Current GenBank Release Notes
GBREL.TXT Genetic Sequence Data Bank
August 15 2025
NCBI-GenBank Flat File Release 268.0
Distribution Release Notes
258320620 sequences, 5676067778413 bases, for traditional GenBank records
5641997037 sequences, 41333485596602 bases, for set-based (WGS/TSA/TLS) records
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 268.0
1.2 Cutoff Date
1.3 Important Changes in Release 268.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 268.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use Submission Portal or BankIt for
sending sequence data.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
Email: gb-sub@ncbi.nlm.nih.gov
Updates and changes to existing GenBank records:
https://www.ncbi.nlm.nih.gov/genbank/update/
Email: update@ncbi.nlm.nih.gov
URLs for GenBank's web-based submission tools:
Submission Portal https://submit.ncbi.nlm.nih.gov/
BankIt https://www.ncbi.nlm.nih.gov/WebSub/
See Section 1.5 for additional details about submitting data to GenBank.
*****************************************************************************
GenBank Release 268.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
https://ftp.ncbi.nih.gov/ncbi-asn1
https://ftp.ncbi.nih.gov/genbank
GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:
https://ftp.ncbi.nih.gov/genbank/wgs
https://ftp.ncbi.nih.gov/ncbi-asn1/wgs
https://ftp.ncbi.nih.gov/genbank/tsa
https://ftp.ncbi.nih.gov/ncbi-asn1/tsa
https://ftp.ncbi.nih.gov/genbank/tls
https://ftp.ncbi.nih.gov/ncbi-asn1/tls
See the README files in those areas for more information.
1.2 Cutoff Date
This full release, 268.0, incorporates data processed by the INSDC databases
as of Wednesday Jun 18 2025 at 7:46PM EDT. For more recent data, users are
advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
https://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
https://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotide' database (see Section 6.4 of this document).
1.3 Important Changes in Release 268.0
1.3.1 Organizational changes
The total number of sequence data files for traditional GenBank records
(non-WGS/TSA/TLS) increased by 424 with this release:
- the BCT division is now composed of 477 files (+14)
- the ENV division is now composed of 39 files (+1)
- the INV division is now composed of 1513 files (+134)
- the MAM division is now composed of 203 files (+14)
- the PLN division is now composed of 2456 files (+224)
- the VRL division is now composed of 340 files (+1)
- the VRT division is now composed of 458 files (+36)
1.4 Upcoming Changes
1.4.1 Two new inference types for the /inference qualifier
Agreement was reached during the June 2025 INSDC annual meeting to support
two new types of inferences for the /inference qualifier. They are:
domain architecture: To indicate analyses based on sets of protein domains.
ortholog evidence: To support features based on findings from orthology
programs and data sources.
Details on the use of these new types will be provided upon the next
update of the INSDC Feature Table Document (as well as via these release
notes) :
https://www.insdc.org/submitting-standards/feature-table/#7.3
1.4.2 New qualifier to associate mRNA and CDS features: /transcript_id
Also at the June 2025 INSDC annual meeting, it was agreed to implement
a new qualifier that allows mRNA and CDS features to be associated.
The new /transcript_id qualifier aims to explicitly link parent mRNA
features to their child CDS features. The transcript_id would function
similarly to a /locus_tag qualifier, being unique within a given genome
and appearing on both the mRNA and its corresponding CDS. This linkage
is crucial for representing the hierarchical structure of gene annotations.
More details about /transcipt_id will be provided for the October 2025
update of the INSDC Feature Table Document (see URL provided above) and
via these release notes.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank utilizing the tools summarized below.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. General
information for submitting to Genbank is available online:
https://www.ncbi.nlm.nih.gov/genbank/submit/
To assist researchers in entering their own sequence data, GenBank
provides Web-based submission tools: Submission Portal and Bankit.
Submission Portal https://submit.ncbi.nlm.nih.gov/
BankIt https://www.ncbi.nlm.nih.gov/WebSub/
Submission Portal provides an efficient submission pathway for high
frequency submission types (e.g., 16S rRNA, rRNA-ITS, metazoan COX1,
SARS-CoV-2, etc.).
BankIt is an easy-to-use program that enables authors to enter one
or more sequences, annotate, and submit to GenBank. BankIt provides
a simple forms-based approach for submitting your sequence and the
relevant associated metadata to GenBank.
Genbank also provides submission preparation tools which require uploading
via the Submission Portal or email to gb-sub@ncbi.nlm.nih.gov when relevant:
table2asn: https://www.ncbi.nlm.nih.gov/genbank/table2asn/
table2asn is a command-line program that automates the creation of sequence
records for submission to GenBank. It is used primarily for submission of
complete genomes and large batches of sequences and is available by FTP
for use on MAC, PC and Unix platforms:
https://ftp.ncbi.nlm.nih.gov/asn1-converters/by_program/table2asn/
Through the international collaboration of DNA sequence databases,
GenBank submissions are forwarded daily for inclusion in the European
Nucleotide Archive (ENA) and the DNA Databank of Japan (DDBJ).
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov .
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.
2.2 Files
This GenBank flat file release consists of 6109 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct413.seq - Bacterial sequence entries, part 413.
351. gbbct414.seq - Bacterial sequence entries, part 414.
352. gbbct415.seq - Bacterial sequence entries, part 415.
353. gbbct416.seq - Bacterial sequence entries, part 416.
354. gbbct417.seq - Bacterial sequence entries, part 417.
355. gbbct418.seq - Bacterial sequence entries, part 418.
356. gbbct419.seq - Bacterial sequence entries, part 419.
357. gbbct42.seq - Bacterial sequence entries, part 42.
358. gbbct420.seq - Bacterial sequence entries, part 420.
359. gbbct421.seq - Bacterial sequence entries, part 421.
360. gbbct422.seq - Bacterial sequence entries, part 422.
361. gbbct423.seq - Bacterial sequence entries, part 423.
362. gbbct424.seq - Bacterial sequence entries, part 424.
363. gbbct425.seq - Bacterial sequence entries, part 425.
364. gbbct426.seq - Bacterial sequence entries, part 426.
365. gbbct427.seq - Bacterial sequence entries, part 427.
366. gbbct428.seq - Bacterial sequence entries, part 428.
367. gbbct429.seq - Bacterial sequence entries, part 429.
368. gbbct43.seq - Bacterial sequence entries, part 43.
369. gbbct430.seq - Bacterial sequence entries, part 430.
370. gbbct431.seq - Bacterial sequence entries, part 431.
371. gbbct432.seq - Bacterial sequence entries, part 432.
372. gbbct433.seq - Bacterial sequence entries, part 433.
373. gbbct434.seq - Bacterial sequence entries, part 434.
374. gbbct435.seq - Bacterial sequence entries, part 435.
375. gbbct436.seq - Bacterial sequence entries, part 436.
376. gbbct437.seq - Bacterial sequence entries, part 437.
377. gbbct438.seq - Bacterial sequence entries, part 438.
378. gbbct439.seq - Bacterial sequence entries, part 439.
379. gbbct44.seq - Bacterial sequence entries, part 44.
380. gbbct440.seq - Bacterial sequence entries, part 440.
381. gbbct441.seq - Bacterial sequence entries, part 441.
382. gbbct442.seq - Bacterial sequence entries, part 442.
383. gbbct443.seq - Bacterial sequence entries, part 443.
384. gbbct444.seq - Bacterial sequence entries, part 444.
385. gbbct445.seq - Bacterial sequence entries, part 445.
386. gbbct446.seq - Bacterial sequence entries, part 446.
387. gbbct447.seq - Bacterial sequence entries, part 447.
388. gbbct448.seq - Bacterial sequence entries, part 448.
389. gbbct449.seq - Bacterial sequence entries, part 449.
390. gbbct45.seq - Bacterial sequence entries, part 45.
391. gbbct450.seq - Bacterial sequence entries, part 450.
392. gbbct451.seq - Bacterial sequence entries, part 451.
393. gbbct452.seq - Bacterial sequence entries, part 452.
394. gbbct453.seq - Bacterial sequence entries, part 453.
395. gbbct454.seq - Bacterial sequence entries, part 454.
396. gbbct455.seq - Bacterial sequence entries, part 455.
397. gbbct456.seq - Bacterial sequence entries, part 456.
398. gbbct457.seq - Bacterial sequence entries, part 457.
399. gbbct458.seq - Bacterial sequence entries, part 458.
400. gbbct459.seq - Bacterial sequence entries, part 459.
401. gbbct46.seq - Bacterial sequence entries, part 46.
402. gbbct460.seq - Bacterial sequence entries, part 460.
403. gbbct461.seq - Bacterial sequence entries, part 461.
404. gbbct462.seq - Bacterial sequence entries, part 462.
405. gbbct463.seq - Bacterial sequence entries, part 463.
406. gbbct464.seq - Bacterial sequence entries, part 464.
407. gbbct465.seq - Bacterial sequence entries, part 465.
408. gbbct466.seq - Bacterial sequence entries, part 466.
409. gbbct467.seq - Bacterial sequence entries, part 467.
410. gbbct468.seq - Bacterial sequence entries, part 468.
411. gbbct469.seq - Bacterial sequence entries, part 469.
412. gbbct47.seq - Bacterial sequence entries, part 47.
413. gbbct470.seq - Bacterial sequence entries, part 470.
414. gbbct471.seq - Bacterial sequence entries, part 471.
415. gbbct472.seq - Bacterial sequence entries, part 472.
416. gbbct473.seq - Bacterial sequence entries, part 473.
417. gbbct474.seq - Bacterial sequence entries, part 474.
418. gbbct475.seq - Bacterial sequence entries, part 475.
419. gbbct476.seq - Bacterial sequence entries, part 476.
420. gbbct477.seq - Bacterial sequence entries, part 477.
421. gbbct48.seq - Bacterial sequence entries, part 48.
422. gbbct49.seq - Bacterial sequence entries, part 49.
423. gbbct5.seq - Bacterial sequence entries, part 5.
424. gbbct50.seq - Bacterial sequence entries, part 50.
425. gbbct51.seq - Bacterial sequence entries, part 51.
426. gbbct52.seq - Bacterial sequence entries, part 52.
427. gbbct53.seq - Bacterial sequence entries, part 53.
428. gbbct54.seq - Bacterial sequence entries, part 54.
429. gbbct55.seq - Bacterial sequence entries, part 55.
430. gbbct56.seq - Bacterial sequence entries, part 56.
431. gbbct57.seq - Bacterial sequence entries, part 57.
432. gbbct58.seq - Bacterial sequence entries, part 58.
433. gbbct59.seq - Bacterial sequence entries, part 59.
434. gbbct6.seq - Bacterial sequence entries, part 6.
435. gbbct60.seq - Bacterial sequence entries, part 60.
436. gbbct61.seq - Bacterial sequence entries, part 61.
437. gbbct62.seq - Bacterial sequence entries, part 62.
438. gbbct63.seq - Bacterial sequence entries, part 63.
439. gbbct64.seq - Bacterial sequence entries, part 64.
440. gbbct65.seq - Bacterial sequence entries, part 65.
441. gbbct66.seq - Bacterial sequence entries, part 66.
442. gbbct67.seq - Bacterial sequence entries, part 67.
443. gbbct68.seq - Bacterial sequence entries, part 68.
444. gbbct69.seq - Bacterial sequence entries, part 69.
445. gbbct7.seq - Bacterial sequence entries, part 7.
446. gbbct70.seq - Bacterial sequence entries, part 70.
447. gbbct71.seq - Bacterial sequence entries, part 71.
448. gbbct72.seq - Bacterial sequence entries, part 72.
449. gbbct73.seq - Bacterial sequence entries, part 73.
450. gbbct74.seq - Bacterial sequence entries, part 74.
451. gbbct75.seq - Bacterial sequence entries, part 75.
452. gbbct76.seq - Bacterial sequence entries, part 76.
453. gbbct77.seq - Bacterial sequence entries, part 77.
454. gbbct78.seq - Bacterial sequence entries, part 78.
455. gbbct79.seq - Bacterial sequence entries, part 79.
456. gbbct8.seq - Bacterial sequence entries, part 8.
457. gbbct80.seq - Bacterial sequence entries, part 80.
458. gbbct81.seq - Bacterial sequence entries, part 81.
459. gbbct82.seq - Bacterial sequence entries, part 82.
460. gbbct83.seq - Bacterial sequence entries, part 83.
461. gbbct84.seq - Bacterial sequence entries, part 84.
462. gbbct85.seq - Bacterial sequence entries, part 85.
463. gbbct86.seq - Bacterial sequence entries, part 86.
464. gbbct87.seq - Bacterial sequence entries, part 87.
465. gbbct88.seq - Bacterial sequence entries, part 88.
466. gbbct89.seq - Bacterial sequence entries, part 89.
467. gbbct9.seq - Bacterial sequence entries, part 9.
468. gbbct90.seq - Bacterial sequence entries, part 90.
469. gbbct91.seq - Bacterial sequence entries, part 91.
470. gbbct92.seq - Bacterial sequence entries, part 92.
471. gbbct93.seq - Bacterial sequence entries, part 93.
472. gbbct94.seq - Bacterial sequence entries, part 94.
473. gbbct95.seq - Bacterial sequence entries, part 95.
474. gbbct96.seq - Bacterial sequence entries, part 96.
475. gbbct97.seq - Bacterial sequence entries, part 97.
476. gbbct98.seq - Bacterial sequence entries, part 98.
477. gbbct99.seq - Bacterial sequence entries, part 99.
478. gbchg.txt - Accession numbers of entries updated since the previous release.
479. gbcon1.seq - Constructed sequence entries, part 1.
480. gbcon10.seq - Constructed sequence entries, part 10.
481. gbcon11.seq - Constructed sequence entries, part 11.
482. gbcon12.seq - Constructed sequence entries, part 12.
483. gbcon13.seq - Constructed sequence entries, part 13.
484. gbcon14.seq - Constructed sequence entries, part 14.
485. gbcon15.seq - Constructed sequence entries, part 15.
486. gbcon16.seq - Constructed sequence entries, part 16.
487. gbcon17.seq - Constructed sequence entries, part 17.
488. gbcon18.seq - Constructed sequence entries, part 18.
489. gbcon19.seq - Constructed sequence entries, part 19.
490. gbcon2.seq - Constructed sequence entries, part 2.
491. gbcon20.seq - Constructed sequence entries, part 20.
492. gbcon21.seq - Constructed sequence entries, part 21.
493. gbcon22.seq - Constructed sequence entries, part 22.
494. gbcon23.seq - Constructed sequence entries, part 23.
495. gbcon24.seq - Constructed sequence entries, part 24.
496. gbcon25.seq - Constructed sequence entries, part 25.
497. gbcon26.seq - Constructed sequence entries, part 26.
498. gbcon27.seq - Constructed sequence entries, part 27.
499. gbcon28.seq - Constructed sequence entries, part 28.
500. gbcon29.seq - Constructed sequence entries, part 29.
501. gbcon3.seq - Constructed sequence entries, part 3.
502. gbcon30.seq - Constructed sequence entries, part 30.
503. gbcon31.seq - Constructed sequence entries, part 31.
504. gbcon32.seq - Constructed sequence entries, part 32.
505. gbcon33.seq - Constructed sequence entries, part 33.
506. gbcon34.seq - Constructed sequence entries, part 34.
507. gbcon35.seq - Constructed sequence entries, part 35.
508. gbcon36.seq - Constructed sequence entries, part 36.
509. gbcon37.seq - Constructed sequence entries, part 37.
510. gbcon38.seq - Constructed sequence entries, part 38.
511. gbcon39.seq - Constructed sequence entries, part 39.
512. gbcon4.seq - Constructed sequence entries, part 4.
513. gbcon40.seq - Constructed sequence entries, part 40.
514. gbcon41.seq - Constructed sequence entries, part 41.
515. gbcon42.seq - Constructed sequence entries, part 42.
516. gbcon43.seq - Constructed sequence entries, part 43.
517. gbcon44.seq - Constructed sequence entries, part 44.
518. gbcon45.seq - Constructed sequence entries, part 45.
519. gbcon46.seq - Constructed sequence entries, part 46.
520. gbcon47.seq - Constructed sequence entries, part 47.
521. gbcon48.seq - Constructed sequence entries, part 48.
522. gbcon49.seq - Constructed sequence entries, part 49.
523. gbcon5.seq - Constructed sequence entries, part 5.
524. gbcon50.seq - Constructed sequence entries, part 50.
525. gbcon51.seq - Constructed sequence entries, part 51.
526. gbcon52.seq - Constructed sequence entries, part 52.
527. gbcon53.seq - Constructed sequence entries, part 53.
528. gbcon54.seq - Constructed sequence entries, part 54.
529. gbcon55.seq - Constructed sequence entries, part 55.
530. gbcon56.seq - Constructed sequence entries, part 56.
531. gbcon57.seq - Constructed sequence entries, part 57.
532. gbcon58.seq - Constructed sequence entries, part 58.
533. gbcon59.seq - Constructed sequence entries, part 59.
534. gbcon6.seq - Constructed sequence entries, part 6.
535. gbcon60.seq - Constructed sequence entries, part 60.
536. gbcon61.seq - Constructed sequence entries, part 61.
