG   624
NP_001128481.1     575   SPGSIGLKGERGPPGGVGFPGSRGDIGPPGPPGVGPIGPIGEKGQAGLPG   624
NP_001155871.1     575   ASGTAGLKGERGPPGQPGFPGVRGERGLPGSPGVGTAGLPGDKGERGFAG   624
XP_694040.5        546   EPAKFGIKGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPG   595
XP_002933064.2     574   VAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPG   623


NP_001836.2        625   GPGSPGLPGPKGEPGKIVPLPGPPGAEGLPGSPGFPGPQGDRGFPGTPGR   674
XP_003314261.2     726   GPGSPGLPGPKGEPGKVVPLPGPPGAEGLPGSPGFPGPQGDRGFPGTPGR   775
XP_001088660.2     625   GPGSPGLPGPKGEPGKVVPLPGPPGAEGLPGSPGFPGPQGDRGFPGTPGR   674
XP_005634201.1     601   IPGSPGQPGPKGEAGKVVPLPGPPGAQGLPGSPGFQGPQGDRGFPGTPGR   650
NP_001159983.1     625   TPGAPGQPGPKGEAGKVVPLPGPPGAEGLPGSPGFQGPQGDRGFPGSPGR   674
NP_034061.2        625   GPGSPGLPGPKGEAGKVVPLPGPPGAAGLPGSPGFPGPQGDRGFPGTPGR   674
NP_001128481.1     625   GPGSPGLPGPKGEAGKVVPLPGPPGAAGLPGSPGFPGPQGDRGFPGTPGR   674
NP_001155871.1     625   TPGLPGLPGTKGEAGRTVPLPGPPGADGLPGPPGFPGPQGDKGNPGLPGR   674
XP_694040.5        596   APGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGV   645
XP_002933064.2     624   FVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGR   673


NP_001836.2        675   PGLPGEKGAVGQPGIGFPGPPGPKGVDGLPGDMGPPGTPGRPGFNGLPGN   724
XP_003314261.2     776   PGLPGEKGAVGQPGIGFPGPPGPKGVDGLPGDVGPPGTPGRPGFNGLPGN   825
XP_001088660.2     675   PGLPGEKGAVGQPGIGFPGPPGPKGVDGLPGDMGPPGTPGRPGFNGLPGN   724
XP_005634201.1     651   PGLPGEKGAIGQPGIGFPGPPGPKGVDGLPGDVGPPGSPGRPGFNGLPGN   700
NP_001159983.1     675   PGLPGEKGAIGQPGIGFPGPPGPKGVDGLPGDAGPPGNPGRQGFNGLPGN   724
NP_034061.2        675   PGIPGEKGAVGQPGIGFPGLPGPKGVDGLPGEIGRPGSPGRPGFNGLPGN   724
NP_001128481.1     675   PGNPGEKGAVGQPGIGFPGLPGPKGVDGLPGEIGRPGSPGRPGFNGLPGN   724
NP_001155871.1     675   PGLPGEKGAVGQPGIGFPGPPGPKGFPGQPGSPGPPGTPGTPGLDGFPGT   724
XP_694040.5        646   PGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGR   695
XP_002933064.2     674   PGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGL   723


NP_001836.2        725   PGVQGQKGEPGVGLPGLKGLPGLPGIPGTPGEKGSIGVPGVPGEHGAIGP   774
XP_003314261.2     826   PGVQGQKGEPGVGLPGLKGLPGLPGIPGTPGEKGSIGVPGVPGEHGAIGP   875
XP_001088660.2     725   PGVQGQKGEPGVGLPGLKGLPGLPGIPGTPGEKGSIGVPGIPGEHGAIGP   774
XP_005634201.1     701   PGVPGQKGEPGIGLPGLKGLPGLPGIPGTPGEKGNIGGPGVPGEHGAIGP   750
NP_001159983.1     725   PGPPGQKGEPGVGLPGLKGLPGIPGIPGTPGEKGNVGGPGIPGEHGAIGP   774
NP_034061.2        725   PGPQGQKGEPGIGLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGP   774
NP_001128481.1     725   PGPQGQKGEPGIGLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGP   774
NP_001155871.1     725   PGLQGQKGEPGVGLPGPKGLPGIPGPAGIPGEKGNPGLPGLRGEQGFPGV   774
XP_694040.5        696   AGTPGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGP   745
XP_002933064.2     724   RGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGV   773


