Display Settings:

Format

Send to:

Choose Destination
HomoloGene:14202. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_444253.3          1   ------------MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILP   38
XP_003950224.1       1   ------------MG-IAL------------------------RGPAQILD   13
XP_001113525.1       1   ------------MGDVKLVASSHISKTSLSVDPSRVGSMPLTEAPAFILP   38
XP_005639631.1       1   -MGELPGEEATTMGDVKLAALTQASKTSVSVDHSRAGSAPPTEAPAFILP   49
NP_647461.3          1   MSGQLPGKT---MGDVKLFASSHMSKTSHSVDPSKVSSMPLTEAPAFILP   47
NP_001099344.2       1   MPGQLPGKT---MGDVKLFASSHMSKTSHSVDPSRVSSLPLTEAPAFILP   47
NP_990790.1          1   ------------MGDVKLVTSTRVSKTSLTLSPS-----VPAEAPAFTLP   33
XP_002662355.2           --------------------------------------------------
XP_002935598.2           --------------------------------------------------


NP_444253.3         39   PRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGT   88
XP_003950224.1      14   P-------------------------------------------------   14
XP_001113525.1      39   PRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGT   88
XP_005639631.1      50   PRNLCIREGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGT   99
NP_647461.3         48   PRNLCVKEGATAKFEGRVRGYPEPQVTWHRKGQAITNGGRFLLDCGVRGT   97
NP_001099344.2      48   PRNLCVKEGATAKFEGRVRGHPEPQVTWHRNGQTITNGGRFLLDGGVRGT   97
NP_990790.1         34   PRNIRVQLGATARFEGKVRGYPEPQITWYRNGHPLPEGDHYVVDHSIRGI   83
XP_002662355.2           --------------------------------------------------
XP_002935598.2           --------------------------------------------------


NP_444253.3         89   FSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSK   138
XP_003950224.1           --------------------------------------------------
XP_001113525.1      89   FSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSK   138
XP_005639631.1     100   FSLVIHAVREEDQGKYTCEATNDGGARQVTVELTVEGGFMKKHGQPVVSK   149
NP_647461.3         98   FSLVIHTVREEDKGKYTCEASNGSGARQVTVELTVEGNSMKKRDQPVLSK   147
NP_001099344.2      98   FSLVIRGVREEDKGKYTCEASNGSGARQVTVELTVEGDLMKKHGQPVLSK   147
NP_990790.1         84   FSLVIKGVQEGDSGKYTCEAANDGGVRQVTVELTVEGNSLKKYSLPSSAK   133
XP_002662355.2           --------------------------------------------------
XP_002935598.2           --------------------------------------------------


NP_444253.3        139   TLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRP   188
XP_003950224.1      15   ----------------------------------PENQMG----------   20
XP_001113525.1     139   TLGDRFSASAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRP   188
XP_005639631.1     150   TLG--FAAPAVETRPSIWGECPPKFATKLGRAVVKEGQTGRFSCKITGRP   197
NP_647461.3        148   ASG--FPG---ETRPSIWGECPPKFATKLGRAVVKEGQMGRFSCKITGRP   192
NP_001099344.2     148   ASG--FPG---ETRPSIWGECPPKFATKLGRAVVKEGQMGRFSCKITGRP   192
NP_990790.1        134   TPGGRLSVPPVEHRPSIWGESPPKFATKPNRVVVREGQTGRFSCKITGRP   183
XP_002662355.2           --------------------------------------------------
XP_002935598.2           --------------------------------------------------


NP_444253.3        189   QPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNG   238
XP_003950224.1           --------------------------------------------------
XP_001113525.1     189   QPQVTWLKGNVPLQPSARVSMSEKNGMQVLEIHGVNQDDMGVYTCLVVNG   238
XP_005639631.1     198   QPQVTWLKGDVALQPSARVSMSEKNGVQVLEIHEVSRDDVGVYTCMVVNG   247
NP_647461.3        193   PPQVTWLKGNVPLQPSARVSMSEKNGMQILEIRGVTRDDLGVYTCMVVNG   242
NP_001099344.2     193   PPQVTWLKGNVPLQPSARVSMSEKNGMQILEIHEVTQDDMGTYTCMVVNG   242
NP_990790.1        184   QPQVTWTKGDIHLQQNERFNMFEKTGIQYLEIQNVQLADAGIYTCTVVNS   233
XP_002662355.2           --------------------------------------------------
XP_002935598.2           --------------------------------------------------


NP_444253.3        239   SGKASMSAELSIQGLDSANRSF--VRETKAT---------NSDVRKEVTN   277
XP_003950224.1           --------------------------------------------------
XP_001113525.1     239   SGKASMSAELSIQGLDSANRSF--GRETKAT---------NSYVRREVTN   277
XP_005639631.1     248   SGKASMSAELSIQGLDNTSRYVXALSLTKVA---------NSDIRKEVTN   288
NP_647461.3        243   SGKASMSAELSIPGLDNAARLA--VRGTKAP---------SPDIRKEVTN   281
NP_001099344.2     243   SGKASMSAELSIPGLDNATRLS---RGTKDP---------SPDIRKEVTN   280
NP_990790.1        234   AGKASVSAELTVQGPDKTDTHAQPLCMPPKPTTLATKAIENSDFKQATSN   283
XP_002662355.2       1   ----------------------------------------MTDFRAAL--   8
XP_002935598.2           --------------------------------------------------


