Display Settings:

Format

Send to:

Choose Destination
HomoloGene:18287. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_775954.2          1   ------MAAKSDGG-GVGVGFAQLHNLDEAVGSGGEEDGEPGGGGCGGGG   43
XP_003954568.1           --------------------------------------------------
XP_001089696.2       1   ------MAAKSDGG-GVGVGFAQLHNLDEAVGSGGEEDGEPGGGGCGGGG   43
XP_005635712.1           --------------------------------------------------
NP_001179260.1       1   ------MAAKSDGG-GVGVGFAQLHNLDEAVGSGGEEDGEPGGGGCGGGG   43
NP_775569.2          1   ------MAAKSDGG-GVGVGFAQLHNLDEAVGS-GEEDGEPGGGGC-GGG   41
NP_001012042.1       1   ------MAAKSDGG-GVGVGFAQLHNLDEAVGS-GEEDGEPGGGGC-GGG   41
XP_420037.3              --------------------------------------------------
NP_001012257.1       1   ------MAAKSDGV-GVVTGFAQLHNLDEATGD-----------------   26
NP_001259606.1           --------------------------------------------------
XP_310478.3          1   MSLGSCLTGQSSRG-LLEICFAGRCDLDNNKTN-----------------   32
NP_509427.2              --------------------------------------------------
NP_001029115.1       1   ------MAAKSDGMLGVGSGFAQLHNLDEAVAA-------AAAGERGGGG   37


NP_775954.2         44   DGSEPGESSSMHICHCCNTSS----CYWGCRSACLRSLLGRKPRRS-AAA   88
XP_003954568.1           --------------------------------------------------
XP_001089696.2      44   DGSEPGESSSLHICHCCNTSS----CYWGCRSACLRSLLGKKPRRS-AAA   88
XP_005635712.1           --------------------------------------------------
NP_001179260.1      44   DGSEPGESSSLHICHCCNTSS----CYWGCRSACLRSLLGKKPRRSAAAA   89
NP_775569.2         42   DGSEPGESSSLHICHCCNTSS----CYWGCRSACLRSLLGKKPRRSAAAA   87
NP_001012042.1      42   DGSEPGESSSLHICHCCNTSS----CYWGCRSACLRSLLGKKPRRSAAAA   87
XP_420037.3              --------------------------------------------------
NP_001012257.1      27   --EEPLDSAAIHICHCCNSSS----CYWGCRSACLQPLLGERDRPQHQQQ   70
NP_001259606.1       1   ---------------------------------MASAEQRTEVDALMMGP   17
XP_310478.3         33   -------------CHCARNLSHSLLSFGPFGFSCSSAPTMTPPSVQAEGL   69
NP_509427.2          1   ------------------------------------MFLKKHKSKLLLVP   14
NP_001029115.1      38   EDGEPGESSSIHICHCCNTSS----CYWGCRSACLRSLLGKGKGAGMLGG   83


NP_775954.2         89   DGGDQPLQPPAAPGAGRQPPTPSAARPEPPPPQVERPWLDCLWIVLALLV   138
XP_003954568.1       1   -------------------------------MEVERPWLDCLWIVLALLV   19
XP_001089696.2      89   DGGDQPLQPPAAPGADRQPPTPSAARPEPPPPQVERPWLDCLWIVLALLV   138
XP_005635712.1           --------------------------------------------------
NP_001179260.1      90   DGGDQPLQPPAA--AGRQPPTPSAERLQP--PQVERPWLDCLWIVLALLV   135
NP_775569.2         88   DGGDQPLQPPGA--AGRHPPTPSAGRPQPASPQVERPWLDCLWIVLALLV   135
NP_001012042.1      88   DGGDQPLQPPGA--AGRHPPTPSAGRPQPASPQVERPWLDCLWIVLALLV   135
XP_420037.3          1   -------------------------------MTLKREDL-----------   8
NP_001012257.1      71   HQPE------------------------------ERLWLDCLWIIVALLV   90
NP_001259606.1      18   -----------------------------------ISKLSMLLTVVSILW   32
XP_310478.3         70   RGSETDGAKLTTAVGGRLSYLTRTDE-----PSVDVSRWDILLTAISILF   114
NP_509427.2         15   RDEEQEDAGIVAVLTDRIP------------SVLLVRWFDLFCFGFAMCS   52
NP_001029115.1      84   QAGGKG----------------------------DRAWLDCLWIVLALMV   105