NP_001836.2        775   PGLQGIRGEPGPPGLPGSVGSPGVPGIGPPGARGPPGGQGPPGLSGPPGI   824
XP_003314261.2     876   PGLQGIRGEPGPPGLPGSVGSPGVPGIGPPGARGPPGGQGPPGLSGPPGI   925
XP_001088660.2     775   PGLQGIRGEPGPPGLPGSVGSPGVPGVGPPGARGPPGGQGPPGLSGPPGI   824
XP_005634201.1     751   PGLQGIRGDPGPPGLQGPKGAPGVPGIGPPGAVGPPGGQGPPGSSGPPGV   800
NP_001159983.1     775   PGLQGLRGDPGPPGFQGPKGAPGVPGIGPPGAMGPPGGQGPPGSSGPPGV   824
NP_034061.2        775   PGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGI   824
NP_001128481.1     775   PGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGV   824
NP_001155871.1     775   PGQQGFRGDPGLPGLQGLPGPQGSPGVGPPGLPGPAGQPGPEGPPGFPGI   824
XP_694040.5        746   PGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGI   795
XP_002933064.2     774   PGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGV   823


NP_001836.2        825   KGEKGFPGFPGLDMPGPKGDKGAQGLPGITGQSGLPGLPGQQGAPGIPGF   874
XP_003314261.2     926   KGEKGFPGFPGLDMPGPKGDKGAQGLPGITGQSGLPGLPGQQGAPGIPGF   975
XP_001088660.2     825   KGEKGFPGFPGLDMPGPKGDKGSQGLPGVTGQSGLPGLPGQQGSPGIPGF   874
XP_005634201.1     801   KGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGF   850
NP_001159983.1     825   KGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGQPGI   874
NP_034061.2        825   KGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGF   874
NP_001128481.1     825   KGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGF   874
NP_001155871.1     825   KGERGFPGIPGLDMPGPKGDKGSQGQPGVPGSVGLPGLPGPQGSVGLKGS   874
XP_694040.5        796   KGDKGYQGLPGLDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPGE   845
XP_002933064.2     824   KGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGF   873


NP_001836.2        875   PGSKGEMGVMGTPGQPGSPGPVGAPGLPGEKGDHGFPGSSGPRGDPGLKG   924
XP_003314261.2     976   PGSKGEMGVMGTPGQPGSPGPVGAPGLPGEKGDHGFPGSSGPRGDPGLKG   1025
XP_001088660.2     875   PGSKGEMGVMGTPGQPGSPGPVGVPGLPGEKGDHGFPGSSGPRGDPGLKG   924
XP_005634201.1     851   PGPKGEMGVMGTPGQPGSPGPAGLPGLPGEKGDHGFPGSSGPRGDPGFKG   900
NP_001159983.1     875   PGPKGEMGVMGTPGQPGSPGPAGVPGLPGAKGDHGFPGSSGPRGDPGFKG   924
NP_034061.2        875   PGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKG   924
NP_001128481.1     875   PGSKGEMGVMGTPGQPGSPGPAGAPGLPGEKGDHGFPGSSGPRGDPGFKG   924
NP_001155871.1     875   AGAKGEMGVMGTPGLPGTPGPVGDRGLPGEKGSQGLKGVVGPQGEPGVKG   924
XP_694040.5        846   RGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKG   895
XP_002933064.2     874   PGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKG   923


NP_001836.2        925   DKGDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIGPIGEKGSRGDPGTP   974
XP_003314261.2    1026   DKGDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIGPIGEKGSRGDPGTP   1075
XP_001088660.2     925   DKGDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIGPIGEKGSRGDPGTP   974
XP_005634201.1     901   DKGDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTP   950
NP_001159983.1     925   DKGDVGLPGKPGSMDKVDMGSMKGEKGDQGEKGQTGPTGDKGSRGDPGTP   974
NP_034061.2        925   DKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTP   974
NP_001128481.1     925   DKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTP   974
NP_001155871.1     925   DKGEAGLPGIPGSMDTMDMVSLKGQKGDPGEKGDLGPTGEKGLRGEYGEP   974
XP_694040.5        896   ERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDP   945
XP_002933064.2     924   EKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSP   973