NP_444253.3        278   VISKESKLDSLEAAAKSKNCSSPQRGGS-PPWAANSQPQPPRESKLESCK   326
XP_003950224.1           --------------------------------------------------
XP_001113525.1     278   VISKELKLNSLEAAAESKNCCSPQRGGS-PAWAANSQPQPPRESKLESCK   326
XP_005639631.1     289   GTTQGPKLDHLESAAERWPCSSTQIGGS-PTWATSSQPQPLRESKLEPPG   337
NP_647461.3        282   GVSKDP-----ETVAESKNCPSPQRSGS-SARATNSHLKSPQEPKPKLCE   325
NP_001099344.2     281   GISKDP-----ETVAESKNCSSPQKSNF-LAQATNSHLKSLQQPKLKPCE   324
NP_990790.1        284   GIAKELKSTSTELMVETKDRLSAKKETFYTSREAKDGKQGQNQEANAVPL   333
XP_002662355.2           --------------------------------------------------
XP_002935598.2           --------------------------------------------------


NP_444253.3        327   DSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAP   376
XP_003950224.1      21   ---------------------------------------PSGDGPK----   27
XP_001113525.1     327   DSPRTAPQTPVLQTTSSSITLQAARVQLEPRAPGLGALSPSGEERKRPAA   376
XP_005639631.1     338   DPPRKALRSPVLQKTSSTITLQAAKVQPEPRAPVSSALSSPGEERERPAA   387
NP_647461.3        326   DAPRKVPQSSILQKSTSTITLQALKVQPEARVPAIGSFSP-GEDRKSLAA   374
NP_001099344.2     325   DSPRKVLQSSVLQKTSSTIVLQASKVQPEVRAAGIGASGP-GEERKSLTA   373
NP_990790.1        334   QESRGTKGPQVLQKTSSTITLQAVKAQPEPKAEPQTTFIRQAEDRKRTVQ   383
XP_002662355.2           --------------------------------------------------
XP_002935598.2           --------------------------------------------------


NP_444253.3        377   PRPATFPTRQPGLGSQ------DVVSKAANRRIPMEGQRDS--AFPKFES   418
XP_003950224.1           --------------------------------------------------
XP_001113525.1     377   PRPATFPTRQPGLGNQ------DVVSKAATRIIPMEGQKDS--ALPKFES   418
XP_005639631.1     388   PPTATFPARQSGLGSQ------EVVNKVATRKIPMESQRDS--TFPKFES   429
NP_647461.3        375   PQQATLPTRQSSLGG-------SVGNKFVTGNIPRESQRES--TFPRFES   415
NP_001099344.2     374   PRQATPPTRQCGLGG-------SVGNKFITGNIPIENQRES--RFPKFES   414
NP_990790.1        384   PLMTTTTQENPSLTGQVSPRSRETENRAGVRKSVKEEKREPLGIPPQFES   433
XP_002662355.2           --------------------------------------------------
XP_002935598.2           --------------------------------------------------


NP_444253.3        419   KPQSQEVKENQTVKFRCEVSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAG   468
XP_003950224.1           --------------------------------------------------
XP_001113525.1     419   KPQSQEVRENQTVKFRCEVSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAG   468
XP_005639631.1     430   KPQSQEVSEDETVKFRCEVSGTPKPEVTWFLEGAPVKRREGMVEVYEEGG   479
NP_647461.3        416   QPQSQEVTEGQTVKFICEVSGIPKPDVGWFLEGIPVRRREGITEVYEDGV   465
NP_001099344.2     415   QPQSQEVTEGQTVKFTCEVSGIPKPEVGWFLEGIPVRRQEGIVEIYEDGT   464
NP_990790.1        434   RPQSLEASEGQEIKFKSKVSGKPKPDVEWFKEGVPIKTGEG-IQIYEEDG   482
XP_002662355.2           --------------------------------------------------
XP_002935598.2           --------------------------------------------------


NP_444253.3        469   SHYLCLLKARTRDSGTYSCTASNAQGQLSCSWTLQVERLAVMEVAPSFSS   518
XP_003950224.1      28   ----------------------------------EMETL-VLSFLPSL--   40
XP_001113525.1     469   SHYLCLLRARTRDSGTYSCTASNARGQVSCSWTLQVERLAVMEVAPSFSS   518
XP_005639631.1     480   CHYLCLLRVRAKDSGSYSCTASNVRGQVSCGWTLLVKRLAVMEVAPSFSS   529
NP_647461.3        466   SHHLCLLRARTRDSGRYSCTASNSLGQVSCSWSLLVDRPNLAQTAPSFSS   515
NP_001099344.2     465   SHYLCLPRAGTRDSGRYSCTASNTLGQVSCSWTLRVDRPSLTQTAPSFSS   514
NP_990790.1        483   THCLWLKKACLGDSGSYSCAAFNPRGQTSTSWLLTVKRPKVEEVAPCFSS   532
XP_002662355.2           --------------------------------------------------
XP_002935598.2           --------------------------------------------------