NP_775954.2        139   FFGDVGTDLWLALDYYRKGDYVYFGLTLFFVLVPSLLVQSLSFRWFVQDY   188
XP_003954568.1      20   FFGDVGTDLWLALDYYRKGDYVYFGLTLFFVLVPSLLVQSLSFRWFVQDY   69
XP_001089696.2     139   FFGDVGTDLWLALDYYRKGDYGYFGLTLFFVLVPSLPVQSLSFRWFVQDY   188
XP_005635712.1           --------------------------------------------------
NP_001179260.1     136   FFGDVGTDLWLALDYYRKGDYGYFGLTLFFVLVPSLLVQSLSFRWFVQDY   185
NP_775569.2        136   FFGDVGTDLWLALDYYRKGDYGCFGLTLFFVLVPSLLVQSLSFRWFVQDY   185
NP_001012042.1     136   FFGDVGTDLWLALDYYRKGDYGCFGLTLFFVLVPSLLVQSLSFRWFVQDY   185
XP_420037.3              --------------------------------------------------
NP_001012257.1      91   FFWDVGTDLLLALDYYSKRDYLWFGLTLFFVLVPSVLVQILSFRWFVQDY   140
NP_001259606.1      33   RFVSICINWSLAYVYWMEESYGYCAWTIGSILVPMVVTSVIYIHTL----   78
XP_310478.3        115   RLVSISLTVLLSCEYYRNGRTVYFALTLVGLFVPGIITSLLNLLMYLDD-   163
NP_509427.2         53   YALDFFSDIGIAIFHFWAGRYLSGSLVLAFALLPSVIINIISMVWMLDD-   101
NP_001029115.1     106   FFWDVGTDLWLAADYYSKRDYLCSSLTLGFVLVPSLLVQILSFRWFAQDY   155


NP_775954.2        189   TGGGLGAVEGLTSRGPPMMGAGYVHGAARGGPGVRVSPTPGAQRLCRLSV   238
XP_003954568.1      70   TGGGLGAVEGLTSRGPPMMGAGYVHGAARGGPGVRVSPTPGAQRLCRLSV   119
XP_001089696.2     189   TGGGLGAVEGLSSRGPPMMGAVYG--AARGVPGAGVSATPGAQRLCRLSV   236
XP_005635712.1           --------------------------------------------------
NP_001179260.1     186   TGGGLGAVEGLSSRGPPMMGAGYGH-------GAGPAATPGAQRLCRLSV   228
NP_775569.2        186   TGGGLGAVEGLSSRGPPMMGAGYGHGAARGGPGAGGSATPGAQRLCRLSV   235
NP_001012042.1     186   TGGGLGAVEGLSSRGPPMMGAGYGHGAARGGPGAGGSATPGAQRLCRLSV   235
XP_420037.3          9   --------------------------------GAAGTATPGAQRLCRISV   26
NP_001012257.1     141   TGGGLGAVEGLSRKATADLS----------------SRIYGRDRCCVISI   174
NP_001259606.1      79   -----------------------------------KSAHAGEKRILERGV   93
XP_310478.3        164   ----------------------------------ARRNRRDRQPCCSTLL   179
NP_509427.2        102   ----------------------EMHWKRRAHPRRTGTFELNQKRFIPLSK   129
NP_001029115.1     156   TGGGLGAVEGLSSRGPPMMGSIHHH-------YQRHHPSYTAERFCRISV   198