NP_001836.2        975   GVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLPGPKGSVGGMGLPGTPGE   1024
XP_003314261.2    1076   GVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLPGPKGSVGGMGLPGTPGE   1125
XP_001088660.2     975   GVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLPGPKGSVGGMGLPGTPGE   1024
XP_005634201.1     951   GVPGKDGQAGHPGQPGPKGDPGIGGTPGAPGLPGPKGSVGGMGLPGTPGE   1000
NP_001159983.1     975   GVPGKDGQAGHPGQPGPKGDPGVSGIPGAPGLPGPKGSAGGMGLPGMPGP   1024
NP_034061.2        975   GVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGE   1024
NP_001128481.1     975   GVPGKDGQAGHPGQPGPKGDPGLSGIPGSPGLPGPKGSVGGMGLPGSPGE   1024
NP_001155871.1     975   GIPGRDGEPGTPGQPGPKGDQGPPGYPGDPGIPGQKGSVGEMGLPGTPGE   1024
XP_694040.5        946   GMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGP   995
XP_002933064.2     974   GTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGE   1023


NP_001836.2       1025   KGVPGIPGPQGSPGLPGDKGAKGEKGQAGPPGIGIPGLRGEKGDQGIAGF   1074
XP_003314261.2    1126   KGVPGIPGPQGSPGLPGDKGAKGEKGQAGPPGIGIPGLRGEKGDQGIAGF   1175
XP_001088660.2    1025   KGVPGIPGPQGSPGLQGEKGAKGAKGQAGPPGIGIPGLPGEKGDQGIAGF   1074
XP_005634201.1    1001   KGVPGIPGPQGVPGLPGEKGAKGEKGQAGLPGIGIPGRPGDKGEQGISGF   1050
NP_001159983.1    1025   KGVAGIPGPQGIPGLPGDKGAKGEKGQAGLPGIGIPGRPGDKGDQGLAGF   1074
NP_034061.2       1025   KGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGF   1074
NP_001128481.1    1025   KGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGF   1074
NP_001155871.1    1025   KGLPGIPGSPGTPGFPGQKGEKGDKGAAGFPGIGFPGSPGEKGEPGRTGS   1074
XP_694040.5        996   KGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGF   1045
XP_002933064.2    1024   KGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGP   1073


NP_001836.2       1075   PGSPGEKGEKGSIGIPGMPGSPGLKGSPGSVGYPGSPGLPGEKGDKGLPG   1124
XP_003314261.2    1176   PGSPGEKGEKGTIGIPGMPGSPGLKGSPGSVGYPGSPGLPGEKGDKGLPG   1225
XP_001088660.2    1075   PGSPGEKGEKGSIGIPGMPGSPGLKGSPGSVGYPGSPGLPGEKGDKGLPG   1124
XP_005634201.1    1051   PGSPGEKGEKGSAGVPGIPGSPGPKGLPGTVGYPGSPGLPGEKGDKGLPG   1100
NP_001159983.1    1075   PGSPGEKGEKGSTGIPGMPGSPGPKGSPGSVGYPGSPGLPGEKGDKGLPG   1124
NP_034061.2       1075   PGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPG   1124
NP_001128481.1    1075   PGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPG   1124
NP_001155871.1    1075   PGLSGDKGEKGNAGIPGMPGAPGPKGSPGIAGFPGNPGLHGAKGEKGLPG   1124
XP_694040.5       1046   PGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGYPGSPGKPGEKGVGGLPG   1095
XP_002933064.2    1074   HGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHG   1123