NP_444253.3        519   VLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGVAEL   568
XP_003950224.1           --------------------------------------------------
XP_001113525.1     519   VLKDCTVIEGQDFVLQCSVRGTPVPQITWLLNGQPIQYAHSTCEAGVAEL   568
XP_005639631.1     530   VLKDCAVIEGQDFVLQCSVQGTPVPQITWLLNEQPIQYAHSSCEAGVAEL   579
NP_647461.3        516   VLKDSVVIEGQDFVLRCSVQGTPAPRVTWLLNGQPIQFAHSICEAGVAEL   565
NP_001099344.2     515   VLKDSVVIEGQDFVLRCSVRGTPAPQVTWLLNGQPIQFARSICEAGEAEL   564
NP_990790.1        533   VLKGCTVSEGQDFVLQCYVGGVPVPEITWLLNEQPIQYAHSTFEAGVAKL   582
XP_002662355.2           --------------------------------------------------
XP_002935598.2           --------------------------------------------------


NP_444253.3        569   HIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPS   618
XP_003950224.1           --------------------------------------------------
XP_001113525.1     569   HIQDALPEDHGTYTCLAENALGQVSCSARVTVHEKKSSGKSEYLLPVAPS   618
XP_005639631.1     580   HIQDALPEDDGIYTCLAKNTLGQVSCSARVTVHEKKSDRKSGYLLRTAPG   629
NP_647461.3        566   HIQDALPEDRGTYTCLAENAMGQVSCSATVTVQEKKGEGEREHRLSPARS   615
NP_001099344.2     565   HIQDALPEDRGTYTCLAENALGQVSCSATVTVQEKKGEGERAHRLPPAPS   614
NP_990790.1        583   TVQDALPEDDGIYTCLAENNAGRASCSAQVTVKEKKSSKKAEGTQAAKLN   632
XP_002662355.2           --------------------------------------------------
XP_002935598.2           --------------------------------------------------


NP_444253.3        619   KPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESED   668
XP_003950224.1      41   -----------------------------GNPPPEVIWLHNGNEIQESED   61
XP_001113525.1     619   KPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESED   668
XP_005639631.1     630   KPVAPLFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESED   679
NP_647461.3        616   KPIAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHDGNEIQESED   665
NP_001099344.2     615   KLFAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHDGNEIQESED   664
NP_990790.1        633   KTFAPIFLKGLTDLKVMDGSQVIMTVEVSANPCPEIIWLHNGKEIQETED   682
XP_002662355.2           --------------------------------------------------
XP_002935598.2           --------------------------------------------------


NP_444253.3        669   FHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDG   718
XP_003950224.1      62   FHFEQRGTQHSLCIQEVFPEDTGTYICEAWNSAGEVRTQAVLTVQEPHDG   111
XP_001113525.1     669   FHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDG   718
XP_005639631.1     680   FHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLMVQEPQDG   729
NP_647461.3        666   FHFEQKGGWHSLCIQEVFPEDTGTYTCEAWNSAGEVRTRAVLTVQEPHDG   715
NP_001099344.2     665   FHFEQKGGWHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAILTVQEPHDG   714
NP_990790.1        683   FHFEKKGNEYSLYIQEVFPEDTGKYTCEAWNELGETQTQATLTVQEPQDG   732
XP_002662355.2       9   ---------------------------------------------KPSSG   13
XP_002935598.2           --------------------------------------------------


NP_444253.3        719   TQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHF   768
XP_003950224.1     112   TQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHF   161
XP_001113525.1     719   TQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALSKDTGHY   768
XP_005639631.1     730   TQPWFISKPRSLTASLGQTVLISCAIAGDPFPTVHWLRDGKALSKDSGHF   779
NP_647461.3        716   TQPWFISKPRSVTATLGQSVLISCAIAGDPFPTVHWLRDGRALSKDSGHF   765
NP_001099344.2     715   TQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALSRDHGHF   764
NP_990790.1        733   IQPWFISKPRSVTAAAGQNVLISCAIAGDPFPTVHWFKDGQEITPGTGC-   781
XP_002662355.2      14   PKP-----------------------------------------------   16
XP_002935598.2           --------------------------------------------------


NP_444253.3        769   EVLQNEDVFTLVLKKVQPWHAGQYEILLKNR-------------------   799
XP_003950224.1     162   EVLQNEDVFTLVLKKVQPWHAGQYEILLNSPNLGLGSQKKHKLMWGLDFQ   211
XP_001113525.1     769   EVLQNEDVFTLVLKKVQPWHAGRYEILLKNR-------------------   799
XP_005639631.1     780   EVLQNEDVFTLVLKNVQPWHAGQYEIQLKNR-------------------   810
NP_647461.3        766   ELLQNEDVFTLVLKNVQPWHAGQYEILLKNR-------------------   796
NP_001099344.2     765   ELLQNEDVFTLVLKNVQPWHAGQYEILLKNR-------------------   795
NP_990790.1        782   EILQNEDIFTLILRNVQSRHAGQYEIQLRNQ-------------------   812
XP_002662355.2           --------------------------------------------------
XP_002935598.2           --------------------------------------------------