537. gbcon62.seq - Constructed sequence entries, part 62.
538. gbcon63.seq - Constructed sequence entries, part 63.
539. gbcon64.seq - Constructed sequence entries, part 64.
540. gbcon65.seq - Constructed sequence entries, part 65.
541. gbcon66.seq - Constructed sequence entries, part 66.
542. gbcon67.seq - Constructed sequence entries, part 67.
543. gbcon68.seq - Constructed sequence entries, part 68.
544. gbcon7.seq - Constructed sequence entries, part 7.
545. gbcon8.seq - Constructed sequence entries, part 8.
546. gbcon9.seq - Constructed sequence entries, part 9.
547. gbdel.txt - Accession numbers of entries deleted since the previous release.
548. gbenv1.seq - Environmental sampling sequence entries, part 1.
549. gbenv10.seq - Environmental sampling sequence entries, part 10.
550. gbenv11.seq - Environmental sampling sequence entries, part 11.
551. gbenv12.seq - Environmental sampling sequence entries, part 12.
552. gbenv13.seq - Environmental sampling sequence entries, part 13.
553. gbenv14.seq - Environmental sampling sequence entries, part 14.
554. gbenv15.seq - Environmental sampling sequence entries, part 15.
555. gbenv16.seq - Environmental sampling sequence entries, part 16.
556. gbenv17.seq - Environmental sampling sequence entries, part 17.
557. gbenv18.seq - Environmental sampling sequence entries, part 18.
558. gbenv19.seq - Environmental sampling sequence entries, part 19.
559. gbenv2.seq - Environmental sampling sequence entries, part 2.
560. gbenv20.seq - Environmental sampling sequence entries, part 20.
561. gbenv21.seq - Environmental sampling sequence entries, part 21.
562. gbenv22.seq - Environmental sampling sequence entries, part 22.
563. gbenv23.seq - Environmental sampling sequence entries, part 23.
564. gbenv24.seq - Environmental sampling sequence entries, part 24.
565. gbenv25.seq - Environmental sampling sequence entries, part 25.
566. gbenv26.seq - Environmental sampling sequence entries, part 26.
567. gbenv27.seq - Environmental sampling sequence entries, part 27.
568. gbenv28.seq - Environmental sampling sequence entries, part 28.
569. gbenv29.seq - Environmental sampling sequence entries, part 29.
570. gbenv3.seq - Environmental sampling sequence entries, part 3.
571. gbenv30.seq - Environmental sampling sequence entries, part 30.
572. gbenv31.seq - Environmental sampling sequence entries, part 31.
573. gbenv32.seq - Environmental sampling sequence entries, part 32.
574. gbenv33.seq - Environmental sampling sequence entries, part 33.
575. gbenv34.seq - Environmental sampling sequence entries, part 34.
576. gbenv35.seq - Environmental sampling sequence entries, part 35.
577. gbenv36.seq - Environmental sampling sequence entries, part 36.
578. gbenv37.seq - Environmental sampling sequence entries, part 37.
579. gbenv38.seq - Environmental sampling sequence entries, part 38.
580. gbenv39.seq - Environmental sampling sequence entries, part 39.
581. gbenv4.seq - Environmental sampling sequence entries, part 4.
582. gbenv5.seq - Environmental sampling sequence entries, part 5.
583. gbenv6.seq - Environmental sampling sequence entries, part 6.
584. gbenv7.seq - Environmental sampling sequence entries, part 7.
585. gbenv8.seq - Environmental sampling sequence entries, part 8.
586. gbenv9.seq - Environmental sampling sequence entries, part 9.
587. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
588. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
589. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
590. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
591. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
592. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
593. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
594. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
595. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
596. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
597. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
598. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
599. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
600. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
601. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
602. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
603. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
604. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
605. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
606. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
607. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
608. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
609. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
610. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
611. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
612. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
613. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
614. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
615. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
616. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
617. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
618. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
619. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
620. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
621. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
622. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
623. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
624. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
625. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
626. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
627. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
628. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
629. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
630. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
631. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
632. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
633. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
634. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
635. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
636. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
637. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
638. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
639. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
640. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
641. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
642. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
643. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
644. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
645. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
646. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
647. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
648. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
649. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
650. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
651. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
652. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
653. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
654. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
655. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
656. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
657. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
658. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
659. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
660. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
661. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
662. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
663. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
664. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
665. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
666. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
667. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
668. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
669. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
670. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
671. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
672. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
673. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
674. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
675. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
676. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
677. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
678. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
679. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
680. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
681. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
682. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
683. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
684. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
685. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
686. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
687. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
688. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
689. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
690. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
691. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
692. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
693. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
694. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
695. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
696. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
697. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
698. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
699. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
700. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
701. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
702. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
703. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
704. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
705. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
706. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
707. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
708. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
709. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
710. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
711. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
712. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
713. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
714. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
715. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
716. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
717. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
718. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
719. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
720. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
721. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
722. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
723. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
724. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
725. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
726. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
727. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
728. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
729. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
730. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
731. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
732. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
733. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
734. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
735. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
736. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
737. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
738. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
739. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
740. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
741. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
742. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
743. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
744. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
745. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
746. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
747. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
748. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
749. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
750. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
751. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
752. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
753. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
754. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
755. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
756. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
757. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
758. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
759. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
760. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
761. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
762. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
763. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
764. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
765. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
766. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
767. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
768. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
769. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
770. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
771. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
772. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
773. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
774. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
775. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
776. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
777. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
778. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
779. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
780. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
781. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
782. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
783. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
784. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
785. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
786. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
787. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
788. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
789. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
790. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
791. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
792. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
793. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
794. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
795. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
796. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
797. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
798. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
799. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
800. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
801. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
802. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
803. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
804. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
805. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
806. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
807. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
808. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
809. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
810. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
811. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
812. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
813. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
814. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
815. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
816. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
817. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
818. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
819. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
820. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
821. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
822. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
823. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
824. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
825. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
826. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
827. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
828. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
829. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
830. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
831. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
832. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
833. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
834. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
835. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
836. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
837. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
838. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
839. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
840. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
841. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
842. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
843. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
844. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
845. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
846. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
847. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
848. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
849. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
850. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
851. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
852. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
853. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
854. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
855. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
856. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
857. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
858. gbinv1.seq - Invertebrate sequence entries, part 1.
859. gbinv10.seq - Invertebrate sequence entries, part 10.
860. gbinv100.seq - Invertebrate sequence entries, part 100.
861. gbinv1000.seq - Invertebrate sequence entries, part 1000.
862. gbinv1001.seq - Invertebrate sequence entries, part 1001.
863. gbinv1002.seq - Invertebrate sequence entries, part 1002.
864. gbinv1003.seq - Invertebrate sequence entries, part 1003.
865. gbinv1004.seq - Invertebrate sequence entries, part 1004.
866. gbinv1005.seq - Invertebrate sequence entries, part 1005.
867. gbinv1006.seq - Invertebrate sequence entries, part 1006.
868. gbinv1007.seq - Invertebrate sequence entries, part 1007.
869. gbinv1008.seq - Invertebrate sequence entries, part 1008.
870. gbinv1009.seq - Invertebrate sequence entries, part 1009.
871. gbinv101.seq - Invertebrate sequence entries, part 101.
872. gbinv1010.seq - Invertebrate sequence entries, part 1010.
873. gbinv1011.seq - Invertebrate sequence entries, part 1011.
874. gbinv1012.seq - Invertebrate sequence entries, part 1012.
875. gbinv1013.seq - Invertebrate sequence entries, part 1013.
876. gbinv1014.seq - Invertebrate sequence entries, part 1014.
877. gbinv1015.seq - Invertebrate sequence entries, part 1015.
878. gbinv1016.seq - Invertebrate sequence entries, part 1016.
879. gbinv1017.seq - Invertebrate sequence entries, part 1017.
880. gbinv1018.seq - Invertebrate sequence entries, part 1018.
881. gbinv1019.seq - Invertebrate sequence entries, part 1019.
882. gbinv102.seq - Invertebrate sequence entries, part 102.
883. gbinv1020.seq - Invertebrate sequence entries, part 1020.
884. gbinv1021.seq - Invertebrate sequence entries, part 1021.
885. gbinv1022.seq - Invertebrate sequence entries, part 1022.
886. gbinv1023.seq - Invertebrate sequence entries, part 1023.
887. gbinv1024.seq - Invertebrate sequence entries, part 1024.
888. gbinv1025.seq - Invertebrate sequence entries, part 1025.
889. gbinv1026.seq - Invertebrate sequence entries, part 1026.
890. gbinv1027.seq - Invertebrate sequence entries, part 1027.
891. gbinv1028.seq - Invertebrate sequence entries, part 1028.
892. gbinv1029.seq - Invertebrate sequence entries, part 1029.
893. gbinv103.seq - Invertebrate sequence entries, part 103.
894. gbinv1030.seq - Invertebrate sequence entries, part 1030.
895. gbinv1031.seq - Invertebrate sequence entries, part 1031.
896. gbinv1032.seq - Invertebrate sequence entries, part 1032.
897. gbinv1033.seq - Invertebrate sequence entries, part 1033.
898. gbinv1034.seq - Invertebrate sequence entries, part 1034.
899. gbinv1035.seq - Invertebrate sequence entries, part 1035.
900. gbinv1036.seq - Invertebrate sequence entries, part 1036.
901. gbinv1037.seq - Invertebrate sequence entries, part 1037.
902. gbinv1038.seq - Invertebrate sequence entries, part 1038.
903. gbinv1039.seq - Invertebrate sequence entries, part 1039.
904. gbinv104.seq - Invertebrate sequence entries, part 104.
905. gbinv1040.seq - Invertebrate sequence entries, part 1040.
906. gbinv1041.seq - Invertebrate sequence entries, part 1041.
907. gbinv1042.seq - Invertebrate sequence entries, part 1042.
908. gbinv1043.seq - Invertebrate sequence entries, part 1043.
909. gbinv1044.seq - Invertebrate sequence entries, part 1044.
910. gbinv1045.seq - Invertebrate sequence entries, part 1045.
911. gbinv1046.seq - Invertebrate sequence entries, part 1046.
912. gbinv1047.seq - Invertebrate sequence entries, part 1047.
913. gbinv1048.seq - Invertebrate sequence entries, part 1048.
914. gbinv1049.seq - Invertebrate sequence entries, part 1049.
915. gbinv105.seq - Invertebrate sequence entries, part 105.
916. gbinv1050.seq - Invertebrate sequence entries, part 1050.
917. gbinv1051.seq - Invertebrate sequence entries, part 1051.
918. gbinv1052.seq - Invertebrate sequence entries, part 1052.
919. gbinv1053.seq - Invertebrate sequence entries, part 1053.
920. gbinv1054.seq - Invertebrate sequence entries, part 1054.
921. gbinv1055.seq - Invertebrate sequence entries, part 1055.
922. gbinv1056.seq - Invertebrate sequence entries, part 1056.
923. gbinv1057.seq - Invertebrate sequence entries, part 1057.
924. gbinv1058.seq - Invertebrate sequence entries, part 1058.
925. gbinv1059.seq - Invertebrate sequence entries, part 1059.
926. gbinv106.seq - Invertebrate sequence entries, part 106.
927. gbinv1060.seq - Invertebrate sequence entries, part 1060.
928. gbinv1061.seq - Invertebrate sequence entries, part 1061.
929. gbinv1062.seq - Invertebrate sequence entries, part 1062.
930. gbinv1063.seq - Invertebrate sequence entries, part 1063.
931. gbinv1064.seq - Invertebrate sequence entries, part 1064.
932. gbinv1065.seq - Invertebrate sequence entries, part 1065.
933. gbinv1066.seq - Invertebrate sequence entries, part 1066.
934. gbinv1067.seq - Invertebrate sequence entries, part 1067.
935. gbinv1068.seq - Invertebrate sequence entries, part 1068.
936. gbinv1069.seq - Invertebrate sequence entries, part 1069.
937. gbinv107.seq - Invertebrate sequence entries, part 107.
938. gbinv1070.seq - Invertebrate sequence entries, part 1070.
939. gbinv1071.seq - Invertebrate sequence entries, part 1071.
940. gbinv1072.seq - Invertebrate sequence entries, part 1072.
941. gbinv1073.seq - Invertebrate sequence entries, part 1073.
942. gbinv1074.seq - Invertebrate sequence entries, part 1074.
943. gbinv1075.seq - Invertebrate sequence entries, part 1075.
944. gbinv1076.seq - Invertebrate sequence entries, part 1076.
945. gbinv1077.seq - Invertebrate sequence entries, part 1077.
946. gbinv1078.seq - Invertebrate sequence entries, part 1078.
947. gbinv1079.seq - Invertebrate sequence entries, part 1079.
948. gbinv108.seq - Invertebrate sequence entries, part 108.
949. gbinv1080.seq - Invertebrate sequence entries, part 1080.
950. gbinv1081.seq - Invertebrate sequence entries, part 1081.
951. gbinv1082.seq - Invertebrate sequence entries, part 1082.
952. gbinv1083.seq - Invertebrate sequence entries, part 1083.
953. gbinv1084.seq - Invertebrate sequence entries, part 1084.
954. gbinv1085.seq - Invertebrate sequence entries, part 1085.
955. gbinv1086.seq - Invertebrate sequence entries, part 1086.
956. gbinv1087.seq - Invertebrate sequence entries, part 1087.
957. gbinv1088.seq - Invertebrate sequence entries, part 1088.
958. gbinv1089.seq - Invertebrate sequence entries, part 1089.
959. gbinv109.seq - Invertebrate sequence entries, part 109.
960. gbinv1090.seq - Invertebrate sequence entries, part 1090.
961. gbinv1091.seq - Invertebrate sequence entries, part 1091.
962. gbinv1092.seq - Invertebrate sequence entries, part 1092.
963. gbinv1093.seq - Invertebrate sequence entries, part 1093.
964. gbinv1094.seq - Invertebrate sequence entries, part 1094.
965. gbinv1095.seq - Invertebrate sequence entries, part 1095.
966. gbinv1096.seq - Invertebrate sequence entries, part 1096.
967. gbinv1097.seq - Invertebrate sequence entries, part 1097.
968. gbinv1098.seq - Invertebrate sequence entries, part 1098.
969. gbinv1099.seq - Invertebrate sequence entries, part 1099.
970. gbinv11.seq - Invertebrate sequence entries, part 11.
971. gbinv110.seq - Invertebrate sequence entries, part 110.
972. gbinv1100.seq - Invertebrate sequence entries, part 1100.
973. gbinv1101.seq - Invertebrate sequence entries, part 1101.
974. gbinv1102.seq - Invertebrate sequence entries, part 1102.
975. gbinv1103.seq - Invertebrate sequence entries, part 1103.
976. gbinv1104.seq - Invertebrate sequence entries, part 1104.
977. gbinv1105.seq - Invertebrate sequence entries, part 1105.
978. gbinv1106.seq - Invertebrate sequence entries, part 1106.
979. gbinv1107.seq - Invertebrate sequence entries, part 1107.
980. gbinv1108.seq - Invertebrate sequence entries, part 1108.
981. gbinv1109.seq - Invertebrate sequence entries, part 1109.
982. gbinv111.seq - Invertebrate sequence entries, part 111.
983. gbinv1110.seq - Invertebrate sequence entries, part 1110.
984. gbinv1111.seq - Invertebrate sequence entries, part 1111.
985. gbinv1112.seq - Invertebrate sequence entries, part 1112.
986. gbinv1113.seq - Invertebrate sequence entries, part 1113.
987. gbinv1114.seq - Invertebrate sequence entries, part 1114.
988. gbinv1115.seq - Invertebrate sequence entries, part 1115.
989. gbinv1116.seq - Invertebrate sequence entries, part 1116.
990. gbinv1117.seq - Invertebrate sequence entries, part 1117.
991. gbinv1118.seq - Invertebrate sequence entries, part 1118.
992. gbinv1119.seq - Invertebrate sequence entries, part 1119.
993. gbinv112.seq - Invertebrate sequence entries, part 112.
994. gbinv1120.seq - Invertebrate sequence entries, part 1120.
995. gbinv1121.seq - Invertebrate sequence entries, part 1121.
996. gbinv1122.seq - Invertebrate sequence entries, part 1122.
997. gbinv1123.seq - Invertebrate sequence entries, part 1123.
998. gbinv1124.seq - Invertebrate sequence entries, part 1124.
999. gbinv1125.seq - Invertebrate sequence entries, part 1125.
1000. gbinv1126.seq - Invertebrate sequence entries, part 1126.
1001. gbinv1127.seq - Invertebrate sequence entries, part 1127.
1002. gbinv1128.seq - Invertebrate sequence entries, part 1128.
1003. gbinv1129.seq - Invertebrate sequence entries, part 1129.
1004. gbinv113.seq - Invertebrate sequence entries, part 113.
1005. gbinv1130.seq - Invertebrate sequence entries, part 1130.
1006. gbinv1131.seq - Invertebrate sequence entries, part 1131.
1007. gbinv1132.seq - Invertebrate sequence entries, part 1132.
1008. gbinv1133.seq - Invertebrate sequence entries, part 1133.
1009. gbinv1134.seq - Invertebrate sequence entries, part 1134.