NP_001836.2       1125   LDGIPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEPGLPGRG   1174
XP_003314261.2    1226   LDGIPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEPGLPGRG   1275
XP_001088660.2    1125   LDGIPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEPGLPGRG   1174
XP_005634201.1    1101   SDGIPGIKGEAGLPGQPGPTGPAGQKGEPGSDGIPGSVGEKGEPGLPGRG   1150
NP_001159983.1    1125   LDGIPGIKGEAGLPGKPGPTGPAGQKGEPGSDGIPGSVGEKGESGLPGRG   1174
NP_034061.2       1125   LDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRG   1174
NP_001128481.1    1125   LDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGLPGRG   1174
NP_001155871.1    1125   LSGIPGLKGEPGEPGVPGPAGSIGQKGEPGYDGIPGTAGAKGEQGVPGRG   1174
XP_694040.5       1096   SPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRG   1145
XP_002933064.2    1124   LVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRG   1173


NP_001836.2       1175   FPGFPGAKGDKGSKGEVGFPGLAGSPGIPGSKGEQGFMGPPGPQGQPGLP   1224
XP_003314261.2    1276   FPGFPGAKGDKGSKGEVGFPGLAGSPGIPGSKGEQGFMGPPGPQGQPGLP   1325
XP_001088660.2    1175   FPGFPGAKGDK---------------------------------------   1185
XP_005634201.1    1151   FPGFPGAKGEKGSKGDVGFPGQAGSPGIPGSKGEPGFLGPPGPQGQPGLP   1200
NP_001159983.1    1175   FPGFPGSKGDKGSKGDVGFPGLSGSPGIPGSKGEQGFMGPPGPQGQPGLP   1224
NP_034061.2       1175   FPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLP   1224
NP_001128481.1    1175   FPGFPGTKGDKGSKGEVGFPGLAGSPGIPGAKGEQGFMGPPGPQGQPGLP   1224
NP_001155871.1    1175   VPGYPGAKGDKGAKGEVGFPGSPGIPGIPGLKGEQGYAGPPGPKGNQGLP   1224
XP_694040.5       1146   LPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGER   1195
XP_002933064.2    1174   LPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFP   1223


NP_001836.2       1225   GSPGHATEGPKGDRGPQGQPGLPGLPGPMGPPGLPGIDGVKGDKGNPGWP   1274
XP_003314261.2    1326   GSPGHATEGPKGDRGPQGQPGLPGLPGPMGPPGLPGIDGVKGDKGNPGWP   1375
XP_001088660.2    1186   -----------------------GLPGPMGPPGLPGIDGVKGDKGNPGWP   1212
XP_005634201.1    1201   GAPGHAVEGPKGDRGPQGQPGLPGLPGPVGPPGLPGLDGLKGDKGNPGWP   1250
NP_001159983.1    1225   GTPGHAVEGPKGDRGPQGQPGLPGRPGPMGPPGLPGLEGLKGERGNPGWP   1274
NP_034061.2       1225   GTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWP   1274
NP_001128481.1    1225   GTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGIDGPKGDKGNPGWP   1274
NP_001155871.1    1225   GLPGSAIEGPKGDRGPQGQPGLPGLPGPTGPPGPPGLKGAKGEQGSDGWP   1274
XP_694040.5       1196   GLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQ   1245
XP_002933064.2    1224   GPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWP   1273


NP_001836.2       1275   GAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGPPGVPGFQGPKGLPGL   1324
XP_003314261.2    1376   GAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGPPGVPGFQGPKGLPGL   1425
XP_001088660.2    1213   GAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGPPGVPGFQGPKGVPGL   1262
XP_005634201.1    1251   GAPGAPGPKGEPGFQGLPGIGGSPGITGSKGDMGPPGVPGFQGQKGLPGL   1300
NP_001159983.1    1275   GTPGAPGPKGDPGFQGMPGIGGSPGITGAKGDVGPPGVPGFHGQKGAPGL   1324
NP_034061.2       1275   GAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQKGLPGL   1324
NP_001128481.1    1275   GAPGAPGPKGDPGFQGMPGIGGSPGITGSKGDMGPPGVPGFQGQKGLPGL   1324
NP_001155871.1    1275   GTPGGPGDKGDPGFQGLPGSPGLPGGAGEKGDLGPPGVPGVPGPKGSAGF   1324
XP_694040.5       1246   GAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGV   1295
XP_002933064.2    1274   GAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGI   1323