NP_444253.3        800   -------------VGECSCQ------------VSLMLQNSSARA-LP---   820
XP_003950224.1     212   EPGWRMQLPGVTDATEQPCQSPSTATEVITDVINQLSKRAPLTN-VPIYK   260
XP_001113525.1     800   -------------VGECSCQ------------VSLMLQNSPAGA-LP---   820
XP_005639631.1     811   -------------VGECSCQ------------VSLMLQSSPTGA-PL---   831
NP_647461.3        797   -------------VGECSCQ------------VSLMLHNSPSRA-PP---   817
NP_001099344.2     796   -------------VGECSCQ------------VSLMLHKGPSRVPPP---   817
NP_990790.1        813   -------------VGECSCQ------------VSLMLRESSASRAEMLR-   836
XP_002662355.2           --------------------------------------------------
XP_002935598.2           --------------------------------------------------


NP_444253.3        821   ----------------------------------------------RGRE   824
XP_003950224.1     261   HSLAGLPHPLPLPSTLPPSGICSPLTFLSYPAPFPPATFLFPFTGCRGRE   310
XP_001113525.1     821   ----------------------------------------------RGRE   824
XP_005639631.1     832   ----------------------------------------------RGRE   835
NP_647461.3        818   ----------------------------------------------RGRE   821
NP_001099344.2     818   ----------------------------------------------RGRE   821
NP_990790.1        837   ----------------------------------------------DGRE   840
XP_002662355.2      17   -----------------------------------------------GSE   19
XP_002935598.2           --------------------------------------------------


NP_444253.3        825   PASCEDLC-GGGVGADGGGSDRYGSLRPGWPARGQGWLEEE-DGEDVRGV   872
XP_003950224.1     311   PASCEDLC-GGGVGADGGGSDHYGSLRPGWPARGQGWPQEE-DGEDVRGV   358
XP_001113525.1     825   PASCEGLC-GGGVGADGGGSDRYGTLRPGWPARGQGWPEEE-DGEDVRGV   872
XP_005639631.1     836   PASCEGLC-SRGAGADGGGGDCYGTLRPGRPARGQGWPEEEDDGEDVRGV   884
NP_647461.3        822   PASCEGLCGGGGVGAHGDG-DRHGTLRPCWPARGQGWPEEE-DGEDVRGL   869
NP_001099344.2     822   PASCEGLC-GGGVGAHGDA-DRDGTLRPCWPARGQGWPEEE-DGEDVRGL   868
NP_990790.1        841   SASSGERRDGGNYGALTFG-RTSGFKKSSSETRA----AEE-EQEDVRGV   884
XP_002662355.2           --------------------------------------------------
XP_002935598.2           --------------------------------------------------


NP_444253.3        873   LKRRVETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKTLSEDDLKEIPAEQ   922
XP_003950224.1     359   LKRRVETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKTLSEDDLKEIPAEQ   408
XP_001113525.1     873   LKRRVETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKTLSEDDLKEIPAEQ   922
XP_005639631.1     885   LKRRVETRQHTEEAIRQQQVEQLDFRDLLGKKVSTKTVSEEDLKEIPAEQ   934
NP_647461.3        870   LKRRVETRLHTEEAIRQQEVGQLDFRDLLGKKVSTKTVSEDDLKDIPAEQ   919
NP_001099344.2     869   LKRRVETRLHTEEAIRQQEVGQLDFRDLLGKKVSTKTVSEDDLKDIPAEQ   918
NP_990790.1        885   LKRRVETREHTEESLRQQEAEQLDFRDILGKKVSTKSFSEEDLKEIPAEQ   934
XP_002662355.2      20   --------------IKTSTPAKVDFRSLLNKKDGS---SKAPVATTPPSR   52
XP_002935598.2           --------------------------------------------------


NP_444253.3        923   --MDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPEK   970
XP_003950224.1     409   --MDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPEK   456
XP_001113525.1     923   --MDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTPKTPVPEK   970
XP_005639631.1     935   --MDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTPKTPVPEK   982
NP_647461.3        920   --MDFRANLQRQVKPKTISEEERKVHSPQQVDFRSVLAKKGTPKTPVPEK   967
NP_001099344.2     919   --MDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTPKTPVPEK   966
NP_990790.1        935   --MDFRANLQRQVKPKTLSEEERKVHAPQQVDFRSVLAKKGTPKTPLPEK   982
XP_002662355.2      53   GPSDFRSVLSKKQAAESVKTEEKEQNS-----------TKPAPKTPQKEK   91
XP_002935598.2       1   --MSYTSTLRIQLDKPLLRDTDRGDSC-----------------------   25


NP_444253.3        971   VPPPKPATPDFRSVLGGKKKLPAENGSSSA---ETLNAKAVESSKPLSNA   1017
XP_003950224.1     457   VPPPKPATPDFRSVLGGKKKLPAENGSSSA---ETLNAKAVESSKPLSNA   503
XP_001113525.1     971   VPPPKPATPDFRSVLGGKKKLPAENGSSSA---ETLNAKAVESSKPLSNA   1017
XP_005639631.1     983   APLPKPATPDFRSVLGSKKKLPAENGSNNA---EALNAKAAESPKAVSNA   1029
NP_647461.3        968   APP-KAATPDFRSVLGGKKKSPSENGGNSA---EVLNVKAGESPTPAGDA   1013
NP_001099344.2     967   VPPQKAATPDFRSVLGSKKKSPAENGGNTA---EVLNVKAGESPTPAGNA   1013
NP_990790.1        983   VPPPKPAVTDFRSVLGAKKKPPAENGSAST---PAPNARAGSE-------   1022
XP_002662355.2      92   ----QSGVNGVNGGAVDKKSTLKENTTTTT---EKKDSKTDAGT------   128
XP_002935598.2      26   ---------------------QTENGTGSPYYKERLSAKEGEDEKS----   50