1010. gbinv1135.seq - Invertebrate sequence entries, part 1135.
1011. gbinv1136.seq - Invertebrate sequence entries, part 1136.
1012. gbinv1137.seq - Invertebrate sequence entries, part 1137.
1013. gbinv1138.seq - Invertebrate sequence entries, part 1138.
1014. gbinv1139.seq - Invertebrate sequence entries, part 1139.
1015. gbinv114.seq - Invertebrate sequence entries, part 114.
1016. gbinv1140.seq - Invertebrate sequence entries, part 1140.
1017. gbinv1141.seq - Invertebrate sequence entries, part 1141.
1018. gbinv1142.seq - Invertebrate sequence entries, part 1142.
1019. gbinv1143.seq - Invertebrate sequence entries, part 1143.
1020. gbinv1144.seq - Invertebrate sequence entries, part 1144.
1021. gbinv1145.seq - Invertebrate sequence entries, part 1145.
1022. gbinv1146.seq - Invertebrate sequence entries, part 1146.
1023. gbinv1147.seq - Invertebrate sequence entries, part 1147.
1024. gbinv1148.seq - Invertebrate sequence entries, part 1148.
1025. gbinv1149.seq - Invertebrate sequence entries, part 1149.
1026. gbinv115.seq - Invertebrate sequence entries, part 115.
1027. gbinv1150.seq - Invertebrate sequence entries, part 1150.
1028. gbinv1151.seq - Invertebrate sequence entries, part 1151.
1029. gbinv1152.seq - Invertebrate sequence entries, part 1152.
1030. gbinv1153.seq - Invertebrate sequence entries, part 1153.
1031. gbinv1154.seq - Invertebrate sequence entries, part 1154.
1032. gbinv1155.seq - Invertebrate sequence entries, part 1155.
1033. gbinv1156.seq - Invertebrate sequence entries, part 1156.
1034. gbinv1157.seq - Invertebrate sequence entries, part 1157.
1035. gbinv1158.seq - Invertebrate sequence entries, part 1158.
1036. gbinv1159.seq - Invertebrate sequence entries, part 1159.
1037. gbinv116.seq - Invertebrate sequence entries, part 116.
1038. gbinv1160.seq - Invertebrate sequence entries, part 1160.
1039. gbinv1161.seq - Invertebrate sequence entries, part 1161.
1040. gbinv1162.seq - Invertebrate sequence entries, part 1162.
1041. gbinv1163.seq - Invertebrate sequence entries, part 1163.
1042. gbinv1164.seq - Invertebrate sequence entries, part 1164.
1043. gbinv1165.seq - Invertebrate sequence entries, part 1165.
1044. gbinv1166.seq - Invertebrate sequence entries, part 1166.
1045. gbinv1167.seq - Invertebrate sequence entries, part 1167.
1046. gbinv1168.seq - Invertebrate sequence entries, part 1168.
1047. gbinv1169.seq - Invertebrate sequence entries, part 1169.
1048. gbinv117.seq - Invertebrate sequence entries, part 117.
1049. gbinv1170.seq - Invertebrate sequence entries, part 1170.
1050. gbinv1171.seq - Invertebrate sequence entries, part 1171.
1051. gbinv1172.seq - Invertebrate sequence entries, part 1172.
1052. gbinv1173.seq - Invertebrate sequence entries, part 1173.
1053. gbinv1174.seq - Invertebrate sequence entries, part 1174.
1054. gbinv1175.seq - Invertebrate sequence entries, part 1175.
1055. gbinv1176.seq - Invertebrate sequence entries, part 1176.
1056. gbinv1177.seq - Invertebrate sequence entries, part 1177.
1057. gbinv1178.seq - Invertebrate sequence entries, part 1178.
1058. gbinv1179.seq - Invertebrate sequence entries, part 1179.
1059. gbinv118.seq - Invertebrate sequence entries, part 118.
1060. gbinv1180.seq - Invertebrate sequence entries, part 1180.
1061. gbinv1181.seq - Invertebrate sequence entries, part 1181.
1062. gbinv1182.seq - Invertebrate sequence entries, part 1182.
1063. gbinv1183.seq - Invertebrate sequence entries, part 1183.
1064. gbinv1184.seq - Invertebrate sequence entries, part 1184.
1065. gbinv1185.seq - Invertebrate sequence entries, part 1185.
1066. gbinv1186.seq - Invertebrate sequence entries, part 1186.
1067. gbinv1187.seq - Invertebrate sequence entries, part 1187.
1068. gbinv1188.seq - Invertebrate sequence entries, part 1188.
1069. gbinv1189.seq - Invertebrate sequence entries, part 1189.
1070. gbinv119.seq - Invertebrate sequence entries, part 119.
1071. gbinv1190.seq - Invertebrate sequence entries, part 1190.
1072. gbinv1191.seq - Invertebrate sequence entries, part 1191.
1073. gbinv1192.seq - Invertebrate sequence entries, part 1192.
1074. gbinv1193.seq - Invertebrate sequence entries, part 1193.
1075. gbinv1194.seq - Invertebrate sequence entries, part 1194.
1076. gbinv1195.seq - Invertebrate sequence entries, part 1195.
1077. gbinv1196.seq - Invertebrate sequence entries, part 1196.
1078. gbinv1197.seq - Invertebrate sequence entries, part 1197.
1079. gbinv1198.seq - Invertebrate sequence entries, part 1198.
1080. gbinv1199.seq - Invertebrate sequence entries, part 1199.
1081. gbinv12.seq - Invertebrate sequence entries, part 12.
1082. gbinv120.seq - Invertebrate sequence entries, part 120.
1083. gbinv1200.seq - Invertebrate sequence entries, part 1200.
1084. gbinv1201.seq - Invertebrate sequence entries, part 1201.
1085. gbinv1202.seq - Invertebrate sequence entries, part 1202.
1086. gbinv1203.seq - Invertebrate sequence entries, part 1203.
1087. gbinv1204.seq - Invertebrate sequence entries, part 1204.
1088. gbinv1205.seq - Invertebrate sequence entries, part 1205.
1089. gbinv1206.seq - Invertebrate sequence entries, part 1206.
1090. gbinv1207.seq - Invertebrate sequence entries, part 1207.
1091. gbinv1208.seq - Invertebrate sequence entries, part 1208.
1092. gbinv1209.seq - Invertebrate sequence entries, part 1209.
1093. gbinv121.seq - Invertebrate sequence entries, part 121.
1094. gbinv1210.seq - Invertebrate sequence entries, part 1210.
1095. gbinv1211.seq - Invertebrate sequence entries, part 1211.
1096. gbinv1212.seq - Invertebrate sequence entries, part 1212.
1097. gbinv1213.seq - Invertebrate sequence entries, part 1213.
1098. gbinv1214.seq - Invertebrate sequence entries, part 1214.
1099. gbinv1215.seq - Invertebrate sequence entries, part 1215.
1100. gbinv1216.seq - Invertebrate sequence entries, part 1216.
1101. gbinv1217.seq - Invertebrate sequence entries, part 1217.
1102. gbinv1218.seq - Invertebrate sequence entries, part 1218.
1103. gbinv1219.seq - Invertebrate sequence entries, part 1219.
1104. gbinv122.seq - Invertebrate sequence entries, part 122.
1105. gbinv1220.seq - Invertebrate sequence entries, part 1220.
1106. gbinv1221.seq - Invertebrate sequence entries, part 1221.
1107. gbinv1222.seq - Invertebrate sequence entries, part 1222.
1108. gbinv1223.seq - Invertebrate sequence entries, part 1223.
1109. gbinv1224.seq - Invertebrate sequence entries, part 1224.
1110. gbinv1225.seq - Invertebrate sequence entries, part 1225.
1111. gbinv1226.seq - Invertebrate sequence entries, part 1226.
1112. gbinv1227.seq - Invertebrate sequence entries, part 1227.
1113. gbinv1228.seq - Invertebrate sequence entries, part 1228.
1114. gbinv1229.seq - Invertebrate sequence entries, part 1229.
1115. gbinv123.seq - Invertebrate sequence entries, part 123.
1116. gbinv1230.seq - Invertebrate sequence entries, part 1230.
1117. gbinv1231.seq - Invertebrate sequence entries, part 1231.
1118. gbinv1232.seq - Invertebrate sequence entries, part 1232.
1119. gbinv1233.seq - Invertebrate sequence entries, part 1233.
1120. gbinv1234.seq - Invertebrate sequence entries, part 1234.
1121. gbinv1235.seq - Invertebrate sequence entries, part 1235.
1122. gbinv1236.seq - Invertebrate sequence entries, part 1236.
1123. gbinv1237.seq - Invertebrate sequence entries, part 1237.
1124. gbinv1238.seq - Invertebrate sequence entries, part 1238.
1125. gbinv1239.seq - Invertebrate sequence entries, part 1239.
1126. gbinv124.seq - Invertebrate sequence entries, part 124.
1127. gbinv1240.seq - Invertebrate sequence entries, part 1240.
1128. gbinv1241.seq - Invertebrate sequence entries, part 1241.
1129. gbinv1242.seq - Invertebrate sequence entries, part 1242.
1130. gbinv1243.seq - Invertebrate sequence entries, part 1243.
1131. gbinv1244.seq - Invertebrate sequence entries, part 1244.
1132. gbinv1245.seq - Invertebrate sequence entries, part 1245.
1133. gbinv1246.seq - Invertebrate sequence entries, part 1246.
1134. gbinv1247.seq - Invertebrate sequence entries, part 1247.
1135. gbinv1248.seq - Invertebrate sequence entries, part 1248.
1136. gbinv1249.seq - Invertebrate sequence entries, part 1249.
1137. gbinv125.seq - Invertebrate sequence entries, part 125.
1138. gbinv1250.seq - Invertebrate sequence entries, part 1250.
1139. gbinv1251.seq - Invertebrate sequence entries, part 1251.
1140. gbinv1252.seq - Invertebrate sequence entries, part 1252.
1141. gbinv1253.seq - Invertebrate sequence entries, part 1253.
1142. gbinv1254.seq - Invertebrate sequence entries, part 1254.
1143. gbinv1255.seq - Invertebrate sequence entries, part 1255.
1144. gbinv1256.seq - Invertebrate sequence entries, part 1256.
1145. gbinv1257.seq - Invertebrate sequence entries, part 1257.
1146. gbinv1258.seq - Invertebrate sequence entries, part 1258.
1147. gbinv1259.seq - Invertebrate sequence entries, part 1259.
1148. gbinv126.seq - Invertebrate sequence entries, part 126.
1149. gbinv1260.seq - Invertebrate sequence entries, part 1260.
1150. gbinv1261.seq - Invertebrate sequence entries, part 1261.
1151. gbinv1262.seq - Invertebrate sequence entries, part 1262.
1152. gbinv1263.seq - Invertebrate sequence entries, part 1263.
1153. gbinv1264.seq - Invertebrate sequence entries, part 1264.
1154. gbinv1265.seq - Invertebrate sequence entries, part 1265.
1155. gbinv1266.seq - Invertebrate sequence entries, part 1266.
1156. gbinv1267.seq - Invertebrate sequence entries, part 1267.
1157. gbinv1268.seq - Invertebrate sequence entries, part 1268.
1158. gbinv1269.seq - Invertebrate sequence entries, part 1269.
1159. gbinv127.seq - Invertebrate sequence entries, part 127.
1160. gbinv1270.seq - Invertebrate sequence entries, part 1270.
1161. gbinv1271.seq - Invertebrate sequence entries, part 1271.
1162. gbinv1272.seq - Invertebrate sequence entries, part 1272.
1163. gbinv1273.seq - Invertebrate sequence entries, part 1273.
1164. gbinv1274.seq - Invertebrate sequence entries, part 1274.
1165. gbinv1275.seq - Invertebrate sequence entries, part 1275.
1166. gbinv1276.seq - Invertebrate sequence entries, part 1276.
1167. gbinv1277.seq - Invertebrate sequence entries, part 1277.
1168. gbinv1278.seq - Invertebrate sequence entries, part 1278.
1169. gbinv1279.seq - Invertebrate sequence entries, part 1279.
1170. gbinv128.seq - Invertebrate sequence entries, part 128.
1171. gbinv1280.seq - Invertebrate sequence entries, part 1280.
1172. gbinv1281.seq - Invertebrate sequence entries, part 1281.
1173. gbinv1282.seq - Invertebrate sequence entries, part 1282.
1174. gbinv1283.seq - Invertebrate sequence entries, part 1283.
1175. gbinv1284.seq - Invertebrate sequence entries, part 1284.
1176. gbinv1285.seq - Invertebrate sequence entries, part 1285.
1177. gbinv1286.seq - Invertebrate sequence entries, part 1286.
1178. gbinv1287.seq - Invertebrate sequence entries, part 1287.
1179. gbinv1288.seq - Invertebrate sequence entries, part 1288.
1180. gbinv1289.seq - Invertebrate sequence entries, part 1289.
1181. gbinv129.seq - Invertebrate sequence entries, part 129.
1182. gbinv1290.seq - Invertebrate sequence entries, part 1290.
1183. gbinv1291.seq - Invertebrate sequence entries, part 1291.
1184. gbinv1292.seq - Invertebrate sequence entries, part 1292.
1185. gbinv1293.seq - Invertebrate sequence entries, part 1293.
1186. gbinv1294.seq - Invertebrate sequence entries, part 1294.
1187. gbinv1295.seq - Invertebrate sequence entries, part 1295.
1188. gbinv1296.seq - Invertebrate sequence entries, part 1296.
1189. gbinv1297.seq - Invertebrate sequence entries, part 1297.
1190. gbinv1298.seq - Invertebrate sequence entries, part 1298.
1191. gbinv1299.seq - Invertebrate sequence entries, part 1299.
1192. gbinv13.seq - Invertebrate sequence entries, part 13.
1193. gbinv130.seq - Invertebrate sequence entries, part 130.
1194. gbinv1300.seq - Invertebrate sequence entries, part 1300.
1195. gbinv1301.seq - Invertebrate sequence entries, part 1301.
1196. gbinv1302.seq - Invertebrate sequence entries, part 1302.
1197. gbinv1303.seq - Invertebrate sequence entries, part 1303.
1198. gbinv1304.seq - Invertebrate sequence entries, part 1304.
1199. gbinv1305.seq - Invertebrate sequence entries, part 1305.
1200. gbinv1306.seq - Invertebrate sequence entries, part 1306.
1201. gbinv1307.seq - Invertebrate sequence entries, part 1307.
1202. gbinv1308.seq - Invertebrate sequence entries, part 1308.
1203. gbinv1309.seq - Invertebrate sequence entries, part 1309.
1204. gbinv131.seq - Invertebrate sequence entries, part 131.
1205. gbinv1310.seq - Invertebrate sequence entries, part 1310.
1206. gbinv1311.seq - Invertebrate sequence entries, part 1311.
1207. gbinv1312.seq - Invertebrate sequence entries, part 1312.
1208. gbinv1313.seq - Invertebrate sequence entries, part 1313.
1209. gbinv1314.seq - Invertebrate sequence entries, part 1314.
1210. gbinv1315.seq - Invertebrate sequence entries, part 1315.
1211. gbinv1316.seq - Invertebrate sequence entries, part 1316.
1212. gbinv1317.seq - Invertebrate sequence entries, part 1317.
1213. gbinv1318.seq - Invertebrate sequence entries, part 1318.
1214. gbinv1319.seq - Invertebrate sequence entries, part 1319.
1215. gbinv132.seq - Invertebrate sequence entries, part 132.
1216. gbinv1320.seq - Invertebrate sequence entries, part 1320.
1217. gbinv1321.seq - Invertebrate sequence entries, part 1321.
1218. gbinv1322.seq - Invertebrate sequence entries, part 1322.
1219. gbinv1323.seq - Invertebrate sequence entries, part 1323.
1220. gbinv1324.seq - Invertebrate sequence entries, part 1324.
1221. gbinv1325.seq - Invertebrate sequence entries, part 1325.
1222. gbinv1326.seq - Invertebrate sequence entries, part 1326.
1223. gbinv1327.seq - Invertebrate sequence entries, part 1327.
1224. gbinv1328.seq - Invertebrate sequence entries, part 1328.
1225. gbinv1329.seq - Invertebrate sequence entries, part 1329.
1226. gbinv133.seq - Invertebrate sequence entries, part 133.
1227. gbinv1330.seq - Invertebrate sequence entries, part 1330.
1228. gbinv1331.seq - Invertebrate sequence entries, part 1331.
1229. gbinv1332.seq - Invertebrate sequence entries, part 1332.
1230. gbinv1333.seq - Invertebrate sequence entries, part 1333.
1231. gbinv1334.seq - Invertebrate sequence entries, part 1334.
1232. gbinv1335.seq - Invertebrate sequence entries, part 1335.
1233. gbinv1336.seq - Invertebrate sequence entries, part 1336.
1234. gbinv1337.seq - Invertebrate sequence entries, part 1337.
1235. gbinv1338.seq - Invertebrate sequence entries, part 1338.
1236. gbinv1339.seq - Invertebrate sequence entries, part 1339.
1237. gbinv134.seq - Invertebrate sequence entries, part 134.