NP_001836.2       1325   QGIKGDQGDQGVPGAKGLPGPPGPPGPYDIIKGEPGLPGPEGPPGLKGLQ   1374
XP_003314261.2    1426   QGIKGDQGDQGIPGAKGLPGPPGPPGPYDIIKGEPGLPGPEGPPGLKGLQ   1475
XP_001088660.2    1263   QGIKGDQGDQGVPGAKGLPGPPGPPGPYDIIKGEPGLPGPEGPAGLKGLQ   1312
XP_005634201.1    1301   QGAKGDQGDQGFPGSKGLPGPPGPPGPYDIVKGDPGLPGPEGPAGLKGLP   1350
NP_001159983.1    1325   QGVKGDQGDQGFPGTKGLPGPPGPPGPFSIIKGEPGLPGPEGPAGLKGLQ   1374
NP_034061.2       1325   QGVKGDQGDQGVPGPKGLQGPPGPPGPYDVIKGEPGLPGPEGPPGLKGLQ   1374
NP_001128481.1    1325   QGVKGDQGDQGIPGPKGLQGPPGPPGPYDVIKGEPGLPGPEGPPGLKGLQ   1374
NP_001155871.1    1325   PGLKGERGDQGLPGSKGLQGPPGPPGAFQLIKGDPGLPGPVGPVGLKGFP   1374
XP_694040.5       1296   IGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQ   1345
XP_002933064.2    1324   SGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQ   1373


NP_001836.2       1375   GLPGPKGQQGVTGLVGIPGPPGIPGFDGAPGQKGEMGPAGPTGPRGFPGP   1424
XP_003314261.2    1476   GLPGPKGQQGVTGLVGIPGPPGIPGFDGAPGQKGEMGPAGPTGPRGFPGP   1525
XP_001088660.2    1313   GPPGPKGQQGVTGLVGIPGPPGIPGFDGAPGQKGEMGPTGPTGPRGFPGP   1362
XP_005634201.1    1351   GPPGPKGQQGVTGSVGLPGPPGIPGFDGAPGQKGETGPFGPPGPRGFPGP   1400
NP_001159983.1    1375   GPPGPKGQQGVTGSVGLPGPPGEPGFDGAPGQKGETGPFGPPGPRGFPGP   1424
NP_034061.2       1375   GPPGPKGQQGVTGSVGLPGPPGVPGFDGAPGQKGETGPFGPPGPRGFPGP   1424
NP_001128481.1    1375   GPPGPKGQQGVTGSVGLPGPPGVPGFDGAPGQKGETGPFGPPGPRGFPGP   1424
NP_001155871.1    1375   GHPGPKGQQGVTGPSGVPGPPGSPGFDGRPGQKGEVGPYGPPGPRGIPGP   1424
XP_694040.5       1346   GFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPGQTGPPGPRGYPGP   1395
XP_002933064.2    1374   GLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGP   1423


NP_001836.2       1425   PGPDGLPGSMGPPGTPSVDHGFLVTRHSQTIDDPQCPSGTKILYHGYSLL   1474
XP_003314261.2    1526   PGPDGLPGSMGPPGTPSVDHGFLVTRHSQTIDDPQCPSGTKILYHGYSLL   1575
XP_001088660.2    1363   PGPDGLPGSMGPPGTPSVDHGFLVTRHSQTIDDPQCPSGTKILYHGYSLL   1412
XP_005634201.1    1401   PGPDGLPGSMGPPGTPSVDHGFLVTRHSQTTDDPQCPPGTKILYHGYSLL   1450
NP_001159983.1    1425   PGPDGLPGSMGPPGTPSVDHGFLVTRHSQTTDDPQCPPGTKILYHGYSLL   1474
NP_034061.2       1425   PGPDGLPGSMGPPGTPSVDHGFLVTRHSQTTDDPLCPPGTKILYHGYSLL   1474
NP_001128481.1    1425   PGPDGLPGSMGPPGTPSVDHGFLVTRHSQTTDDPLCPPGTKILYHGYSLL   1474
NP_001155871.1    1425   PGPEGLPGAMGPPGAASVAHGFLVTRHSQTTEEPQCPFGTRLIYHGYSLL   1474
XP_694040.5       1396   PGPDGIPGHIGPPGPSSMDHGFLVTRHSQTIDVPHCPQGTTPIYDGYSLL   1445
XP_002933064.2    1424   PGSDGLPGPIGLPGSPSMAHGFLVTRHSQTTETPQCPFGTTAVYSGYSLL   1473