NP_444253.3       1018   QPSGPLKP------------VGNAKPAETL----KPMGNAKPAETLKPMG   1051
XP_003950224.1     504   QPSGPLKP------------VGNAKPAETL----KPMGNAKPAETLKPMG   537
XP_001113525.1    1018   QPSGPLKP------------MGNAKPAETL----KPMGNAKPAETLKPMG   1051
XP_005639631.1    1030   QPLGSLKP------------LGNAKPAETLKPTPKPMGNAKPAETLKPLG   1067
NP_647461.3       1014   QAIGALKP------------VGNAKPAETP----KPIGNAKPTETLKPVG   1047
NP_001099344.2    1014   QPVGALKPIGNAKPAETLKSVGNAKPAETL----KPVGNAKPAETLKPVG   1059
NP_990790.1       1023   --------------------AQNATPNSEA--------------------   1032
XP_002662355.2     129   --------------------IGKKEKSSPE--------------------   138
XP_002935598.2      51   --------------------IGESKQPGAL--------------------   60


NP_444253.3       1052   NAKPDEN------------------------------------LKSASKE   1065
XP_003950224.1     538   NAKPDEN------------------------------------LKSASKE   551
XP_001113525.1    1052   NTKPAET------------------------------------LKSASKE   1065
XP_005639631.1    1068   NAKPAETLKPISNAKPAEPLKPVGNAKPAETPKPIGNAKPAEILKPAGKE   1117
NP_647461.3       1048   NTKPAETLKPIANAQPSGSLKPVTNAQPAEPQKPVGNAKSAETSKPAGKE   1097
NP_001099344.2    1060   NVKPAETLKPIANAQPSGSPKPIANAQPIETQKSVANAKSAETPKLAGKE   1109
NP_990790.1       1033   ---------------------------------------------PAPKP   1037
XP_002662355.2     139   --------------------------------------------KKTSDG   144
XP_002935598.2           --------------------------------------------------


NP_444253.3       1066   ELKKDVKNDVNCKRGHA--------------GTTDNEKRSESQGTAPAFK   1101
XP_003950224.1     552   ELKKDVKNDVNCKRGHA--------------GTTDNEKRSESQGTAPAFK   587
XP_001113525.1    1066   ELKKDVKNDVNCKRGHA--------------GTTDNEKRSESQGTAPVFK   1101
XP_005639631.1    1118   ELKKEVKNDVNCKRAQA--------------GATDNEKRSENQGTAPAFK   1153
NP_647461.3       1098   EV-KEVKNDVNCKKGQV--------------GATGNEKRPESQGSAPVFK   1132
NP_001099344.2    1110   EL-KEVRNDVNCKKAHV--------------GATGNEKRPESQGSAPVFK   1144
NP_990790.1       1038   VVKKEEKNDRKCEHGCAVVDGGIIGKKAENKPAASKPTPPPSKGTAPSFT   1087
XP_002662355.2     145   QI--TESNDKKVVNGGE-----------------------KDAGKPPVFK   169
XP_002935598.2      61   -HVQTVRKEGRCAAGTQ---------------------------------   76


NP_444253.3       1102   QKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGS   1151
XP_003950224.1     588   QKLQDVHVAEGKKLLLQCQVSSDPPATITWTLNGKTLKTTKFIILSQEGS   637
XP_001113525.1    1102   EKLQDVRVAEGEKLLLQCQVSSDPPATVTWTLNGKTLKTTKFIVLSQEGS   1151
XP_005639631.1    1154   EKLQDVHVTEGEKLLLQCQVSSDPPATITWMLNGKTLKTTKFIILSQEGS   1203
NP_647461.3       1133   EKLQDVHVAEGEKLLLQCQVISDPPATVTWSLNGKTLKTTKFIVLAQEGS   1182
NP_001099344.2    1145   EKLQDVHVAEGEKLLLQCQVTSDPPATVTWTLNGKTLKTTKFIILAQEGS   1194
NP_990790.1       1088   EKLQDAKVADGEKLVLQCRISSDPPASVSWTLDSKAIKSSKSIVISQEGT   1137
XP_002662355.2     170   QPLSDITVVDGERLRLECQVTSDLQAAITWILDGKTVKPSKFIVLSHEGE   219
XP_002935598.2      77   --TERRKVTSVEMFSSRAVTTSDRFLTLILELS------------PQNGS   112