1238. gbinv1340.seq - Invertebrate sequence entries, part 1340.
1239. gbinv1341.seq - Invertebrate sequence entries, part 1341.
1240. gbinv1342.seq - Invertebrate sequence entries, part 1342.
1241. gbinv1343.seq - Invertebrate sequence entries, part 1343.
1242. gbinv1344.seq - Invertebrate sequence entries, part 1344.
1243. gbinv1345.seq - Invertebrate sequence entries, part 1345.
1244. gbinv1346.seq - Invertebrate sequence entries, part 1346.
1245. gbinv1347.seq - Invertebrate sequence entries, part 1347.
1246. gbinv1348.seq - Invertebrate sequence entries, part 1348.
1247. gbinv1349.seq - Invertebrate sequence entries, part 1349.
1248. gbinv135.seq - Invertebrate sequence entries, part 135.
1249. gbinv1350.seq - Invertebrate sequence entries, part 1350.
1250. gbinv1351.seq - Invertebrate sequence entries, part 1351.
1251. gbinv1352.seq - Invertebrate sequence entries, part 1352.
1252. gbinv1353.seq - Invertebrate sequence entries, part 1353.
1253. gbinv1354.seq - Invertebrate sequence entries, part 1354.
1254. gbinv1355.seq - Invertebrate sequence entries, part 1355.
1255. gbinv1356.seq - Invertebrate sequence entries, part 1356.
1256. gbinv1357.seq - Invertebrate sequence entries, part 1357.
1257. gbinv1358.seq - Invertebrate sequence entries, part 1358.
1258. gbinv1359.seq - Invertebrate sequence entries, part 1359.
1259. gbinv136.seq - Invertebrate sequence entries, part 136.
1260. gbinv1360.seq - Invertebrate sequence entries, part 1360.
1261. gbinv1361.seq - Invertebrate sequence entries, part 1361.
1262. gbinv1362.seq - Invertebrate sequence entries, part 1362.
1263. gbinv1363.seq - Invertebrate sequence entries, part 1363.
1264. gbinv1364.seq - Invertebrate sequence entries, part 1364.
1265. gbinv1365.seq - Invertebrate sequence entries, part 1365.
1266. gbinv1366.seq - Invertebrate sequence entries, part 1366.
1267. gbinv1367.seq - Invertebrate sequence entries, part 1367.
1268. gbinv1368.seq - Invertebrate sequence entries, part 1368.
1269. gbinv1369.seq - Invertebrate sequence entries, part 1369.
1270. gbinv137.seq - Invertebrate sequence entries, part 137.
1271. gbinv1370.seq - Invertebrate sequence entries, part 1370.
1272. gbinv1371.seq - Invertebrate sequence entries, part 1371.
1273. gbinv1372.seq - Invertebrate sequence entries, part 1372.
1274. gbinv1373.seq - Invertebrate sequence entries, part 1373.
1275. gbinv1374.seq - Invertebrate sequence entries, part 1374.
1276. gbinv1375.seq - Invertebrate sequence entries, part 1375.
1277. gbinv1376.seq - Invertebrate sequence entries, part 1376.
1278. gbinv1377.seq - Invertebrate sequence entries, part 1377.
1279. gbinv1378.seq - Invertebrate sequence entries, part 1378.
1280. gbinv1379.seq - Invertebrate sequence entries, part 1379.
1281. gbinv138.seq - Invertebrate sequence entries, part 138.
1282. gbinv1380.seq - Invertebrate sequence entries, part 1380.
1283. gbinv1381.seq - Invertebrate sequence entries, part 1381.
1284. gbinv1382.seq - Invertebrate sequence entries, part 1382.
1285. gbinv1383.seq - Invertebrate sequence entries, part 1383.
1286. gbinv1384.seq - Invertebrate sequence entries, part 1384.
1287. gbinv1385.seq - Invertebrate sequence entries, part 1385.
1288. gbinv1386.seq - Invertebrate sequence entries, part 1386.
1289. gbinv1387.seq - Invertebrate sequence entries, part 1387.
1290. gbinv1388.seq - Invertebrate sequence entries, part 1388.
1291. gbinv1389.seq - Invertebrate sequence entries, part 1389.
1292. gbinv139.seq - Invertebrate sequence entries, part 139.
1293. gbinv1390.seq - Invertebrate sequence entries, part 1390.
1294. gbinv1391.seq - Invertebrate sequence entries, part 1391.
1295. gbinv1392.seq - Invertebrate sequence entries, part 1392.
1296. gbinv1393.seq - Invertebrate sequence entries, part 1393.
1297. gbinv1394.seq - Invertebrate sequence entries, part 1394.
1298. gbinv1395.seq - Invertebrate sequence entries, part 1395.
1299. gbinv1396.seq - Invertebrate sequence entries, part 1396.
1300. gbinv1397.seq - Invertebrate sequence entries, part 1397.
1301. gbinv1398.seq - Invertebrate sequence entries, part 1398.
1302. gbinv1399.seq - Invertebrate sequence entries, part 1399.
1303. gbinv14.seq - Invertebrate sequence entries, part 14.
1304. gbinv140.seq - Invertebrate sequence entries, part 140.
1305. gbinv1400.seq - Invertebrate sequence entries, part 1400.
1306. gbinv1401.seq - Invertebrate sequence entries, part 1401.
1307. gbinv1402.seq - Invertebrate sequence entries, part 1402.
1308. gbinv1403.seq - Invertebrate sequence entries, part 1403.
1309. gbinv1404.seq - Invertebrate sequence entries, part 1404.
1310. gbinv1405.seq - Invertebrate sequence entries, part 1405.
1311. gbinv1406.seq - Invertebrate sequence entries, part 1406.
1312. gbinv1407.seq - Invertebrate sequence entries, part 1407.
1313. gbinv1408.seq - Invertebrate sequence entries, part 1408.
1314. gbinv1409.seq - Invertebrate sequence entries, part 1409.
1315. gbinv141.seq - Invertebrate sequence entries, part 141.
1316. gbinv1410.seq - Invertebrate sequence entries, part 1410.
1317. gbinv1411.seq - Invertebrate sequence entries, part 1411.
1318. gbinv1412.seq - Invertebrate sequence entries, part 1412.
1319. gbinv1413.seq - Invertebrate sequence entries, part 1413.
1320. gbinv1414.seq - Invertebrate sequence entries, part 1414.
1321. gbinv1415.seq - Invertebrate sequence entries, part 1415.
1322. gbinv1416.seq - Invertebrate sequence entries, part 1416.
1323. gbinv1417.seq - Invertebrate sequence entries, part 1417.
1324. gbinv1418.seq - Invertebrate sequence entries, part 1418.
1325. gbinv1419.seq - Invertebrate sequence entries, part 1419.
1326. gbinv142.seq - Invertebrate sequence entries, part 142.
1327. gbinv1420.seq - Invertebrate sequence entries, part 1420.
1328. gbinv1421.seq - Invertebrate sequence entries, part 1421.
1329. gbinv1422.seq - Invertebrate sequence entries, part 1422.
1330. gbinv1423.seq - Invertebrate sequence entries, part 1423.
1331. gbinv1424.seq - Invertebrate sequence entries, part 1424.
1332. gbinv1425.seq - Invertebrate sequence entries, part 1425.
1333. gbinv1426.seq - Invertebrate sequence entries, part 1426.
1334. gbinv1427.seq - Invertebrate sequence entries, part 1427.
1335. gbinv1428.seq - Invertebrate sequence entries, part 1428.
1336. gbinv1429.seq - Invertebrate sequence entries, part 1429.
1337. gbinv143.seq - Invertebrate sequence entries, part 143.
1338. gbinv1430.seq - Invertebrate sequence entries, part 1430.
1339. gbinv1431.seq - Invertebrate sequence entries, part 1431.
1340. gbinv1432.seq - Invertebrate sequence entries, part 1432.
1341. gbinv1433.seq - Invertebrate sequence entries, part 1433.
1342. gbinv1434.seq - Invertebrate sequence entries, part 1434.
1343. gbinv1435.seq - Invertebrate sequence entries, part 1435.
1344. gbinv1436.seq - Invertebrate sequence entries, part 1436.
1345. gbinv1437.seq - Invertebrate sequence entries, part 1437.
1346. gbinv1438.seq - Invertebrate sequence entries, part 1438.
1347. gbinv1439.seq - Invertebrate sequence entries, part 1439.
1348. gbinv144.seq - Invertebrate sequence entries, part 144.
1349. gbinv1440.seq - Invertebrate sequence entries, part 1440.
1350. gbinv1441.seq - Invertebrate sequence entries, part 1441.
1351. gbinv1442.seq - Invertebrate sequence entries, part 1442.
1352. gbinv1443.seq - Invertebrate sequence entries, part 1443.
1353. gbinv1444.seq - Invertebrate sequence entries, part 1444.
1354. gbinv1445.seq - Invertebrate sequence entries, part 1445.
1355. gbinv1446.seq - Invertebrate sequence entries, part 1446.
1356. gbinv1447.seq - Invertebrate sequence entries, part 1447.
1357. gbinv1448.seq - Invertebrate sequence entries, part 1448.
1358. gbinv1449.seq - Invertebrate sequence entries, part 1449.
1359. gbinv145.seq - Invertebrate sequence entries, part 145.
1360. gbinv1450.seq - Invertebrate sequence entries, part 1450.
1361. gbinv1451.seq - Invertebrate sequence entries, part 1451.
1362. gbinv1452.seq - Invertebrate sequence entries, part 1452.
1363. gbinv1453.seq - Invertebrate sequence entries, part 1453.
1364. gbinv1454.seq - Invertebrate sequence entries, part 1454.
1365. gbinv1455.seq - Invertebrate sequence entries, part 1455.
1366. gbinv1456.seq - Invertebrate sequence entries, part 1456.
1367. gbinv1457.seq - Invertebrate sequence entries, part 1457.
1368. gbinv1458.seq - Invertebrate sequence entries, part 1458.
1369. gbinv1459.seq - Invertebrate sequence entries, part 1459.
1370. gbinv146.seq - Invertebrate sequence entries, part 146.
1371. gbinv1460.seq - Invertebrate sequence entries, part 1460.
1372. gbinv1461.seq - Invertebrate sequence entries, part 1461.
1373. gbinv1462.seq - Invertebrate sequence entries, part 1462.
1374. gbinv1463.seq - Invertebrate sequence entries, part 1463.
1375. gbinv1464.seq - Invertebrate sequence entries, part 1464.
1376. gbinv1465.seq - Invertebrate sequence entries, part 1465.
1377. gbinv1466.seq - Invertebrate sequence entries, part 1466.
1378. gbinv1467.seq - Invertebrate sequence entries, part 1467.
1379. gbinv1468.seq - Invertebrate sequence entries, part 1468.
1380. gbinv1469.seq - Invertebrate sequence entries, part 1469.
1381. gbinv147.seq - Invertebrate sequence entries, part 147.
1382. gbinv1470.seq - Invertebrate sequence entries, part 1470.
1383. gbinv1471.seq - Invertebrate sequence entries, part 1471.
1384. gbinv1472.seq - Invertebrate sequence entries, part 1472.
1385. gbinv1473.seq - Invertebrate sequence entries, part 1473.
1386. gbinv1474.seq - Invertebrate sequence entries, part 1474.
1387. gbinv1475.seq - Invertebrate sequence entries, part 1475.
1388. gbinv1476.seq - Invertebrate sequence entries, part 1476.
1389. gbinv1477.seq - Invertebrate sequence entries, part 1477.
1390. gbinv1478.seq - Invertebrate sequence entries, part 1478.
1391. gbinv1479.seq - Invertebrate sequence entries, part 1479.
1392. gbinv148.seq - Invertebrate sequence entries, part 148.
1393. gbinv1480.seq - Invertebrate sequence entries, part 1480.
1394. gbinv1481.seq - Invertebrate sequence entries, part 1481.
1395. gbinv1482.seq - Invertebrate sequence entries, part 1482.
1396. gbinv1483.seq - Invertebrate sequence entries, part 1483.
1397. gbinv1484.seq - Invertebrate sequence entries, part 1484.
1398. gbinv1485.seq - Invertebrate sequence entries, part 1485.
1399. gbinv1486.seq - Invertebrate sequence entries, part 1486.
1400. gbinv1487.seq - Invertebrate sequence entries, part 1487.
1401. gbinv1488.seq - Invertebrate sequence entries, part 1488.
1402. gbinv1489.seq - Invertebrate sequence entries, part 1489.
1403. gbinv149.seq - Invertebrate sequence entries, part 149.
1404. gbinv1490.seq - Invertebrate sequence entries, part 1490.
1405. gbinv1491.seq - Invertebrate sequence entries, part 1491.
1406. gbinv1492.seq - Invertebrate sequence entries, part 1492.
1407. gbinv1493.seq - Invertebrate sequence entries, part 1493.
1408. gbinv1494.seq - Invertebrate sequence entries, part 1494.
1409. gbinv1495.seq - Invertebrate sequence entries, part 1495.
1410. gbinv1496.seq - Invertebrate sequence entries, part 1496.
1411. gbinv1497.seq - Invertebrate sequence entries, part 1497.
1412. gbinv1498.seq - Invertebrate sequence entries, part 1498.
1413. gbinv1499.seq - Invertebrate sequence entries, part 1499.
1414. gbinv15.seq - Invertebrate sequence entries, part 15.
1415. gbinv150.seq - Invertebrate sequence entries, part 150.
1416. gbinv1500.seq - Invertebrate sequence entries, part 1500.
1417. gbinv1501.seq - Invertebrate sequence entries, part 1501.
1418. gbinv1502.seq - Invertebrate sequence entries, part 1502.
1419. gbinv1503.seq - Invertebrate sequence entries, part 1503.
1420. gbinv1504.seq - Invertebrate sequence entries, part 1504.
1421. gbinv1505.seq - Invertebrate sequence entries, part 1505.
1422. gbinv1506.seq - Invertebrate sequence entries, part 1506.
1423. gbinv1507.seq - Invertebrate sequence entries, part 1507.
1424. gbinv1508.seq - Invertebrate sequence entries, part 1508.
1425. gbinv1509.seq - Invertebrate sequence entries, part 1509.
1426. gbinv151.seq - Invertebrate sequence entries, part 151.
1427. gbinv1510.seq - Invertebrate sequence entries, part 1510.
1428. gbinv1511.seq - Invertebrate sequence entries, part 1511.
1429. gbinv1512.seq - Invertebrate sequence entries, part 1512.
1430. gbinv1513.seq - Invertebrate sequence entries, part 1513.
1431. gbinv152.seq - Invertebrate sequence entries, part 152.
1432. gbinv153.seq - Invertebrate sequence entries, part 153.
1433. gbinv154.seq - Invertebrate sequence entries, part 154.
1434. gbinv155.seq - Invertebrate sequence entries, part 155.
1435. gbinv156.seq - Invertebrate sequence entries, part 156.
1436. gbinv157.seq - Invertebrate sequence entries, part 157.
1437. gbinv158.seq - Invertebrate sequence entries, part 158.
1438. gbinv159.seq - Invertebrate sequence entries, part 159.
1439. gbinv16.seq - Invertebrate sequence entries, part 16.
1440. gbinv160.seq - Invertebrate sequence entries, part 160.
1441. gbinv161.seq - Invertebrate sequence entries, part 161.
1442. gbinv162.seq - Invertebrate sequence entries, part 162.
1443. gbinv163.seq - Invertebrate sequence entries, part 163.
1444. gbinv164.seq - Invertebrate sequence entries, part 164.
1445. gbinv165.seq - Invertebrate sequence entries, part 165.
1446. gbinv166.seq - Invertebrate sequence entries, part 166.
1447. gbinv167.seq - Invertebrate sequence entries, part 167.
1448. gbinv168.seq - Invertebrate sequence entries, part 168.
1449. gbinv169.seq - Invertebrate sequence entries, part 169.
1450. gbinv17.seq - Invertebrate sequence entries, part 17.
1451. gbinv170.seq - Invertebrate sequence entries, part 170.
1452. gbinv171.seq - Invertebrate sequence entries, part 171.
1453. gbinv172.seq - Invertebrate sequence entries, part 172.
1454. gbinv173.seq - Invertebrate sequence entries, part 173.
1455. gbinv174.seq - Invertebrate sequence entries, part 174.
1456. gbinv175.seq - Invertebrate sequence entries, part 175.
1457. gbinv176.seq - Invertebrate sequence entries, part 176.
1458. gbinv177.seq - Invertebrate sequence entries, part 177.
1459. gbinv178.seq - Invertebrate sequence entries, part 178.
1460. gbinv179.seq - Invertebrate sequence entries, part 179.
1461. gbinv18.seq - Invertebrate sequence entries, part 18.
1462. gbinv180.seq - Invertebrate sequence entries, part 180.
1463. gbinv181.seq - Invertebrate sequence entries, part 181.
1464. gbinv182.seq - Invertebrate sequence entries, part 182.
1465. gbinv183.seq - Invertebrate sequence entries, part 183.
1466. gbinv184.seq - Invertebrate sequence entries, part 184.
1467. gbinv185.seq - Invertebrate sequence entries, part 185.
1468. gbinv186.seq - Invertebrate sequence entries, part 186.