NP_775954.2        239   WIWQSVIHLLQMGQVWRYIRTMYLGI---QSQRRKE--HQRRFYWAMMYE   283
XP_003954568.1     120   WIWQSVIHLLQMGQVWRYLRAQHLSI---QSEKGKR--LXRKYNWALYYK   164
XP_001089696.2     237   WIWQSVIHLLQMGQVWRYIRTMYLGI---QSQRRKE--HQRRFYWAMMYE   281
XP_005635712.1       1   ---------------------MYLGI---QSQRQKE--HQRRFYWAMMYE   24
NP_001179260.1     229   WIWQSVIHLLQMGQVWRYIRTMYLGI---QSQRQKE--HQRRFYWAMMYE   273
NP_775569.2        236   WIWQSVIHLLQMGQVWRYIRTMYLGI---QSQRQKE--HQRRFYWAMMYE   280
NP_001012042.1     236   WIWQSVIHLLQMGQVWRYIRTMYLGI---QSQRQKE--HQRRFYWAMMYE   280
XP_420037.3         27   WVWQSVIHLLQMGQVWRYIRTMYLGI---QSQRRKE--HQRRFYWAMMYE   71
NP_001012257.1     175   WIWHACVHVLQMGQVWRYIRTMYLGI---QSRRQKE--NQRRFYWAMMYE   219
NP_001259606.1      94   YSNAVISYL------FRDVYVLNYAFKYSLAKERDDKQAEIEYYQKLMTE   137
XP_310478.3        180   ----CVVVVPFCCRYWHSLRLSYACY---RAKHRQDWAAQKRTYELLVQE   222
NP_509427.2        130   MI---VLCICQMGPLFWYYKALYYGWMFRKSSNENTDGEKRKCFSKMVEA   176
NP_001029115.1     199   WLWQSVIHILQMGQVWRYLRTMYLGI---QSQRQKE--HQRRFYWAMMYE   243


NP_775954.2        284   YADVNMLRLLETFLESAPQLVLQLYIMLQ--KNSAET--------LPCVS   323
XP_003954568.1     165   YSDIFLIRLGYGFLETIPQRIVILCLNIS--KPSAKS--------LPCVS   204
XP_001089696.2     282   YADVNMLRLLETFLESAPQLVLQLCIMIQ--KNSAET--------LPCVS   321
XP_005635712.1      25   YADVNMLRLLETFLESAPQLVLQLCIMIQ--KNSAET--------LPCVS   64
NP_001179260.1     274   YADVNMLRLLETFLESAPQLVLQLCIMIQ--KSRAET--------LPCVS   313
NP_775569.2        281   YADVNMLRLLETFLESAPQLVLQLCIMIQ--KNSAET--------LPCVS   320
NP_001012042.1     281   YADVNMLRLLETFLESAPQLVLQLCIMIQ--KNSAET--------LPCVS   320
XP_420037.3         72   YADVNMLRLLETFLESAPQLVLQLCIMIQ--KNRAET--------LPCVS   111
NP_001012257.1     220   YADVNMLRLLETFLESAPQLVLQLCIMIQ--KNRAET--------LQCVS   259
NP_001259606.1     138   ECNVSFVRLFDSFLESAPQKILQLAILLQ--STLEFT-------YYRHIA   178
XP_310478.3        223   DSDVALLRIFECLLEVTLQKILQLTIVLS--TGPVTV--------LQMLS   262
NP_509427.2        177   ERDATLLRFFEAFLESAPQLIIQGSIAASYFQNYYQTGTYPYWLYFQAAS   226
NP_001029115.1     244   YADVNMLRLLETFLESAPQLVLQLCIMIQ--KNRAET--------LPCVS   283