NP_444253.3       1152   LCSVSIEKALPEDRGL--YKCVAKNDAGQAECSCQVTVDDAPASENTKAP   1199
XP_003950224.1     638   LCSVSIEKALPEDRGL--YKCVAKNDAGQAECSCQVTVDDAPASENTKAP   685
XP_001113525.1    1152   LCSVSIEKALPEDRGL--YKCVAKNDAGQAECSCQVTVDDAPASENTKAP   1199
XP_005639631.1    1204   LCSVSIEKALPEDRGF--YKCIAKNGAGQAECSCQVTVDDAPTKENAKAP   1251
NP_647461.3       1183   RFSVSIEKALPEDRGL--YKCVAKNSAGQAECSCQVTVDDAQTSENTKAP   1230
NP_001099344.2    1195   LFSVSIEKALPEDRGL--YKCVAKNSAGQAECSCQVTVDDAGTSENTKAP   1242
NP_990790.1       1138   LCSLTIEKVMPEDGGE--YKCIAENAAGKAECACKVLVEDTSSTKAAKPA   1185
XP_002662355.2     220   KCSLTIDKALPEDEGR--YTCRAENAHGKAECSCVVTVDDPSDP----SA   263
XP_002935598.2     113   --GLYVRRVLRPDTTLTVLSTARENKTPMREESTHVGKTNPMPLSATTVP   160


NP_444253.3       1200   EMKSRRPKSSLPPVLGTE-SDATVKKKPAPKTPPKAAMPPQIIQFPEDQK   1248
XP_003950224.1     686   EMKSRRPKSSLPPVLGTE-SDATVKKKPAPKTPPKAAMPPQIIQFPEDQK   734
XP_001113525.1    1200   EMKSRRPKSSLPPVLGTE-SDATVKKKPAPKTPPKAAMPPQIIQFPEDQK   1248
XP_005639631.1    1252   EMKARRPKSSLPPMLGTE-SDATVKKKPAPKTPPKAAMPPQIIQFPEDQK   1300
NP_647461.3       1231   EMKSRRPKSSLPPVLGTE-SDATVKKKPAPKTPTKAAMPPQIIQFPEDQK   1279
NP_001099344.2    1243   EMKSRRPKSSLTPVLGTE-SDATVKKKPASKTPTKAAMPPQIIQFPEDQK   1291
NP_990790.1       1186   EKKTKKPKTTLPPVLSTESSEATVKKKPAPKTPPKAATPPQITQFPEDRK   1235
XP_002662355.2     264   DKKNRKSSSATP---TTE-NEARIKKKPA---PTKQGSPPQFLHFPGDQK   306
XP_002935598.2     161   KESSSTQPSAPPSRFESPSTSITHGPVSPKRKPNKTGDSLKIVDGVDQIK   210


NP_444253.3       1249   VRAGESVELFGKVTGTQPITCTWMKFRKQIQE-SEHMKVENSENGSKLTI   1297
XP_003950224.1     735   VRAGESVELFGKVTGTQPITCTWMKFRKQIQE-SEHMKVENSENGSKLTI   783
XP_001113525.1    1249   VRAGESVELFGKVTGTQPITCTWMKFRKQIQE-SEHMKVENSENGSKLTI   1297
XP_005639631.1    1301   VRAGESVELFGKVAGTQPITCTWMKFRKQIQE-SEHIKVETSENGSRLTI   1349
NP_647461.3       1280   VRAGEPVELFGKVAGTQPITCKWMKFRKQIQE-SEHIKVENGESGSKLTI   1328
NP_001099344.2    1292   VRAGEPVELFGKVTGTQPITCTWMKFRKQIQE-SENIRVENSESGSKLTI   1340
NP_990790.1       1236   VRAGESVELFAKVVGTAPITCTWMKFRKQIQE-NEYIKIENAENSSKLTI   1284
XP_002662355.2     307   IRAGEKVELLGNFGGSPPITCTWLKFKKPIQPGNGGISIETTENSSQLTI   356
XP_002935598.2     211   ARVGDKVELHCGIRGTTPIAATWLRNKKQVTE-GPRISVHTSDMESRLVI   259


NP_444253.3       1298   LAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSS   1347
XP_003950224.1     784   LAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSS   833
XP_001113525.1    1298   LAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSS   1347
XP_005639631.1    1350   VAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSS   1399
NP_647461.3       1329   LAARQEHCGCYTLVVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSS   1378
NP_001099344.2    1341   LAARQEHCGCYTLVVENKLSSRQAQVNLTVVDKPDPPAGTPCASDIRSSS   1390
NP_990790.1       1285   SSTKQEHCGCYTLVVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSS   1334
XP_002662355.2     357   AASDQDHCGCYTLELQNKFGLKQASLNLTIVDKPDPPAGIPAASDIRRSS   406
XP_002935598.2     260   DQVCEDDSGCYTLYVQDRTGNVQHHTSLTVVEHPSPPSGKPLVSATQPSS   309


NP_444253.3       1348   LTLSWYGSSYDGGSAVQSYSIEIW--DSANKTWKELA-TCRSTSFNVQD-   1393
XP_003950224.1     834   LTLSWYGSSYDGGSAVQSYSIEIW--DSANKTWKELA-TCRSTSFNVQD-   879
XP_001113525.1    1348   LTLSWYGSSYDGGSAVQSYSIEIW--DSANKTWKELA-TCRSTSFNVQD-   1393
XP_005639631.1    1400   LTLSWYGSSYDGGSAVQSYSVEIW--DSVDKTWKELA-TCRSTSFNVQD-   1445
NP_647461.3       1379   LTLSWYGSSYDGGSAVQSYNVEIW--DTEDKVWKELA-TCRSTSFNVQD-   1424
NP_001099344.2    1391   LTLSWYGSSYDGGSAVQSYNVEIW--DTEDKVWTELA-TCRSTSFNVQD-   1436
NP_990790.1       1335   LTLSWYGSSYDGGSAVQSYTVEIW--NSVDNKWTDLT-TCRSTSFNVQD-   1380
XP_002662355.2     407   LTLSWYGPTYDGGSIVQSYNLEIW--NSVDNTWNDLT-SCNSTSFHVQN-   452
XP_002935598.2     310   LTLSWSGPCYDGGSAVVSYWIEMKCTKKEEDGWKLLTDSCVNTSYRVEEG   359