1469. gbinv187.seq - Invertebrate sequence entries, part 187.
1470. gbinv188.seq - Invertebrate sequence entries, part 188.
1471. gbinv189.seq - Invertebrate sequence entries, part 189.
1472. gbinv19.seq - Invertebrate sequence entries, part 19.
1473. gbinv190.seq - Invertebrate sequence entries, part 190.
1474. gbinv191.seq - Invertebrate sequence entries, part 191.
1475. gbinv192.seq - Invertebrate sequence entries, part 192.
1476. gbinv193.seq - Invertebrate sequence entries, part 193.
1477. gbinv194.seq - Invertebrate sequence entries, part 194.
1478. gbinv195.seq - Invertebrate sequence entries, part 195.
1479. gbinv196.seq - Invertebrate sequence entries, part 196.
1480. gbinv197.seq - Invertebrate sequence entries, part 197.
1481. gbinv198.seq - Invertebrate sequence entries, part 198.
1482. gbinv199.seq - Invertebrate sequence entries, part 199.
1483. gbinv2.seq - Invertebrate sequence entries, part 2.
1484. gbinv20.seq - Invertebrate sequence entries, part 20.
1485. gbinv200.seq - Invertebrate sequence entries, part 200.
1486. gbinv201.seq - Invertebrate sequence entries, part 201.
1487. gbinv202.seq - Invertebrate sequence entries, part 202.
1488. gbinv203.seq - Invertebrate sequence entries, part 203.
1489. gbinv204.seq - Invertebrate sequence entries, part 204.
1490. gbinv205.seq - Invertebrate sequence entries, part 205.
1491. gbinv206.seq - Invertebrate sequence entries, part 206.
1492. gbinv207.seq - Invertebrate sequence entries, part 207.
1493. gbinv208.seq - Invertebrate sequence entries, part 208.
1494. gbinv209.seq - Invertebrate sequence entries, part 209.
1495. gbinv21.seq - Invertebrate sequence entries, part 21.
1496. gbinv210.seq - Invertebrate sequence entries, part 210.
1497. gbinv211.seq - Invertebrate sequence entries, part 211.
1498. gbinv212.seq - Invertebrate sequence entries, part 212.
1499. gbinv213.seq - Invertebrate sequence entries, part 213.
1500. gbinv214.seq - Invertebrate sequence entries, part 214.
1501. gbinv215.seq - Invertebrate sequence entries, part 215.
1502. gbinv216.seq - Invertebrate sequence entries, part 216.
1503. gbinv217.seq - Invertebrate sequence entries, part 217.
1504. gbinv218.seq - Invertebrate sequence entries, part 218.
1505. gbinv219.seq - Invertebrate sequence entries, part 219.
1506. gbinv22.seq - Invertebrate sequence entries, part 22.
1507. gbinv220.seq - Invertebrate sequence entries, part 220.
1508. gbinv221.seq - Invertebrate sequence entries, part 221.
1509. gbinv222.seq - Invertebrate sequence entries, part 222.
1510. gbinv223.seq - Invertebrate sequence entries, part 223.
1511. gbinv224.seq - Invertebrate sequence entries, part 224.
1512. gbinv225.seq - Invertebrate sequence entries, part 225.
1513. gbinv226.seq - Invertebrate sequence entries, part 226.
1514. gbinv227.seq - Invertebrate sequence entries, part 227.
1515. gbinv228.seq - Invertebrate sequence entries, part 228.
1516. gbinv229.seq - Invertebrate sequence entries, part 229.
1517. gbinv23.seq - Invertebrate sequence entries, part 23.
1518. gbinv230.seq - Invertebrate sequence entries, part 230.
1519. gbinv231.seq - Invertebrate sequence entries, part 231.
1520. gbinv232.seq - Invertebrate sequence entries, part 232.
1521. gbinv233.seq - Invertebrate sequence entries, part 233.
1522. gbinv234.seq - Invertebrate sequence entries, part 234.
1523. gbinv235.seq - Invertebrate sequence entries, part 235.
1524. gbinv236.seq - Invertebrate sequence entries, part 236.
1525. gbinv237.seq - Invertebrate sequence entries, part 237.
1526. gbinv238.seq - Invertebrate sequence entries, part 238.
1527. gbinv239.seq - Invertebrate sequence entries, part 239.
1528. gbinv24.seq - Invertebrate sequence entries, part 24.
1529. gbinv240.seq - Invertebrate sequence entries, part 240.
1530. gbinv241.seq - Invertebrate sequence entries, part 241.
1531. gbinv242.seq - Invertebrate sequence entries, part 242.
1532. gbinv243.seq - Invertebrate sequence entries, part 243.
1533. gbinv244.seq - Invertebrate sequence entries, part 244.
1534. gbinv245.seq - Invertebrate sequence entries, part 245.
1535. gbinv246.seq - Invertebrate sequence entries, part 246.
1536. gbinv247.seq - Invertebrate sequence entries, part 247.
1537. gbinv248.seq - Invertebrate sequence entries, part 248.
1538. gbinv249.seq - Invertebrate sequence entries, part 249.
1539. gbinv25.seq - Invertebrate sequence entries, part 25.
1540. gbinv250.seq - Invertebrate sequence entries, part 250.
1541. gbinv251.seq - Invertebrate sequence entries, part 251.
1542. gbinv252.seq - Invertebrate sequence entries, part 252.
1543. gbinv253.seq - Invertebrate sequence entries, part 253.
1544. gbinv254.seq - Invertebrate sequence entries, part 254.
1545. gbinv255.seq - Invertebrate sequence entries, part 255.
1546. gbinv256.seq - Invertebrate sequence entries, part 256.
1547. gbinv257.seq - Invertebrate sequence entries, part 257.
1548. gbinv258.seq - Invertebrate sequence entries, part 258.
1549. gbinv259.seq - Invertebrate sequence entries, part 259.
1550. gbinv26.seq - Invertebrate sequence entries, part 26.
1551. gbinv260.seq - Invertebrate sequence entries, part 260.
1552. gbinv261.seq - Invertebrate sequence entries, part 261.
1553. gbinv262.seq - Invertebrate sequence entries, part 262.
1554. gbinv263.seq - Invertebrate sequence entries, part 263.
1555. gbinv264.seq - Invertebrate sequence entries, part 264.
1556. gbinv265.seq - Invertebrate sequence entries, part 265.
1557. gbinv266.seq - Invertebrate sequence entries, part 266.
1558. gbinv267.seq - Invertebrate sequence entries, part 267.
1559. gbinv268.seq - Invertebrate sequence entries, part 268.
1560. gbinv269.seq - Invertebrate sequence entries, part 269.
1561. gbinv27.seq - Invertebrate sequence entries, part 27.
1562. gbinv270.seq - Invertebrate sequence entries, part 270.
1563. gbinv271.seq - Invertebrate sequence entries, part 271.
1564. gbinv272.seq - Invertebrate sequence entries, part 272.
1565. gbinv273.seq - Invertebrate sequence entries, part 273.
1566. gbinv274.seq - Invertebrate sequence entries, part 274.
1567. gbinv275.seq - Invertebrate sequence entries, part 275.
1568. gbinv276.seq - Invertebrate sequence entries, part 276.
1569. gbinv277.seq - Invertebrate sequence entries, part 277.
1570. gbinv278.seq - Invertebrate sequence entries, part 278.
1571. gbinv279.seq - Invertebrate sequence entries, part 279.
1572. gbinv28.seq - Invertebrate sequence entries, part 28.
1573. gbinv280.seq - Invertebrate sequence entries, part 280.
1574. gbinv281.seq - Invertebrate sequence entries, part 281.
1575. gbinv282.seq - Invertebrate sequence entries, part 282.
1576. gbinv283.seq - Invertebrate sequence entries, part 283.
1577. gbinv284.seq - Invertebrate sequence entries, part 284.
1578. gbinv285.seq - Invertebrate sequence entries, part 285.
1579. gbinv286.seq - Invertebrate sequence entries, part 286.
1580. gbinv287.seq - Invertebrate sequence entries, part 287.
1581. gbinv288.seq - Invertebrate sequence entries, part 288.
1582. gbinv289.seq - Invertebrate sequence entries, part 289.
1583. gbinv29.seq - Invertebrate sequence entries, part 29.
1584. gbinv290.seq - Invertebrate sequence entries, part 290.
1585. gbinv291.seq - Invertebrate sequence entries, part 291.
1586. gbinv292.seq - Invertebrate sequence entries, part 292.
1587. gbinv293.seq - Invertebrate sequence entries, part 293.
1588. gbinv294.seq - Invertebrate sequence entries, part 294.
1589. gbinv295.seq - Invertebrate sequence entries, part 295.
1590. gbinv296.seq - Invertebrate sequence entries, part 296.
1591. gbinv297.seq - Invertebrate sequence entries, part 297.
1592. gbinv298.seq - Invertebrate sequence entries, part 298.
1593. gbinv299.seq - Invertebrate sequence entries, part 299.
1594. gbinv3.seq - Invertebrate sequence entries, part 3.
1595. gbinv30.seq - Invertebrate sequence entries, part 30.
1596. gbinv300.seq - Invertebrate sequence entries, part 300.
1597. gbinv301.seq - Invertebrate sequence entries, part 301.
1598. gbinv302.seq - Invertebrate sequence entries, part 302.
1599. gbinv303.seq - Invertebrate sequence entries, part 303.
1600. gbinv304.seq - Invertebrate sequence entries, part 304.
1601. gbinv305.seq - Invertebrate sequence entries, part 305.
1602. gbinv306.seq - Invertebrate sequence entries, part 306.
1603. gbinv307.seq - Invertebrate sequence entries, part 307.
1604. gbinv308.seq - Invertebrate sequence entries, part 308.
1605. gbinv309.seq - Invertebrate sequence entries, part 309.
1606. gbinv31.seq - Invertebrate sequence entries, part 31.
1607. gbinv310.seq - Invertebrate sequence entries, part 310.
1608. gbinv311.seq - Invertebrate sequence entries, part 311.
1609. gbinv312.seq - Invertebrate sequence entries, part 312.
1610. gbinv313.seq - Invertebrate sequence entries, part 313.
1611. gbinv314.seq - Invertebrate sequence entries, part 314.
1612. gbinv315.seq - Invertebrate sequence entries, part 315.
1613. gbinv316.seq - Invertebrate sequence entries, part 316.
1614. gbinv317.seq - Invertebrate sequence entries, part 317.
1615. gbinv318.seq - Invertebrate sequence entries, part 318.
1616. gbinv319.seq - Invertebrate sequence entries, part 319.
1617. gbinv32.seq - Invertebrate sequence entries, part 32.
1618. gbinv320.seq - Invertebrate sequence entries, part 320.
1619. gbinv321.seq - Invertebrate sequence entries, part 321.
1620. gbinv322.seq - Invertebrate sequence entries, part 322.
1621. gbinv323.seq - Invertebrate sequence entries, part 323.
1622. gbinv324.seq - Invertebrate sequence entries, part 324.
1623. gbinv325.seq - Invertebrate sequence entries, part 325.
1624. gbinv326.seq - Invertebrate sequence entries, part 326.
1625. gbinv327.seq - Invertebrate sequence entries, part 327.
1626. gbinv328.seq - Invertebrate sequence entries, part 328.
1627. gbinv329.seq - Invertebrate sequence entries, part 329.
1628. gbinv33.seq - Invertebrate sequence entries, part 33.
1629. gbinv330.seq - Invertebrate sequence entries, part 330.
1630. gbinv331.seq - Invertebrate sequence entries, part 331.
1631. gbinv332.seq - Invertebrate sequence entries, part 332.
1632. gbinv333.seq - Invertebrate sequence entries, part 333.
1633. gbinv334.seq - Invertebrate sequence entries, part 334.
1634. gbinv335.seq - Invertebrate sequence entries, part 335.
1635. gbinv336.seq - Invertebrate sequence entries, part 336.
1636. gbinv337.seq - Invertebrate sequence entries, part 337.
1637. gbinv338.seq - Invertebrate sequence entries, part 338.
1638. gbinv339.seq - Invertebrate sequence entries, part 339.
1639. gbinv34.seq - Invertebrate sequence entries, part 34.
1640. gbinv340.seq - Invertebrate sequence entries, part 340.
1641. gbinv341.seq - Invertebrate sequence entries, part 341.
1642. gbinv342.seq - Invertebrate sequence entries, part 342.
1643. gbinv343.seq - Invertebrate sequence entries, part 343.
1644. gbinv344.seq - Invertebrate sequence entries, part 344.
1645. gbinv345.seq - Invertebrate sequence entries, part 345.
1646. gbinv346.seq - Invertebrate sequence entries, part 346.
1647. gbinv347.seq - Invertebrate sequence entries, part 347.
1648. gbinv348.seq - Invertebrate sequence entries, part 348.
1649. gbinv349.seq - Invertebrate sequence entries, part 349.
1650. gbinv35.seq - Invertebrate sequence entries, part 35.
1651. gbinv350.seq - Invertebrate sequence entries, part 350.
1652. gbinv351.seq - Invertebrate sequence entries, part 351.
1653. gbinv352.seq - Invertebrate sequence entries, part 352.
1654. gbinv353.seq - Invertebrate sequence entries, part 353.
1655. gbinv354.seq - Invertebrate sequence entries, part 354.
1656. gbinv355.seq - Invertebrate sequence entries, part 355.
1657. gbinv356.seq - Invertebrate sequence entries, part 356.
1658. gbinv357.seq - Invertebrate sequence entries, part 357.
1659. gbinv358.seq - Invertebrate sequence entries, part 358.
1660. gbinv359.seq - Invertebrate sequence entries, part 359.
1661. gbinv36.seq - Invertebrate sequence entries, part 36.
1662. gbinv360.seq - Invertebrate sequence entries, part 360.
1663. gbinv361.seq - Invertebrate sequence entries, part 361.
1664. gbinv362.seq - Invertebrate sequence entries, part 362.
1665. gbinv363.seq - Invertebrate sequence entries, part 363.
1666. gbinv364.seq - Invertebrate sequence entries, part 364.
1667. gbinv365.seq - Invertebrate sequence entries, part 365.
1668. gbinv366.seq - Invertebrate sequence entries, part 366.
1669. gbinv367.seq - Invertebrate sequence entries, part 367.
1670. gbinv368.seq - Invertebrate sequence entries, part 368.
1671. gbinv369.seq - Invertebrate sequence entries, part 369.
1672. gbinv37.seq - Invertebrate sequence entries, part 37.
1673. gbinv370.seq - Invertebrate sequence entries, part 370.
1674. gbinv371.seq - Invertebrate sequence entries, part 371.
1675. gbinv372.seq - Invertebrate sequence entries, part 372.
1676. gbinv373.seq - Invertebrate sequence entries, part 373.
1677. gbinv374.seq - Invertebrate sequence entries, part 374.
1678. gbinv375.seq - Invertebrate sequence entries, part 375.
1679. gbinv376.seq - Invertebrate sequence entries, part 376.
1680. gbinv377.seq - Invertebrate sequence entries, part 377.
1681. gbinv378.seq - Invertebrate sequence entries, part 378.
1682. gbinv379.seq - Invertebrate sequence entries, part 379.
1683. gbinv38.seq - Invertebrate sequence entries, part 38.
1684. gbinv380.seq - Invertebrate sequence entries, part 380.
1685. gbinv381.seq - Invertebrate sequence entries, part 381.
1686. gbinv382.seq - Invertebrate sequence entries, part 382.
1687. gbinv383.seq - Invertebrate sequence entries, part 383.
1688. gbinv384.seq - Invertebrate sequence entries, part 384.
1689. gbinv385.seq - Invertebrate sequence entries, part 385.
1690. gbinv386.seq - Invertebrate sequence entries, part 386.
1691. gbinv387.seq - Invertebrate sequence entries, part 387.
1692. gbinv388.seq - Invertebrate sequence entries, part 388.
1693. gbinv389.seq - Invertebrate sequence entries, part 389.
1694. gbinv39.seq - Invertebrate sequence entries, part 39.
1695. gbinv390.seq - Invertebrate sequence entries, part 390.
1696. gbinv391.seq - Invertebrate sequence entries, part 391.
1697. gbinv392.seq - Invertebrate sequence entries, part 392.
1698. gbinv393.seq - Invertebrate sequence entries, part 393.
1699. gbinv394.seq - Invertebrate sequence entries, part 394.
1700. gbinv395.seq - Invertebrate sequence entries, part 395.
1701. gbinv396.seq - Invertebrate sequence entries, part 396.
1702. gbinv397.seq - Invertebrate sequence entries, part 397.
1703. gbinv398.seq - Invertebrate sequence entries, part 398.
1704. gbinv399.seq - Invertebrate sequence entries, part 399.
1705. gbinv4.seq - Invertebrate sequence entries, part 4.
1706. gbinv40.seq - Invertebrate sequence entries, part 40.
1707. gbinv400.seq - Invertebrate sequence entries, part 400.
1708. gbinv401.seq - Invertebrate sequence entries, part 401.
1709. gbinv402.seq - Invertebrate sequence entries, part 402.
1710. gbinv403.seq - Invertebrate sequence entries, part 403.