NP_775954.2        324   SVTSLMSLAWVLASYHKLLRDSRDDKKSMSYRGAIIQVFW-------RLF   366
XP_003954568.1     205   SVTSLMSLAWVLASYHKLLRDSRDDKKSMSYRGAIIQVFW-------RLF   247
XP_001089696.2     322   SVTSLMSLAWVLASYHKLLRDSRDDKKSMSYRGAVIQLFW-------RLF   364
XP_005635712.1      65   SVTSLMSLAWVLASYHKLLRDSRDDKKSMSYRGALIHLFW-------RLF   107
NP_001179260.1     314   SVTSLMSLAWVLASYHKLLRDSRDDKKSMSYRGALIHLFW-------RLF   356
NP_775569.2        321   SVTSLMSLAWVLASYHKLLRDSRDDKKSMSYRGALIHLFW-------RLF   363
NP_001012042.1     321   SVTSLMSLAWVLASYHKLLRDSRDDKKSMSYRGALIHLFW-------RLF   363
XP_420037.3        112   SVASLMSLAWVLASYHKLLRDSRDDKKSMSYRGALIHLFW-------RLF   154
NP_001012257.1     260   AVTSLLSLSWVLASYHKLLRDSRDDQKSMSYRGALVHLLW-------RFF   302
NP_001259606.1     179   LIVYFGNIAWCIQAYNHSNRLAQLDKHDIAAKGRFLQFLFLLCLTVIRFY   228
XP_310478.3        263   IVSAMGSIAWCMASHYRCVRFARLDKRHIPWSGTIVHIAW-------QFS   305
NP_509427.2        227   LLLSIISISWSVVVQNRSLRMIRDDKVNIWPHEAVLQFCW-------RFL   269
NP_001029115.1     284   SVASLMSLAWVLASYHKLLRDSRDDKKSMSYRGALIHIFW-------RLF   326


NP_775954.2        367   TISSRVISFALFASIFQLYFGIFVVVHWCAMAFWII-HGGTDFCMSKW-E   414
XP_003954568.1     248   TISSRVISFALFASIFQLYFGIFVVVHWCAMAFWII-HGGTDFCMSKW-E   295
XP_001089696.2     365   TISSRVISFALFASIFQLYFGIFVVVHWCAMAFWII-HGGTDFCMSKW-E   412
XP_005635712.1     108   TISSRVISFALFASIFQLYFGIFVVVHWCAMAFWII-HGGTDFCMSKW-E   155
NP_001179260.1     357   TISSRVISFALFASIFQLYFGIFVVVHWCAMAFWII-HGGTDFCMSKW-E   404
NP_775569.2        364   TISSRVISFALFASIFQLYFGIFVVVHWCAMAFWII-HGGTDFCMSKW-E   411
NP_001012042.1     364   TISSRVISFALFASIFQLYFGIFVVVHWCAMAFWII-HGGTDFCMSKW-E   411
XP_420037.3        155   TISSRVISFALFASIFQLYFGIFVVVHWCAMAFWII-HGGTDFCMSKW-E   202
NP_001012257.1     303   TISSRALSFALFASVFHLYFGIFVVLHWCAMAFWVI-HGGTDFCMSKW-E   350
NP_001259606.1     229   FVVSRTLCIAYVASIFPIETLIICATLACFYGTIVFFVDSPMIAKSRP-M   277
XP_310478.3        306   VTVARVLAIATVASVFPLYTAAACAVHALLMATWVFCYERPRFCGDSIPQ   355
NP_509427.2        270   TILARIITLVALVLIFGINVVPLISVHLLVTLVHVIFLQAIHIDACTHIE   319
NP_001029115.1     327   TISSRVISFALFASIFQLYFGIFVVVHWCIMAFWII-HGGTDFCMSKW-E   374


NP_775954.2        415   EILFNMVVGIVYIFCWFNVKEGRTRYRMFAYYTIVLTENAALTFLW-YFY   463
XP_003954568.1     296   EILFNMVVGIVYIFCWFNVKEGRTRYRMFAYYTIVLTENAALTFLW-YFY   344
XP_001089696.2     413   EILFNMVVGIVYIFCWFNVKEGRTRYRMFAYYTIVLTENAALTFLW-YFY   461
XP_005635712.1     156   EILFNMVVGIVYIFCWFNVKEGRTRYRMFAYYTIVLTENAALTFLW-YFY   204
NP_001179260.1     405   EILFNMVVGIVYIFCWFNVKEGRTRYRMFAYYTIVLTENAALTFLW-YFY   453
NP_775569.2        412   EILFNMVVGIVYIFCWFNVKEGRTRYRMFAYYTIVLTENAALTFLW-YFY   460
NP_001012042.1     412   EILFNMVVGIVYIFCWFNVKEGRTRYRMFAYYTIVLTENAALTFLW-YFY   460
XP_420037.3        203   EILFNMVVGIVYIFCWFNVKEGRTRYRMFAYYTVVLTENAALTLLW-YFY   251
NP_001012257.1     351   EVLFNMVVGVVYVFCWFNVKEGRTRYRMVFYYSLVLVENTILTALW-YAY   399
NP_001259606.1     278   NYSYCLCFGVVYLFIFTPVKDAPTKYKYAFYLTFCLLQNIIACALY----   323
XP_310478.3        356   RALLSCAFGAVFIFNYIPLQEGTTRLRYTFFYAVCFVETVAASALYGTFV   405
NP_509427.2        320   KLLL-LINTFIHIFIPFNMVEGNTRWRYLTAYSVEFIEMMLVCWLL----   364
NP_001029115.1     375   EILFNMVVGIVYIFCWFNVKEGRTRYRMFAYYTVILTENAVLTFLW-YFY   423