NP_444253.3       1394   LLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEE--PKDEVEVSDDD   1441
XP_003950224.1     880   LLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEE--PKDEVEVSDDD   927
XP_001113525.1    1394   LLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEE--PKDEVEVSDDD   1441
XP_005639631.1    1446   LLPDREYKFRVRAINVYGTSEPSQESELTAVGEKPEE--PKDEVEVSDDD   1493
NP_647461.3       1425   LLPDREYKFRVRAVNVYGTSEPSQESELTAVGEKPEE--PKDEVEVSDDD   1472
NP_001099344.2    1437   LLPDREYKFRVRAVNVYGTSEPSQESELTAVGEKPEE--PKDEVEVSDDD   1484
NP_990790.1       1381   LQADREYKFRVRAANVYGISEPSQESEVVKVGEKQEEELKEEEAELSDDE   1430
XP_002662355.2     453   LLSDRQYKFRVRAVNVYGVGEPSAESGPIEVGAEEEE--EEVGAAVSDDD   500
XP_002935598.2     360   LEPGGQYQFRVRAANAHGVSEPGEESDIVAMLCAGDE-----------ET   398


NP_444253.3       1442   EKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWA   1491
XP_003950224.1     928   EKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWA   977
XP_001113525.1    1442   EKEPEVDYRTVTINTEQKVSDVYDIEERLGSGKFGQVFRLVEKKTRKIWA   1491
XP_005639631.1    1494   EKEPEVDYRTVTVNTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTGKIWA   1543
NP_647461.3       1473   EKEPEVDYRTVTVNTEQKVSDVYDIEERLGSGKFGQVFRLVEKKTGKIWA   1522
NP_001099344.2    1485   EKEPEVDYRTVTVNTEQKVSDVYDIEERLGSGKFGQVFRLVEKRTGKIWA   1534
NP_990790.1       1431   GKETEVNYRTVTINTEQKVSDVYNIEERLGSGKFGQVFRLVEKKTGKVWA   1480
XP_002662355.2     501   E-EKEPEYRDVVIKKDCSVKDFYDIEDRLGTGKFGQVFKLVEKSSKKVWA   549
XP_002935598.2     399   EGEGSNGYTNVSVNTTEHFNDFYIQLEKLGMGKFGQVYKLKERSTGKICA   448


NP_444253.3       1492   GKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIV   1541
XP_003950224.1     978   GKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEM-   1026
XP_001113525.1    1492   GKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIV   1541
XP_005639631.1    1544   GKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIV   1593
NP_647461.3       1523   GKFFKAYSAKEKDNIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIV   1572
NP_001099344.2    1535   GKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIV   1584
NP_990790.1       1481   GKFFKAYSAKEKENIRDEISIMNCLHHPKLVQCVDAFEEKANIVMVLEMV   1530
XP_002662355.2     550   GKFIKAFSQKEKENVRQEIGIMNSLHHPKLVQCMDAFEGKSDMVMVMEMI   599
XP_002935598.2     449   GKFFKARTQKEIQGARVEVELMNKLHHPQLVRCLSAFQEPGRVVMVLEYI   498


NP_444253.3       1542   SGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENI   1591
XP_003950224.1           --------------------------------------------------
XP_001113525.1    1542   SGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENI   1591
XP_005639631.1    1594   SGGELFERIIDEDFELTERECIQYMRQISAGVEYIHRQGIVHLDLKPENI   1643
NP_647461.3       1573   SGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENI   1622
NP_001099344.2    1585   SGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENI   1634
NP_990790.1       1531   SGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENI   1580
XP_002662355.2     600   SGGELFERIVDEDFELTEREVIKYMLQIIDGVQFIHKQGIVHLDLKPENI   649
XP_002935598.2     499   AGGELFERIVADDFEHTEVMCVEYICQILNGVAYMHHQSIVHLDLKPENI   548


NP_444253.3       1592   MCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYA   1641
XP_003950224.1           --------------------------------------------------
XP_001113525.1    1592   MCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYA   1641
XP_005639631.1    1644   MCVNKTGTRIKLIDFGLARKLENAGSLKVLFGTPEFVAPEVINYEPIGYA   1693
NP_647461.3       1623   MCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYA   1672
NP_001099344.2    1635   MCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYA   1684
NP_990790.1       1581   MCVNKTGTSIKLIDFGLARRLESAGSLKVLFGTPEFVAPEVINYEPIGYE   1630
XP_002662355.2     650   MCINKTGSKIKLIDFGLARRLEDSGSLKVLFGTPEFVAPEVINYEAISYP   699
XP_002935598.2     549   ICLNTVSNQVKIIDFGLARELDPHVPMKVLQGTAEFVAPEVIAFEPVGFT   598