NP_001836.2       1475   YVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLS   1524
XP_003314261.2    1576   YVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLS   1625
XP_001088660.2    1413   YVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLS   1462
XP_005634201.1    1451   YVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLS   1500
NP_001159983.1    1475   YVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLS   1524
NP_034061.2       1475   YVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLS   1524
NP_001128481.1    1475   YVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLS   1524
NP_001155871.1    1475   YVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLS   1524
XP_694040.5       1446   YVQGNERSHGQDLGTAGSCLRKFSPMPFLFCNINNVCNFASRNDYSYWLT   1495
XP_002933064.2    1474   YVQGNERAHGQDLGASGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLS   1523


NP_001836.2       1525   TPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGW   1574
XP_003314261.2    1626   TPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGW   1675
XP_001088660.2    1463   TPEPMPMSMAPITGDNIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGW   1512
XP_005634201.1    1501   TPEPMPMSMAPIAGDNIRPFISRCAVCEAPAMVMAVHSQTIQIPQCPSGW   1550
NP_001159983.1    1525   TPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPQCPTGW   1574
NP_034061.2       1525   TPEPMPMSMAPISGDNIRPFISRCAVCEAPAMVMAVHSQTIQIPQCPNGW   1574
NP_001128481.1    1525   TPEPMPMSMAPISGDNIRPFISRCAVCEAPAMVMAVHSQTIQIPQCPNGW   1574
NP_001155871.1    1525   TPEPMPMSMAPITGESIRPFISRCSVCEAPAMVIAVHSQTIQIPPCPEGW   1574
XP_694040.5       1496   TPEPMPMSMAPVTGESIKPFISRCAVCEAPAMVIAVHSQTIQIPNCPDGW   1545
XP_002933064.2    1524   TPEPMPMSMAPITGDGIKPFISRCTVCEVPAMVMAVHSQTIQIPQCPDGW   1573


NP_001836.2       1575   SSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNY   1624
XP_003314261.2    1676   SSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNY   1725
XP_001088660.2    1513   SSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNY   1562
XP_005634201.1    1551   SSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNY   1600
NP_001159983.1    1575   SSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNY   1624
NP_034061.2       1575   SSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNY   1624
NP_001128481.1    1575   SSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNY   1624
NP_001155871.1    1575   SSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNY   1624
XP_694040.5       1546   ASLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNY   1595
XP_002933064.2    1574   ISLWIGYSFVMQTSAGAEGSGQALASPGSCLEEFRSVPFIECHGRGTCNY   1623


NP_001836.2       1625   YANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT-   1669
XP_003314261.2    1726   YANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT-   1770
XP_001088660.2    1563   YANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT-   1607
XP_005634201.1    1601   YANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT-   1645
NP_001159983.1    1625   YANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT-   1669
NP_034061.2       1625   YANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT-   1669
NP_001128481.1    1625   YANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT-   1669
NP_001155871.1    1625   YANAYSFWLATIERNEMFKKPTPSTLKAGDLRSNVSRCQVCMRNT-   1669
XP_694040.5       1596   YANSYSFWLATIEDTDMFTKPVPATLKAGSLRTHISRCQVCMKRV-   1640
XP_002933064.2    1624   YANTYSFWLATIEKNEMFKKPTPSTLKAGDLRTHVSRCQVCMRRTS   1669


Protein Acc. Gene Organism
NP_001836.2 COL4A1 H.sapiens
XP_003314261.2 COL4A1 P.troglodytes
XP_001088660.2 COL4A1 M.mulatta
XP_005634201.1 COL4A1 C.lupus
NP_001159983.1 COL4A1 B.taurus
NP_034061.2 Col4a1 M.musculus
NP_001128481.1 Col4a1 R.norvegicus
NP_001155871.1 COL4A1 G.gallus
XP_694040.5 col4a1 D.rerio
XP_002933064.2 col4a1 X.tropicalis


Support Center