NP_775954.2        464   RDPETTDSYAVPAL--CCVFISFVAGIAMMLLYYGVLHPTGPRAKILASS   511
XP_003954568.1     345   RNPETTDSYAVPAL--CCVFISFVAGIAMMLLYYGVLHPTGPRAKILASS   392
XP_001089696.2     462   RDPETTDSYAVPAL--CCVFISFVAGIALMLLYYGVLHPMGPRAKILASS   509
XP_005635712.1     205   RNPETTDSYAVPAL--CCVFISFVAGIALMLLYYGVLHPMGPRAKIFASS   252
NP_001179260.1     454   RNPETTDSYAVPAL--CCVFISFVAGIALMLLYYGVLHPTGPRVKILASS   501
NP_775569.2        461   RNPESTDSYAVPAL--CCVFVSFVAGITLMLLYYGVLHPMGPRAKVFASS   508
NP_001012042.1     461   RNPESTDSYAVPAL--CCVFVSFVAGITLMLLYYGVLHPMGPRAKVFASS   508
XP_420037.3        252   RDPDTTDSYAVPAL--CCVFLSFAAGIALMLLYYGVLHPMGPRAKIFASS   299
NP_001012257.1     400   RDPVSTDSYAASAL--CGVFLCFASGVACMVLYYGVLHPMGPRLRVLASS   447
NP_001259606.1     324   ----------IPLYLATAIIALYIVGIVLLIIYYTYCHPNTVRTYF----   359
XP_310478.3        406   RNPTIRQSVLWTGLLTCFPIATFLVGIGLMLVFYRYCHP-----------   444
NP_509427.2        365   --PLSLNTFPYIEKVQVGVPISFIAGIAIMMMYYQFFHPNRRQLIVT---   409
NP_001029115.1     424   RDP-TTDSFAVPAL--CCVFLCFAAGVAFILLYYGVLHPTGPRAKIFASS   470


NP_775954.2        512   CCAELLWGIPLPPDVEPMAPEIPGYRGTQVTPTRAVT----EQQEDLTAD   557
XP_003954568.1     393   CCAELLWGIPLPPDVEPMAPEIPGYRGTQVTPTRAVT----EQQEDLTAD   438
XP_001089696.2     510   CCAELLWGIPLPPDVEPMEPQIPGYRGTQVTPTRAVT----EQQEDLTAD   555
XP_005635712.1     253   CCAELLWGIPLPPDVEPMAPQTPGYRGTQVTPTRAVT----EQQEDLTAD   298
NP_001179260.1     502   CCAELLWGIPLPPDVEPMAPQTPGYRGTQVTPTRAVT----EQQEDLTAD   547
NP_775569.2        509   CCAELLWGIPLPPDVEPMAPQTPGYRGTQVTPTRAVT----EQQEDLTAD   554
NP_001012042.1     509   CCAELLWGIPLPPDVEPMAPQTPGYRGTQVTPTRAVT----EQQEDLTAD   554
XP_420037.3        300   CCAELLWGIPLPPDVEPMAPQTPGYRGAQATPTRAVT----EQQEELTAD   345
NP_001012257.1     448   CCAELLWGLPLPPEAEPMAP-TPGPRGSQATPTRGMASGDYSEPEEAATD   496
NP_001259606.1           --------------------------------------------------
XP_310478.3              --------------------------------------------------
NP_509427.2        410   -----------------------------------------QSQEDLSLN   418
NP_001029115.1     471   CCAELLWGIPLPPDVEPMAPQTPGYRGAEATPTRATT----EQQDDLTAD   516