1711. gbinv404.seq - Invertebrate sequence entries, part 404.
1712. gbinv405.seq - Invertebrate sequence entries, part 405.
1713. gbinv406.seq - Invertebrate sequence entries, part 406.
1714. gbinv407.seq - Invertebrate sequence entries, part 407.
1715. gbinv408.seq - Invertebrate sequence entries, part 408.
1716. gbinv409.seq - Invertebrate sequence entries, part 409.
1717. gbinv41.seq - Invertebrate sequence entries, part 41.
1718. gbinv410.seq - Invertebrate sequence entries, part 410.
1719. gbinv411.seq - Invertebrate sequence entries, part 411.
1720. gbinv412.seq - Invertebrate sequence entries, part 412.
1721. gbinv413.seq - Invertebrate sequence entries, part 413.
1722. gbinv414.seq - Invertebrate sequence entries, part 414.
1723. gbinv415.seq - Invertebrate sequence entries, part 415.
1724. gbinv416.seq - Invertebrate sequence entries, part 416.
1725. gbinv417.seq - Invertebrate sequence entries, part 417.
1726. gbinv418.seq - Invertebrate sequence entries, part 418.
1727. gbinv419.seq - Invertebrate sequence entries, part 419.
1728. gbinv42.seq - Invertebrate sequence entries, part 42.
1729. gbinv420.seq - Invertebrate sequence entries, part 420.
1730. gbinv421.seq - Invertebrate sequence entries, part 421.
1731. gbinv422.seq - Invertebrate sequence entries, part 422.
1732. gbinv423.seq - Invertebrate sequence entries, part 423.
1733. gbinv424.seq - Invertebrate sequence entries, part 424.
1734. gbinv425.seq - Invertebrate sequence entries, part 425.
1735. gbinv426.seq - Invertebrate sequence entries, part 426.
1736. gbinv427.seq - Invertebrate sequence entries, part 427.
1737. gbinv428.seq - Invertebrate sequence entries, part 428.
1738. gbinv429.seq - Invertebrate sequence entries, part 429.
1739. gbinv43.seq - Invertebrate sequence entries, part 43.
1740. gbinv430.seq - Invertebrate sequence entries, part 430.
1741. gbinv431.seq - Invertebrate sequence entries, part 431.
1742. gbinv432.seq - Invertebrate sequence entries, part 432.
1743. gbinv433.seq - Invertebrate sequence entries, part 433.
1744. gbinv434.seq - Invertebrate sequence entries, part 434.
1745. gbinv435.seq - Invertebrate sequence entries, part 435.
1746. gbinv436.seq - Invertebrate sequence entries, part 436.
1747. gbinv437.seq - Invertebrate sequence entries, part 437.
1748. gbinv438.seq - Invertebrate sequence entries, part 438.
1749. gbinv439.seq - Invertebrate sequence entries, part 439.
1750. gbinv44.seq - Invertebrate sequence entries, part 44.
1751. gbinv440.seq - Invertebrate sequence entries, part 440.
1752. gbinv441.seq - Invertebrate sequence entries, part 441.
1753. gbinv442.seq - Invertebrate sequence entries, part 442.
1754. gbinv443.seq - Invertebrate sequence entries, part 443.
1755. gbinv444.seq - Invertebrate sequence entries, part 444.
1756. gbinv445.seq - Invertebrate sequence entries, part 445.
1757. gbinv446.seq - Invertebrate sequence entries, part 446.
1758. gbinv447.seq - Invertebrate sequence entries, part 447.
1759. gbinv448.seq - Invertebrate sequence entries, part 448.
1760. gbinv449.seq - Invertebrate sequence entries, part 449.
1761. gbinv45.seq - Invertebrate sequence entries, part 45.
1762. gbinv450.seq - Invertebrate sequence entries, part 450.
1763. gbinv451.seq - Invertebrate sequence entries, part 451.
1764. gbinv452.seq - Invertebrate sequence entries, part 452.
1765. gbinv453.seq - Invertebrate sequence entries, part 453.
1766. gbinv454.seq - Invertebrate sequence entries, part 454.
1767. gbinv455.seq - Invertebrate sequence entries, part 455.
1768. gbinv456.seq - Invertebrate sequence entries, part 456.
1769. gbinv457.seq - Invertebrate sequence entries, part 457.
1770. gbinv458.seq - Invertebrate sequence entries, part 458.
1771. gbinv459.seq - Invertebrate sequence entries, part 459.
1772. gbinv46.seq - Invertebrate sequence entries, part 46.
1773. gbinv460.seq - Invertebrate sequence entries, part 460.
1774. gbinv461.seq - Invertebrate sequence entries, part 461.
1775. gbinv462.seq - Invertebrate sequence entries, part 462.
1776. gbinv463.seq - Invertebrate sequence entries, part 463.
1777. gbinv464.seq - Invertebrate sequence entries, part 464.
1778. gbinv465.seq - Invertebrate sequence entries, part 465.
1779. gbinv466.seq - Invertebrate sequence entries, part 466.
1780. gbinv467.seq - Invertebrate sequence entries, part 467.
1781. gbinv468.seq - Invertebrate sequence entries, part 468.
1782. gbinv469.seq - Invertebrate sequence entries, part 469.
1783. gbinv47.seq - Invertebrate sequence entries, part 47.
1784. gbinv470.seq - Invertebrate sequence entries, part 470.
1785. gbinv471.seq - Invertebrate sequence entries, part 471.
1786. gbinv472.seq - Invertebrate sequence entries, part 472.
1787. gbinv473.seq - Invertebrate sequence entries, part 473.
1788. gbinv474.seq - Invertebrate sequence entries, part 474.
1789. gbinv475.seq - Invertebrate sequence entries, part 475.
1790. gbinv476.seq - Invertebrate sequence entries, part 476.
1791. gbinv477.seq - Invertebrate sequence entries, part 477.
1792. gbinv478.seq - Invertebrate sequence entries, part 478.
1793. gbinv479.seq - Invertebrate sequence entries, part 479.
1794. gbinv48.seq - Invertebrate sequence entries, part 48.
1795. gbinv480.seq - Invertebrate sequence entries, part 480.
1796. gbinv481.seq - Invertebrate sequence entries, part 481.
1797. gbinv482.seq - Invertebrate sequence entries, part 482.
1798. gbinv483.seq - Invertebrate sequence entries, part 483.
1799. gbinv484.seq - Invertebrate sequence entries, part 484.
1800. gbinv485.seq - Invertebrate sequence entries, part 485.
1801. gbinv486.seq - Invertebrate sequence entries, part 486.
1802. gbinv487.seq - Invertebrate sequence entries, part 487.
1803. gbinv488.seq - Invertebrate sequence entries, part 488.
1804. gbinv489.seq - Invertebrate sequence entries, part 489.
1805. gbinv49.seq - Invertebrate sequence entries, part 49.
1806. gbinv490.seq - Invertebrate sequence entries, part 490.
1807. gbinv491.seq - Invertebrate sequence entries, part 491.
1808. gbinv492.seq - Invertebrate sequence entries, part 492.
1809. gbinv493.seq - Invertebrate sequence entries, part 493.
1810. gbinv494.seq - Invertebrate sequence entries, part 494.
1811. gbinv495.seq - Invertebrate sequence entries, part 495.
1812. gbinv496.seq - Invertebrate sequence entries, part 496.
1813. gbinv497.seq - Invertebrate sequence entries, part 497.
1814. gbinv498.seq - Invertebrate sequence entries, part 498.
1815. gbinv499.seq - Invertebrate sequence entries, part 499.
1816. gbinv5.seq - Invertebrate sequence entries, part 5.
1817. gbinv50.seq - Invertebrate sequence entries, part 50.
1818. gbinv500.seq - Invertebrate sequence entries, part 500.
1819. gbinv501.seq - Invertebrate sequence entries, part 501.
1820. gbinv502.seq - Invertebrate sequence entries, part 502.
1821. gbinv503.seq - Invertebrate sequence entries, part 503.
1822. gbinv504.seq - Invertebrate sequence entries, part 504.
1823. gbinv505.seq - Invertebrate sequence entries, part 505.
1824. gbinv506.seq - Invertebrate sequence entries, part 506.
1825. gbinv507.seq - Invertebrate sequence entries, part 507.
1826. gbinv508.seq - Invertebrate sequence entries, part 508.
1827. gbinv509.seq - Invertebrate sequence entries, part 509.
1828. gbinv51.seq - Invertebrate sequence entries, part 51.
1829. gbinv510.seq - Invertebrate sequence entries, part 510.
1830. gbinv511.seq - Invertebrate sequence entries, part 511.
1831. gbinv512.seq - Invertebrate sequence entries, part 512.
1832. gbinv513.seq - Invertebrate sequence entries, part 513.
1833. gbinv514.seq - Invertebrate sequence entries, part 514.
1834. gbinv515.seq - Invertebrate sequence entries, part 515.
1835. gbinv516.seq - Invertebrate sequence entries, part 516.
1836. gbinv517.seq - Invertebrate sequence entries, part 517.
1837. gbinv518.seq - Invertebrate sequence entries, part 518.
1838. gbinv519.seq - Invertebrate sequence entries, part 519.
1839. gbinv52.seq - Invertebrate sequence entries, part 52.
1840. gbinv520.seq - Invertebrate sequence entries, part 520.
1841. gbinv521.seq - Invertebrate sequence entries, part 521.
1842. gbinv522.seq - Invertebrate sequence entries, part 522.
1843. gbinv523.seq - Invertebrate sequence entries, part 523.
1844. gbinv524.seq - Invertebrate sequence entries, part 524.
1845. gbinv525.seq - Invertebrate sequence entries, part 525.
1846. gbinv526.seq - Invertebrate sequence entries, part 526.
1847. gbinv527.seq - Invertebrate sequence entries, part 527.
1848. gbinv528.seq - Invertebrate sequence entries, part 528.
1849. gbinv529.seq - Invertebrate sequence entries, part 529.
1850. gbinv53.seq - Invertebrate sequence entries, part 53.
1851. gbinv530.seq - Invertebrate sequence entries, part 530.
1852. gbinv531.seq - Invertebrate sequence entries, part 531.
1853. gbinv532.seq - Invertebrate sequence entries, part 532.
1854. gbinv533.seq - Invertebrate sequence entries, part 533.
1855. gbinv534.seq - Invertebrate sequence entries, part 534.
1856. gbinv535.seq - Invertebrate sequence entries, part 535.
1857. gbinv536.seq - Invertebrate sequence entries, part 536.
1858. gbinv537.seq - Invertebrate sequence entries, part 537.
1859. gbinv538.seq - Invertebrate sequence entries, part 538.
1860. gbinv539.seq - Invertebrate sequence entries, part 539.
1861. gbinv54.seq - Invertebrate sequence entries, part 54.
1862. gbinv540.seq - Invertebrate sequence entries, part 540.
1863. gbinv541.seq - Invertebrate sequence entries, part 541.
1864. gbinv542.seq - Invertebrate sequence entries, part 542.
1865. gbinv543.seq - Invertebrate sequence entries, part 543.
1866. gbinv544.seq - Invertebrate sequence entries, part 544.
1867. gbinv545.seq - Invertebrate sequence entries, part 545.
1868. gbinv546.seq - Invertebrate sequence entries, part 546.
1869. gbinv547.seq - Invertebrate sequence entries, part 547.
1870. gbinv548.seq - Invertebrate sequence entries, part 548.
1871. gbinv549.seq - Invertebrate sequence entries, part 549.
1872. gbinv55.seq - Invertebrate sequence entries, part 55.
1873. gbinv550.seq - Invertebrate sequence entries, part 550.
1874. gbinv551.seq - Invertebrate sequence entries, part 551.
1875. gbinv552.seq - Invertebrate sequence entries, part 552.
1876. gbinv553.seq - Invertebrate sequence entries, part 553.
1877. gbinv554.seq - Invertebrate sequence entries, part 554.
1878. gbinv555.seq - Invertebrate sequence entries, part 555.
1879. gbinv556.seq - Invertebrate sequence entries, part 556.
1880. gbinv557.seq - Invertebrate sequence entries, part 557.
1881. gbinv558.seq - Invertebrate sequence entries, part 558.
1882. gbinv559.seq - Invertebrate sequence entries, part 559.
1883. gbinv56.seq - Invertebrate sequence entries, part 56.
1884. gbinv560.seq - Invertebrate sequence entries, part 560.
1885. gbinv561.seq - Invertebrate sequence entries, part 561.
1886. gbinv562.seq - Invertebrate sequence entries, part 562.
1887. gbinv563.seq - Invertebrate sequence entries, part 563.
1888. gbinv564.seq - Invertebrate sequence entries, part 564.
1889. gbinv565.seq - Invertebrate sequence entries, part 565.
1890. gbinv566.seq - Invertebrate sequence entries, part 566.
1891. gbinv567.seq - Invertebrate sequence entries, part 567.
1892. gbinv568.seq - Invertebrate sequence entries, part 568.
1893. gbinv569.seq - Invertebrate sequence entries, part 569.
1894. gbinv57.seq - Invertebrate sequence entries, part 57.
1895. gbinv570.seq - Invertebrate sequence entries, part 570.
1896. gbinv571.seq - Invertebrate sequence entries, part 571.
1897. gbinv572.seq - Invertebrate sequence entries, part 572.
1898. gbinv573.seq - Invertebrate sequence entries, part 573.
1899. gbinv574.seq - Invertebrate sequence entries, part 574.
1900. gbinv575.seq - Invertebrate sequence entries, part 575.
1901. gbinv576.seq - Invertebrate sequence entries, part 576.
1902. gbinv577.seq - Invertebrate sequence entries, part 577.
1903. gbinv578.seq - Invertebrate sequence entries, part 578.
1904. gbinv579.seq - Invertebrate sequence entries, part 579.
1905. gbinv58.seq - Invertebrate sequence entries, part 58.
1906. gbinv580.seq - Invertebrate sequence entries, part 580.
1907. gbinv581.seq - Invertebrate sequence entries, part 581.
1908. gbinv582.seq - Invertebrate sequence entries, part 582.
1909. gbinv583.seq - Invertebrate sequence entries, part 583.
1910. gbinv584.seq - Invertebrate sequence entries, part 584.
1911. gbinv585.seq - Invertebrate sequence entries, part 585.
1912. gbinv586.seq - Invertebrate sequence entries, part 586.
1913. gbinv587.seq - Invertebrate sequence entries, part 587.
1914. gbinv588.seq - Invertebrate sequence entries, part 588.
1915. gbinv589.seq - Invertebrate sequence entries, part 589.
1916. gbinv59.seq - Invertebrate sequence entries, part 59.
1917. gbinv590.seq - Invertebrate sequence entries, part 590.
1918. gbinv591.seq - Invertebrate sequence entries, part 591.
1919. gbinv592.seq - Invertebrate sequence entries, part 592.
1920. gbinv593.seq - Invertebrate sequence entries, part 593.
1921. gbinv594.seq - Invertebrate sequence entries, part 594.
1922. gbinv595.seq - Invertebrate sequence entries, part 595.
1923. gbinv596.seq - Invertebrate sequence entries, part 596.
1924. gbinv597.seq - Invertebrate sequence entries, part 597.
1925. gbinv598.seq - Invertebrate sequence entries, part 598.
1926. gbinv599.seq - Invertebrate sequence entries, part 599.
1927. gbinv6.seq - Invertebrate sequence entries, part 6.
1928. gbinv60.seq - Invertebrate sequence entries, part 60.
1929. gbinv600.seq - Invertebrate sequence entries, part 600.
1930. gbinv601.seq - Invertebrate sequence entries, part 601.
1931. gbinv602.seq - Invertebrate sequence entries, part 602.
1932. gbinv603.seq - Invertebrate sequence entries, part 603.
1933. gbinv604.seq - Invertebrate sequence entries, part 604.
1934. gbinv605.seq - Invertebrate sequence entries, part 605.
1935. gbinv606.seq - Invertebrate sequence entries, part 606.
1936. gbinv607.seq - Invertebrate sequence entries, part 607.
1937. gbinv608.seq - Invertebrate sequence entries, part 608.
1938. gbinv609.seq - Invertebrate sequence entries, part 609.
1939. gbinv61.seq - Invertebrate sequence entries, part 61.
1940. gbinv610.seq - Invertebrate sequence entries, part 610.
1941. gbinv611.seq - Invertebrate sequence entries, part 611.
1942. gbinv612.seq - Invertebrate sequence entries, part 612.
1943. gbinv613.seq - Invertebrate sequence entries, part 613.
1944. gbinv614.seq - Invertebrate sequence entries, part 614.
1945. gbinv615.seq - Invertebrate sequence entries, part 615.
1946. gbinv616.seq - Invertebrate sequence entries, part 616.
1947. gbinv617.seq - Invertebrate sequence entries, part 617.
1948. gbinv618.seq - Invertebrate sequence entries, part 618.
1949. gbinv619.seq - Invertebrate sequence entries, part 619.
1950. gbinv62.seq - Invertebrate sequence entries, part 62.
1951. gbinv620.seq - Invertebrate sequence entries, part 620.
1952. gbinv621.seq - Invertebrate sequence entries, part 621.
1953. gbinv622.seq - Invertebrate sequence entries, part 622.