NP_444253.3       1642   TDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDD   1691
XP_003950224.1           --------------------------------------------------
XP_001113525.1    1642   TDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDD   1691
XP_005639631.1    1694   TDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDD   1743
NP_647461.3       1673   TDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDD   1722
NP_001099344.2    1685   TDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISED   1734
NP_990790.1       1631   TDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDD   1680
XP_002662355.2     700   TDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFEDEAFDEISDQ   749
XP_002935598.2     599   TDMWSLGVICYILLSGDSPFQGNNDMETMQNITSACWDFDDETNALLSET   648


NP_444253.3       1692   AKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMA   1741
XP_003950224.1           --------------------------------------------------
XP_001113525.1    1692   AKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMA   1741
XP_005639631.1    1744   AKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMA   1793
NP_647461.3       1723   AKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMA   1772
NP_001099344.2    1735   AKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMA   1784
NP_990790.1       1681   AKDFISNLLKKDMKSRLNCTQCLQHPWLQKDTKNMEAKKLSKDRMKKYMA   1730
XP_002662355.2     750   AKDFISRLLKKDMRARLTCAQCFEHSWLKQDTKNMEAKQLSKERMKKYIL   799
XP_002935598.2     649   AKDFVKRLLQKNMRSRLTAVQALDHPWVQHKCVS-KTKTLSKERIKKFLA   697


NP_444253.3       1742   RRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEED   1791
XP_003950224.1           --------------------------------------------------
XP_001113525.1    1742   RRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEED   1791
XP_005639631.1    1794   RRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEED   1843
NP_647461.3       1773   RRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPINAEKLESEDD   1822
NP_001099344.2    1785   RRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPINAEKLESEED   1834
NP_990790.1       1731   RRKWQKTGHAVRAIGRLSSMAMISGMSGRKASGSSPTSPINADKVENED-   1779
XP_002662355.2     800   RRRWQKTGNAVRAISRFSSMGMLGGIGPKKSS-------------PTEEE   836
XP_002935598.2     698   RQKWQKTGKAVLALNR---MALLSAKSDNNTTSTHTDGSHDCQQVSMH--   742


NP_444253.3       1792   VSQAFLEAVAEEKPH-VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEV   1840
XP_003950224.1           --------------------------------------------------
XP_001113525.1    1792   VSQAFLEAVAEEKPH-VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEV   1840
XP_005639631.1    1844   VSQAFLEAVAEEKPH-VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEV   1892
NP_647461.3       1823   VSQAFLEAVAEEKPH-VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEV   1871
NP_001099344.2    1835   VSQAFLEAVAEEKPH-VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEV   1883
NP_990790.1       1780   ---AFLEEVAEEKPH-VKPYFTKTILDMEVVEGSAARFDCKIEGYPDPEV   1825
XP_002662355.2     837   PPAPFLESVEDENHTPAAPSFASVIQDVEVVEGSAARFDCKIEGCPDPEV   886
XP_002935598.2     743   ---------LQEQLQ-AAPVFSTLLKDQVEVVGSTARFQCHIEGFPDPEV   782


NP_444253.3       1841   VWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGE   1890
XP_003950224.1           --------------------------------------------------
XP_001113525.1    1841   VWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGE   1890
XP_005639631.1    1893   VWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGE   1942
NP_647461.3       1872   VWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGE   1921
NP_001099344.2    1884   VWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGE   1933
NP_990790.1       1826   MWYKDDQPVKESRHFQIDYDEEGNCSLTISEVCGDDDAKYTCKAVNSLGE   1875
XP_002662355.2     887   VWYKDDQPIKETRHFQIDYEEDGHCSLVISEVCPDDDAKYTCKAVNGLGE   936
XP_002935598.2     783   LWFHAGSPVQECRRLQIEYEDTGSCALIISDVLLTDSGVYTCRASNTQGE   832


NP_444253.3       1891   ATCTAELIVETM-EEGEGE--GEEEEE----   1914
XP_003950224.1           -------------------------------
XP_001113525.1    1891   ATCTAELIVETM-EEGEGE--GEEEEE----   1914
XP_005639631.1    1943   ATCTAELIVETM-EEGEGE--GEEEEEEE--   1968
NP_647461.3       1922   ATCTAELIVETM-EEGEGEEGGEEEEEEEE-   1950
NP_001099344.2    1934   ATCTAELIVETM-EEGEGEEGGEEEEEEE--   1961
NP_990790.1       1876   ATCTAELLVETMGKEGEGEGEGEEDEEEEEE   1906
XP_002662355.2     937   ASCTAELMVEFM-QEEEGDAEGEEED-----   961
XP_002935598.2     833   TESSAKLTVHSLLAERRAKESTQ--------   855


Protein Acc. Gene Organism
NP_444253.3 MYLK H.sapiens
XP_003950224.1 MYLK P.troglodytes
XP_001113525.1 MYLK M.mulatta
XP_005639631.1 MYLK C.lupus
NP_647461.3 Mylk M.musculus
NP_001099344.2 Mylk R.norvegicus
NP_990790.1 MYLK G.gallus
XP_002662355.2 mylkb D.rerio
XP_002935598.2 LOC100489678 X.tropicalis


Support Center