NP_775954.2        558   TCLPVFQVRPMGPPTPLGRPYLPEGPLIKIDMPRKRYPAWDAHFVDRRLR   607
XP_003954568.1     439   TCLPVFQVRPMGPPTPLGRPYLPEGPLIKIDMPRKRYPAWDAHFVDRRLR   488
XP_001089696.2     556   TCLPVFQVRPMGPPTPLGRPYLPEGPLIKIDMPRKRYPAWDAHFVDRRLR   605
XP_005635712.1     299   TCLPVFQVRPMVPSTPSGRPYPPEGPLIKIDMPRKRYPAWDAHFVDRRLR   348
NP_001179260.1     548   TCLPVFQVRPMGPSTPTGRPYLPEGPLIKIDMPRKRYPAWDAHFVDRRLR   597
NP_775569.2        555   TCLPVFQVRPMGPSTPSGRPYHPEGPLIKIDMPRKRYPAWDAHFVDRRLR   604
NP_001012042.1     555   TCLPVFQVRPMGPSTPSGRPYHPEGPLIKIDMPRKRYPAWDAHFVDRRLR   604
XP_420037.3        346   TCLPVFQVRAMVPSTPSGRPYPPEGPLIKIDIPRKRYPAWDAHFVDRRLR   395
NP_001012257.1     497   TCLPVFQVRSTEPTDASGRPIPPKGPLIKIDMPRKRYPAWDAHFVDRRLR   546
NP_001259606.1           --------------------------------------------------
XP_310478.3        445   ------------------------------------------NIISRQLQ   452
NP_509427.2        419   VQKSV-------------------------------------ETLTPKLE   431
NP_001029115.1     517   TCLPVFQVRPMVPTTPSGRPYYPEGPLIKIDMPRKRYPAWDAHFVDRRLR   566


NP_775954.2        608   RTINILQYVTPTA-VGIRYRDGPLLYELLQYESSL-   641
XP_003954568.1     489   RTINILQYVTPTA-VGIRYRDGPLLYELLQYESSL-   522
XP_001089696.2     606   RTINILQYITPTSLLGARG-----LFETQMAGAAT-   635
XP_005635712.1     349   RTINILQYVTPTA-VGIRYRDGPLLYELLQYESSL-   382
NP_001179260.1     598   RTINILQYVTPTA-VGIRYRDGPLLYELLQYESSL-   631
NP_775569.2        605   RTINILQYVTPTA-VGIRYRDGPLLYELLQYESSL-   638
NP_001012042.1     605   RTINILQYVTPTA-VGIRYRDGPLLYELLQYESSL-   638
XP_420037.3        396   RTINILQYVTPTA-VGIRYRDGPLLYELLQYESSL-   429
NP_001012257.1     547   RTINILQFISPNA-VGIRYRDGPLLYELLQYESSL-   580
NP_001259606.1           ------------------------------------
XP_310478.3        453   SR-------TAAA-------------------AAE-   461
NP_509427.2        432   SSLEI---------SGEQNTSQDLVSELLLDVEHEN   458
NP_001029115.1     567   RTINILQYITPSA-VGIRYRDGPLLYELLQYESSL-   600


Protein Acc. Gene Organism
NP_775954.2 XKR6 H.sapiens
XP_003954568.1 XKR6 P.troglodytes
XP_001089696.2 XKR6 M.mulatta
XP_005635712.1 XKR6 C.lupus
NP_001179260.1 XKR6 B.taurus
NP_775569.2 Xkr6 M.musculus
NP_001012042.1 Xkr6 R.norvegicus
XP_420037.3 XKR6 G.gallus
NP_001012257.1 xkr6 D.rerio
NP_001259606.1 CG32579 D.melanogaster
XP_310478.3 AgaP_AGAP000599 A.gambiae
NP_509427.2 ced-8 C.elegans
NP_001029115.1 xkr6 X.tropicalis


Support Center