1954. gbinv623.seq - Invertebrate sequence entries, part 623.
1955. gbinv624.seq - Invertebrate sequence entries, part 624.
1956. gbinv625.seq - Invertebrate sequence entries, part 625.
1957. gbinv626.seq - Invertebrate sequence entries, part 626.
1958. gbinv627.seq - Invertebrate sequence entries, part 627.
1959. gbinv628.seq - Invertebrate sequence entries, part 628.
1960. gbinv629.seq - Invertebrate sequence entries, part 629.
1961. gbinv63.seq - Invertebrate sequence entries, part 63.
1962. gbinv630.seq - Invertebrate sequence entries, part 630.
1963. gbinv631.seq - Invertebrate sequence entries, part 631.
1964. gbinv632.seq - Invertebrate sequence entries, part 632.
1965. gbinv633.seq - Invertebrate sequence entries, part 633.
1966. gbinv634.seq - Invertebrate sequence entries, part 634.
1967. gbinv635.seq - Invertebrate sequence entries, part 635.
1968. gbinv636.seq - Invertebrate sequence entries, part 636.
1969. gbinv637.seq - Invertebrate sequence entries, part 637.
1970. gbinv638.seq - Invertebrate sequence entries, part 638.
1971. gbinv639.seq - Invertebrate sequence entries, part 639.
1972. gbinv64.seq - Invertebrate sequence entries, part 64.
1973. gbinv640.seq - Invertebrate sequence entries, part 640.
1974. gbinv641.seq - Invertebrate sequence entries, part 641.
1975. gbinv642.seq - Invertebrate sequence entries, part 642.
1976. gbinv643.seq - Invertebrate sequence entries, part 643.
1977. gbinv644.seq - Invertebrate sequence entries, part 644.
1978. gbinv645.seq - Invertebrate sequence entries, part 645.
1979. gbinv646.seq - Invertebrate sequence entries, part 646.
1980. gbinv647.seq - Invertebrate sequence entries, part 647.
1981. gbinv648.seq - Invertebrate sequence entries, part 648.
1982. gbinv649.seq - Invertebrate sequence entries, part 649.
1983. gbinv65.seq - Invertebrate sequence entries, part 65.
1984. gbinv650.seq - Invertebrate sequence entries, part 650.
1985. gbinv651.seq - Invertebrate sequence entries, part 651.
1986. gbinv652.seq - Invertebrate sequence entries, part 652.
1987. gbinv653.seq - Invertebrate sequence entries, part 653.
1988. gbinv654.seq - Invertebrate sequence entries, part 654.
1989. gbinv655.seq - Invertebrate sequence entries, part 655.
1990. gbinv656.seq - Invertebrate sequence entries, part 656.
1991. gbinv657.seq - Invertebrate sequence entries, part 657.
1992. gbinv658.seq - Invertebrate sequence entries, part 658.
1993. gbinv659.seq - Invertebrate sequence entries, part 659.
1994. gbinv66.seq - Invertebrate sequence entries, part 66.
1995. gbinv660.seq - Invertebrate sequence entries, part 660.
1996. gbinv661.seq - Invertebrate sequence entries, part 661.
1997. gbinv662.seq - Invertebrate sequence entries, part 662.
1998. gbinv663.seq - Invertebrate sequence entries, part 663.
1999. gbinv664.seq - Invertebrate sequence entries, part 664.
2000. gbinv665.seq - Invertebrate sequence entries, part 665.
2001. gbinv666.seq - Invertebrate sequence entries, part 666.
2002. gbinv667.seq - Invertebrate sequence entries, part 667.
2003. gbinv668.seq - Invertebrate sequence entries, part 668.
2004. gbinv669.seq - Invertebrate sequence entries, part 669.
2005. gbinv67.seq - Invertebrate sequence entries, part 67.
2006. gbinv670.seq - Invertebrate sequence entries, part 670.
2007. gbinv671.seq - Invertebrate sequence entries, part 671.
2008. gbinv672.seq - Invertebrate sequence entries, part 672.
2009. gbinv673.seq - Invertebrate sequence entries, part 673.
2010. gbinv674.seq - Invertebrate sequence entries, part 674.
2011. gbinv675.seq - Invertebrate sequence entries, part 675.
2012. gbinv676.seq - Invertebrate sequence entries, part 676.
2013. gbinv677.seq - Invertebrate sequence entries, part 677.
2014. gbinv678.seq - Invertebrate sequence entries, part 678.
2015. gbinv679.seq - Invertebrate sequence entries, part 679.
2016. gbinv68.seq - Invertebrate sequence entries, part 68.
2017. gbinv680.seq - Invertebrate sequence entries, part 680.
2018. gbinv681.seq - Invertebrate sequence entries, part 681.
2019. gbinv682.seq - Invertebrate sequence entries, part 682.
2020. gbinv683.seq - Invertebrate sequence entries, part 683.
2021. gbinv684.seq - Invertebrate sequence entries, part 684.
2022. gbinv685.seq - Invertebrate sequence entries, part 685.
2023. gbinv686.seq - Invertebrate sequence entries, part 686.
2024. gbinv687.seq - Invertebrate sequence entries, part 687.
2025. gbinv688.seq - Invertebrate sequence entries, part 688.
2026. gbinv689.seq - Invertebrate sequence entries, part 689.
2027. gbinv69.seq - Invertebrate sequence entries, part 69.
2028. gbinv690.seq - Invertebrate sequence entries, part 690.
2029. gbinv691.seq - Invertebrate sequence entries, part 691.
2030. gbinv692.seq - Invertebrate sequence entries, part 692.
2031. gbinv693.seq - Invertebrate sequence entries, part 693.
2032. gbinv694.seq - Invertebrate sequence entries, part 694.
2033. gbinv695.seq - Invertebrate sequence entries, part 695.
2034. gbinv696.seq - Invertebrate sequence entries, part 696.
2035. gbinv697.seq - Invertebrate sequence entries, part 697.
2036. gbinv698.seq - Invertebrate sequence entries, part 698.
2037. gbinv699.seq - Invertebrate sequence entries, part 699.
2038. gbinv7.seq - Invertebrate sequence entries, part 7.
2039. gbinv70.seq - Invertebrate sequence entries, part 70.
2040. gbinv700.seq - Invertebrate sequence entries, part 700.
2041. gbinv701.seq - Invertebrate sequence entries, part 701.
2042. gbinv702.seq - Invertebrate sequence entries, part 702.
2043. gbinv703.seq - Invertebrate sequence entries, part 703.
2044. gbinv704.seq - Invertebrate sequence entries, part 704.
2045. gbinv705.seq - Invertebrate sequence entries, part 705.
2046. gbinv706.seq - Invertebrate sequence entries, part 706.
2047. gbinv707.seq - Invertebrate sequence entries, part 707.
2048. gbinv708.seq - Invertebrate sequence entries, part 708.
2049. gbinv709.seq - Invertebrate sequence entries, part 709.
2050. gbinv71.seq - Invertebrate sequence entries, part 71.
2051. gbinv710.seq - Invertebrate sequence entries, part 710.
2052. gbinv711.seq - Invertebrate sequence entries, part 711.
2053. gbinv712.seq - Invertebrate sequence entries, part 712.
2054. gbinv713.seq - Invertebrate sequence entries, part 713.
2055. gbinv714.seq - Invertebrate sequence entries, part 714.
2056. gbinv715.seq - Invertebrate sequence entries, part 715.
2057. gbinv716.seq - Invertebrate sequence entries, part 716.
2058. gbinv717.seq - Invertebrate sequence entries, part 717.
2059. gbinv718.seq - Invertebrate sequence entries, part 718.
2060. gbinv719.seq - Invertebrate sequence entries, part 719.
2061. gbinv72.seq - Invertebrate sequence entries, part 72.
2062. gbinv720.seq - Invertebrate sequence entries, part 720.
2063. gbinv721.seq - Invertebrate sequence entries, part 721.
2064. gbinv722.seq - Invertebrate sequence entries, part 722.
2065. gbinv723.seq - Invertebrate sequence entries, part 723.
2066. gbinv724.seq - Invertebrate sequence entries, part 724.
2067. gbinv725.seq - Invertebrate sequence entries, part 725.
2068. gbinv726.seq - Invertebrate sequence entries, part 726.
2069. gbinv727.seq - Invertebrate sequence entries, part 727.
2070. gbinv728.seq - Invertebrate sequence entries, part 728.
2071. gbinv729.seq - Invertebrate sequence entries, part 729.
2072. gbinv73.seq - Invertebrate sequence entries, part 73.
2073. gbinv730.seq - Invertebrate sequence entries, part 730.
2074. gbinv731.seq - Invertebrate sequence entries, part 731.
2075. gbinv732.seq - Invertebrate sequence entries, part 732.
2076. gbinv733.seq - Invertebrate sequence entries, part 733.
2077. gbinv734.seq - Invertebrate sequence entries, part 734.
2078. gbinv735.seq - Invertebrate sequence entries, part 735.
2079. gbinv736.seq - Invertebrate sequence entries, part 736.
2080. gbinv737.seq - Invertebrate sequence entries, part 737.
2081. gbinv738.seq - Invertebrate sequence entries, part 738.
2082. gbinv739.seq - Invertebrate sequence entries, part 739.
2083. gbinv74.seq - Invertebrate sequence entries, part 74.
2084. gbinv740.seq - Invertebrate sequence entries, part 740.
2085. gbinv741.seq - Invertebrate sequence entries, part 741.
2086. gbinv742.seq - Invertebrate sequence entries, part 742.
2087. gbinv743.seq - Invertebrate sequence entries, part 743.
2088. gbinv744.seq - Invertebrate sequence entries, part 744.
2089. gbinv745.seq - Invertebrate sequence entries, part 745.
2090. gbinv746.seq - Invertebrate sequence entries, part 746.
2091. gbinv747.seq - Invertebrate sequence entries, part 747.
2092. gbinv748.seq - Invertebrate sequence entries, part 748.
2093. gbinv749.seq - Invertebrate sequence entries, part 749.
2094. gbinv75.seq - Invertebrate sequence entries, part 75.
2095. gbinv750.seq - Invertebrate sequence entries, part 750.
2096. gbinv751.seq - Invertebrate sequence entries, part 751.
2097. gbinv752.seq - Invertebrate sequence entries, part 752.
2098. gbinv753.seq - Invertebrate sequence entries, part 753.
2099. gbinv754.seq - Invertebrate sequence entries, part 754.
2100. gbinv755.seq - Invertebrate sequence entries, part 755.
2101. gbinv756.seq - Invertebrate sequence entries, part 756.
2102. gbinv757.seq - Invertebrate sequence entries, part 757.
2103. gbinv758.seq - Invertebrate sequence entries, part 758.
2104. gbinv759.seq - Invertebrate sequence entries, part 759.
2105. gbinv76.seq - Invertebrate sequence entries, part 76.
2106. gbinv760.seq - Invertebrate sequence entries, part 760.
2107. gbinv761.seq - Invertebrate sequence entries, part 761.
2108. gbinv762.seq - Invertebrate sequence entries, part 762.
2109. gbinv763.seq - Invertebrate sequence entries, part 763.
2110. gbinv764.seq - Invertebrate sequence entries, part 764.
2111. gbinv765.seq - Invertebrate sequence entries, part 765.
2112. gbinv766.seq - Invertebrate sequence entries, part 766.
2113. gbinv767.seq - Invertebrate sequence entries, part 767.
2114. gbinv768.seq - Invertebrate sequence entries, part 768.
2115. gbinv769.seq - Invertebrate sequence entries, part 769.
2116. gbinv77.seq - Invertebrate sequence entries, part 77.
2117. gbinv770.seq - Invertebrate sequence entries, part 770.
2118. gbinv771.seq - Invertebrate sequence entries, part 771.
2119. gbinv772.seq - Invertebrate sequence entries, part 772.
2120. gbinv773.seq - Invertebrate sequence entries, part 773.
2121. gbinv774.seq - Invertebrate sequence entries, part 774.
2122. gbinv775.seq - Invertebrate sequence entries, part 775.
2123. gbinv776.seq - Invertebrate sequence entries, part 776.
2124. gbinv777.seq - Invertebrate sequence entries, part 777.
2125. gbinv778.seq - Invertebrate sequence entries, part 778.
2126. gbinv779.seq - Invertebrate sequence entries, part 779.
2127. gbinv78.seq - Invertebrate sequence entries, part 78.
2128. gbinv780.seq - Invertebrate sequence entries, part 780.
2129. gbinv781.seq - Invertebrate sequence entries, part 781.
2130. gbinv782.seq - Invertebrate sequence entries, part 782.
2131. gbinv783.seq - Invertebrate sequence entries, part 783.
2132. gbinv784.seq - Invertebrate sequence entries, part 784.
2133. gbinv785.seq - Invertebrate sequence entries, part 785.
2134. gbinv786.seq - Invertebrate sequence entries, part 786.
2135. gbinv787.seq - Invertebrate sequence entries, part 787.
2136. gbinv788.seq - Invertebrate sequence entries, part 788.
2137. gbinv789.seq - Invertebrate sequence entries, part 789.
2138. gbinv79.seq - Invertebrate sequence entries, part 79.
2139. gbinv790.seq - Invertebrate sequence entries, part 790.
2140. gbinv791.seq - Invertebrate sequence entries, part 791.
2141. gbinv792.seq - Invertebrate sequence entries, part 792.
2142. gbinv793.seq - Invertebrate sequence entries, part 793.
2143. gbinv794.seq - Invertebrate sequence entries, part 794.
2144. gbinv795.seq - Invertebrate sequence entries, part 795.
2145. gbinv796.seq - Invertebrate sequence entries, part 796.
2146. gbinv797.seq - Invertebrate sequence entries, part 797.
2147. gbinv798.seq - Invertebrate sequence entries, part 798.
2148. gbinv799.seq - Invertebrate sequence entries, part 799.
2149. gbinv8.seq - Invertebrate sequence entries, part 8.
2150. gbinv80.seq - Invertebrate sequence entries, part 80.
2151. gbinv800.seq - Invertebrate sequence entries, part 800.
2152. gbinv801.seq - Invertebrate sequence entries, part 801.
2153. gbinv802.seq - Invertebrate sequence entries, part 802.
2154. gbinv803.seq - Invertebrate sequence entries, part 803.
2155. gbinv804.seq - Invertebrate sequence entries, part 804.
2156. gbinv805.seq - Invertebrate sequence entries, part 805.
2157. gbinv806.seq - Invertebrate sequence entries, part 806.
2158. gbinv807.seq - Invertebrate sequence entries, part 807.
2159. gbinv808.seq - Invertebrate sequence entries, part 808.
2160. gbinv809.seq - Invertebrate sequence entries, part 809.
2161. gbinv81.seq - Invertebrate sequence entries, part 81.
2162. gbinv810.seq - Invertebrate sequence entries, part 810.
2163. gbinv811.seq - Invertebrate sequence entries, part 811.
2164. gbinv812.seq - Invertebrate sequence entries, part 812.
2165. gbinv813.seq - Invertebrate sequence entries, part 813.
2166. gbinv814.seq - Invertebrate sequence entries, part 814.
2167. gbinv815.seq - Invertebrate sequence entries, part 815.
2168. gbinv816.seq - Invertebrate sequence entries, part 816.
2169. gbinv817.seq - Invertebrate sequence entries, part 817.
2170. gbinv818.seq - Invertebrate sequence entries, part 818.
2171. gbinv819.seq - Invertebrate sequence entries, part 819.
2172. gbinv82.seq - Invertebrate sequence entries, part 82.
2173. gbinv820.seq - Invertebrate sequence entries, part 820.
2174. gbinv821.seq - Invertebrate sequence entries, part 821.
2175. gbinv822.seq - Invertebrate sequence entries, part 822.
2176. gbinv823.seq - Invertebrate sequence entries, part 823.
2177. gbinv824.seq - Invertebrate sequence entries, part 824.
2178. gbinv825.seq - Invertebrate sequence entries, part 825.
2179. gbinv826.seq - Invertebrate sequence entries, part 826.
2180. gbinv827.seq - Invertebrate sequence entries, part 827.
2181. gbinv828.seq - Invertebrate sequence entries, part 828.
2182. gbinv829.seq - Invertebrate sequence entries, part 829.
2183. gbinv83.seq - Invertebrate sequence entries, part 83.
2184. gbinv830.seq - Invertebrate sequence entries, part 830.
2185. gbinv831.seq - Invertebrate sequence entries, part 831.
2186. gbinv832.seq - Invertebrate sequence entries, part 832.
2187. gbinv833.seq - Invertebrate sequence entries, part 833.
2188. gbinv834.seq - Invertebrate sequence entries, part 834.
2189. gbinv835.seq - Invertebrate sequence entries, part 835.
2190. gbinv836.seq - Invertebrate sequence entries, part 836.
2191. gbinv837.seq - Invertebrate sequence entries, part 837.
2192. gbinv838.seq - Invertebrate sequence entries, part 838.
2193. gbinv839.seq - Invertebrate sequence entries, part 839.
2194. gbinv84.seq - Invertebrate sequence entries, part 84.
2195. gbinv840.seq - Invertebrate sequence entries, part 840.
2196. gbinv841.seq - Invertebrate sequence entries, part 841.
2197. gbinv842.seq - Invertebrate sequence entries, part 842.
2198. gbinv843.seq - Invertebrate sequence entries, part 843.
2199. gbinv844.seq - Invertebrate sequence entries, part 844.
2200. gbinv845.seq - Invertebrate sequence entries, part 845.
2201. gbinv846.seq - Invertebrate sequence entries, part 846.
2202. gbinv847.seq - Invertebrate sequence entries, part 847.
2203. gbinv848.seq - Invertebrate sequence entries, part 848.
2204. gbinv849.seq - Invertebrate sequence entries, part 849.
2205. gbinv85.seq - Invertebrate sequence entries, part 85.
2206. gbinv850.seq - Invertebrate sequence entries, part 850.
2207. gbinv851.seq - Invertebrate sequence entries, part 851.
2208. gbinv852.seq - Invertebrate sequence entries, part 852.
2209. gbinv853.seq - Invertebrate sequence entries, part 853.
2210. gbinv854.seq - Invertebrate sequence entries, part 854.
2211. gbinv855.seq - Invertebrate sequence entries, part 855.
2212. gbinv856.seq - Invertebrate sequence entries, part 856.
2213. gbinv857.seq - Invertebrate sequence entries, part 857.
2214. gbinv858.seq - Invertebrate sequence entries, part 858.
2215. gbinv859.seq - Invertebrate sequence entries, part 859.
2216. gbinv86.seq - Invertebrate sequence entries, part 86.
2217. gbinv860.seq - Invertebrate sequence entries, part 860.
2218. gbinv861.seq - Invertebrate sequence entries, part 861.
2219. gbinv862.seq - Invertebrate sequence entries, part 862.
2220. gbinv863.seq - Invertebrate sequence entries, part 863.
2221. gbinv864.seq - Invertebrate sequence entries, part 864.
2222. gbinv865.seq - Invertebrate sequence entries, part 865.
2223. gbinv866.seq - Invertebrate sequence entries, part 866.
2224. gbinv867.seq - Invertebrate sequence entries, part 867.
2225. gbinv868.seq - Invertebrate sequence entries, part 868.
2226. gbinv869.seq - Invertebrate sequence entries, part 869.
2227. gbinv87.seq - Invertebrate sequence entries, part 87.
2228. gbinv870.seq - Invertebrate sequence entries, part 870.
2229. gbinv871.seq - Invertebrate sequence entries, part 871.
2230. gbinv872.seq - Invertebrate sequence entries, part 872.
2231. gbinv873.seq - Invertebrate sequence entries, part 873.
2232. gbinv874.seq - Invertebrate sequence entries, part 874.
2233. gbinv875.seq - Invertebrate sequence entries, part 875.
2234. gbinv876.seq - Invertebrate sequence entries, part 876.
2235. gbinv877.seq - Invertebrate sequence entries, part 877.
2236. gbinv878.seq - Invertebrate sequence entries, part 878.
2237. gbinv879.seq - Invertebrate sequence entries, part 879.
2238. gbinv88.seq - Invertebrate sequence entries, part 88.
2239. gbinv880.seq - Invertebrate sequence entries, part 880.
2240. gbinv881.seq - Invertebrate sequence entries, part 881.
2241. gbinv882.seq - Invertebrate sequence entries, part 882.
2242. gbinv883.seq - Invertebrate sequence entries, part 883.
2243. gbinv884.seq - Invertebrate sequence entries, part 884.
2244. gbinv885.seq - Invertebrate sequence entries, part 885.
2245. gbinv886.seq - Invertebrate sequence entries, part 886.
2246. gbinv887.seq - Invertebrate sequence entries, part 887.
2247. gbinv888.seq - Invertebrate sequence entries, part 888.
2248. gbinv889.seq - Invertebrate sequence entries, part 889.
2249. gbinv89.seq - Invertebrate sequence entries, part 89.
2250. gbinv890.seq - Invertebrate sequence entries, part 890.
2251. gbinv891.seq - Invertebrate sequence entries, part 891.
2252. gbinv892.seq - Invertebrate sequence entries, part 892.
2253. gbinv893.seq - Invertebrate sequence entries, part 893.
2254. gbinv894.seq - Invertebrate sequence entries, part 894.
2255. gbinv895.seq - Invertebrate sequence entries, part 895.
2256. gbinv896.seq - Invertebrate sequence entries, part 896.
2257. gbinv897.seq - Invertebrate sequence entries, part 897.
2258. gbinv898.seq - Invertebrate sequence entries, part 898.
2259. gbinv899.seq - Invertebrate sequence entries, part 899.
2260. gbinv9.seq - Invertebrate sequence entries, part 9.
2261. gbinv90.seq - Invertebrate sequence entries, part 90.
2262. gbinv900.seq - Invertebrate sequence entries, part 900.
2263. gbinv901.seq - Invertebrate sequence entries, part 901.
2264. gbinv902.seq - Invertebrate sequence entries, part 902.
2265. gbinv903.seq - Invertebrate sequence entries, part 903.
2266. gbinv904.seq - Invertebrate sequence entries, part 904.
2267. gbinv905.seq - Invertebrate sequence entries, part 905.
2268. gbinv906.seq - Invertebrate sequence entries, part 906.
2269. gbinv907.seq - Invertebrate sequence entries, part 907.
2270. gbinv908.seq - Invertebrate sequence entries, part 908.
2271. gbinv909.seq - Invertebrate sequence entries, part 909.
2272. gbinv91.seq - Invertebrate sequence entries, part 91.
2273. gbinv910.seq - Invertebrate sequence entries, part 910.
2274. gbinv911.seq - Invertebrate sequence entries, part 911.
2275. gbinv912.seq - Invertebrate sequence entries, part 912.
2276. gbinv913.seq - Invertebrate sequence entries, part 913.
2277. gbinv914.seq - Invertebrate sequence entries, part 914.
2278. gbinv915.seq - Invertebrate sequence entries, part 915.
2279. gbinv916.seq - Invertebrate sequence entries, part 916.
2280. gbinv917.seq - Invertebrate sequence entries, part 917.
2281. gbinv918.seq - Invertebrate sequence entries, part 918.
2282. gbinv919.seq - Invertebrate sequence entries, part 919.
2283. gbinv92.seq - Invertebrate sequence entries, part 92.
2284. gbinv920.seq - Invertebrate sequence entries, part 920.
2285. gbinv921.seq - Invertebrate sequence entries, part 921.
2286. gbinv922.seq - Invertebrate sequence entries, part 922.
2287. gbinv923.seq - Invertebrate sequence entries, part 923.
2288. gbinv924.seq - Invertebrate sequence entries, part 924.
2289. gbinv925.seq - Invertebrate sequence entries, part 925.
2290. gbinv926.seq - Invertebrate sequence entries, part 926.
2291. gbinv927.seq - Invertebrate sequence entries, part 927.
2292. gbinv928.seq - Invertebrate sequence entries, part 928.
2293. gbinv929.seq - Invertebrate sequence entries, part 929.
2294. gbinv93.seq - Invertebrate sequence entries, part 93.
2295. gbinv930.seq - Invertebrate sequence entries, part 930.
2296. gbinv931.seq - Invertebrate sequence entries, part 931.
2297. gbinv932.seq - Invertebrate sequence entries, part 932.
2298. gbinv933.seq - Invertebrate sequence entries, part 933.
2299. gbinv934.seq - Invertebrate sequence entries, part 934.
2300. gbinv935.seq - Invertebrate sequence entries, part 935.
2301. gbinv936.seq - Invertebrate sequence entries, part 936.
2302. gbinv937.seq - Invertebrate sequence entries, part 937.
2303. gbinv938.seq - Invertebrate sequence entries, part 938.
2304. gbinv939.seq - Invertebrate sequence entries, part 939.
2305. gbinv94.seq - Invertebrate sequence entries, part 94.
2306. gbinv940.seq - Invertebrate sequence entries, part 940.
2307. gbinv941.seq - Invertebrate sequence entries, part 941.
2308. gbinv942.seq - Invertebrate sequence entries, part 942.
2309. gbinv943.seq - Invertebrate sequence entries, part 943.
2310. gbinv944.seq - Invertebrate sequence entries, part 944.
2311. gbinv945.seq - Invertebrate sequence entries, part 945.
2312. gbinv946.seq - Invertebrate sequence entries, part 946.
2313. gbinv947.seq - Invertebrate sequence entries, part 947.
2314. gbinv948.seq - Invertebrate sequence entries, part 948.
2315. gbinv949.seq - Invertebrate sequence entries, part 949.
2316. gbinv95.seq - Invertebrate sequence entries, part 95.
2317. gbinv950.seq - Invertebrate sequence entries, part 950.
2318. gbinv951.seq - Invertebrate sequence entries, part 951.
2319. gbinv952.seq - Invertebrate sequence entries, part 952.
2320. gbinv953.seq - Invertebrate sequence entries, part 953.
2321. gbinv954.seq - Invertebrate sequence entries, part 954.
2322. gbinv955.seq - Invertebrate sequence entries, part 955.
2323. gbinv956.seq - Invertebrate sequence entries, part 956.
2324. gbinv957.seq - Invertebrate sequence entries, part 957.
2325. gbinv958.seq - Invertebrate sequence entries, part 958.
2326. gbinv959.seq - Invertebrate sequence entries, part 959.
2327. gbinv96.seq - Invertebrate sequence entries, part 96.
2328. gbinv960.seq - Invertebrate sequence entries, part 960.
2329. gbinv961.seq - Invertebrate sequence entries, part 961.
2330. gbinv962.seq - Invertebrate sequence entries, part 962.
2331. gbinv963.seq - Invertebrate sequence entries, part 963.
2332. gbinv964.seq - Invertebrate sequence entries, part 964.
2333. gbinv965.seq - Invertebrate sequence entries, part 965.
2334. gbinv966.seq - Invertebrate sequence entries, part 966.
2335. gbinv967.seq - Invertebrate sequence entries, part 967.
2336. gbinv968.seq - Invertebrate sequence entries, part 968.
2337. gbinv969.seq - Invertebrate sequence entries, part 969.
2338. gbinv97.seq - Invertebrate sequence entries, part 97.
2339. gbinv970.seq - Invertebrate sequence entries, part 970.
2340. gbinv971.seq - Invertebrate sequence entries, part 971.
2341. gbinv972.seq - Invertebrate sequence entries, part 972.
2342. gbinv973.seq - Invertebrate sequence entries, part 973.
2343. gbinv974.seq - Invertebrate sequence entries, part 974.
2344. gbinv975.seq - Invertebrate sequence entries, part 975.
2345. gbinv976.seq - Invertebrate sequence entries, part 976.
2346. gbinv977.seq - Invertebrate sequence entries, part 977.
2347. gbinv978.seq - Invertebrate sequence entries, part 978.
2348. gbinv979.seq - Invertebrate sequence entries, part 979.
2349. gbinv98.seq - Invertebrate sequence entries, part 98.
2350. gbinv980.seq - Invertebrate sequence entries, part 980.
2351. gbinv981.seq - Invertebrate sequence entries, part 981.
2352. gbinv982.seq - Invertebrate sequence entries, part 982.
2353. gbinv983.seq - Invertebrate sequence entries, part 983.
2354. gbinv984.seq - Invertebrate sequence entries, part 984.
2355. gbinv985.seq - Invertebrate sequence entries, part 985.
2356. gbinv986.seq - Invertebrate sequence entries, part 986.
2357. gbinv987.seq - Invertebrate sequence entries, part 987.
2358. gbinv988.seq - Invertebrate sequence entries, part 988.
2359. gbinv989.seq - Invertebrate sequence entries, part 989.
2360. gbinv99.seq - Invertebrate sequence entries, part 99.
2361. gbinv990.seq - Invertebrate sequence entries, part 990.
2362. gbinv991.seq - Invertebrate sequence entries, part 991.
2363. gbinv992.seq - Invertebrate sequence entries, part 992.
2364. gbinv993.seq - Invertebrate sequence entries, part 993.
2365. gbinv994.seq - Invertebrate sequence entries, part 994.
2366. gbinv995.seq - Invertebrate sequence entries, part 995.
2367. gbinv996.seq - Invertebrate sequence entries, part 996.
2368. gbinv997.seq - Invertebrate sequence entries, part 997.
2369. gbinv998.seq - Invertebrate sequence entries, part 998.
2370. gbinv999.seq - Invertebrate sequence entries, part 999.
2371. gbmam1.seq - Other mammalian sequence entries, part 1.
2372. gbmam10.seq - Other mammalian sequence entries, part 10.
2373. gbmam100.seq - Other mammalian sequence entries, part 100.
2374. gbmam101.seq - Other mammalian sequence entries, part 101.
2375. gbmam102.seq - Other mammalian sequence entries, part 102.
2376. gbmam103.seq - Other mammalian sequence entries, part 103.
2377. gbmam104.seq - Other mammalian sequence entries, part 104.
2378. gbmam105.seq - Other mammalian sequence entries, part 105.
2379. gbmam106.seq - Other mammalian sequence entries, part 106.
2380. gbmam107.seq - Other mammalian sequence entries, part 107.
2381. gbmam108.seq - Other mammalian sequence entries, part 108.
2382. gbmam109.seq - Other mammalian sequence entries, part 109.
2383. gbmam11.seq - Other mammalian sequence entries, part 11.
2384. gbmam110.seq - Other mammalian sequence entries, part 110.
2385. gbmam111.seq - Other mammalian sequence entries, part 111.
2386. gbmam112.seq - Other mammalian sequence entries, part 112.
2387. gbmam113.seq - Other mammalian sequence entries, part 113.
2388. gbmam114.seq - Other mammalian sequence entries, part 114.
2389. gbmam115.seq - Other mammalian sequence entries, part 115.
2390. gbmam116.seq - Other mammalian sequence entries, part 116.
2391. gbmam117.seq - Other mammalian sequence entries, part 117.
2392. gbmam118.seq - Other mammalian sequence entries, part 118.
2393. gbmam119.seq - Other mammalian sequence entries, part 119.
2394. gbmam12.seq - Other mammalian sequence entries, part 12.
2395. gbmam120.seq - Other mammalian sequence entries, part 120.
2396. gbmam121.seq - Other mammalian sequence entries, part 121.
2397. gbmam122.seq - Other mammalian sequence entries, part 122.
2398. gbmam123.seq - Other mammalian sequence entries, part 123.
2399. gbmam124.seq - Other mammalian sequence entries, part 124.
2400. gbmam125.seq - Other mammalian sequence entries, part 125.
2401. gbmam126.seq - Other mammalian sequence entries, part 126.
2402. gbmam127.seq - Other mammalian sequence entries, part 127.
2403. gbmam128.seq - Other mammalian sequence entries, part 128.
2404. gbmam129.seq - Other mammalian sequence entries, part 129.
2405. gbmam13.seq - Other mammalian sequence entries, part 13.
2406. gbmam130.seq - Other mammalian sequence entries, part 130.
2407. gbmam131.seq - Other mammalian sequence entries, part 131.
2408. gbmam132.seq - Other mammalian sequence entries, part 132.
2409. gbmam133.seq - Other mammalian sequence entries, part 133.
2410. gbmam134.seq - Other mammalian sequence entries, part 134.
2411. gbmam135.seq - Other mammalian sequence entries, part 135.
2412. gbmam136.seq - Other mammalian sequence entries, part 136.
2413. gbmam137.seq - Other mammalian sequence entries, part 137.
2414. gbmam138.seq - Other mammalian sequence entries, part 138.
2415. gbmam139.seq - Other mammalian sequence entries, part 139.
2416. gbmam14.seq - Other mammalian sequence entries, part 14.
2417. gbmam140.seq - Other mammalian sequence entries, part 140.
2418. gbmam141.seq - Other mammalian sequence entries, part 141.
2419. gbmam142.seq - Other mammalian sequence entries, part 142.
2420. gbmam143.seq - Other mammalian sequence entries, part 143.
2421. gbmam144.seq - Other mammalian sequence entries, part 144.
2422. gbmam145.seq - Other mammalian sequence entries, part 145.
2423. gbmam146.seq - Other mammalian sequence entries, part 146.
2424. gbmam147.seq - Other mammalian sequence entries, part 147.
2425. gbmam148.seq - Other mammalian sequence entries, part 148.
2426. gbmam149.seq - Other mammalian sequence entries, part 149.
2427. gbmam15.seq - Other mammalian sequence entries, part 15.
2428. gbmam150.seq - Other mammalian sequence entries, part 150.
2429. gbmam151.seq - Other mammalian sequence entries, part 151.
2430. gbmam152.seq - Other mammalian sequence entries, part 152.
2431. gbmam153.seq - Other mammalian sequence entries, part 153.
2432. gbmam154.seq - Other mammalian sequence entries, part 154.
2433. gbmam155.seq - Other mammalian sequence entries, part 155.
2434. gbmam156.seq - Other mammalian sequence entries, part 156.
2435. gbmam157.seq - Other mammalian sequence entries, part 157.
2436. gbmam158.seq - Other mammalian sequence entries, part 158.
2437. gbmam159.seq - Other mammalian sequence entries, part 159.
2438. gbmam16.seq - Other mammalian sequence entries, part 16.
2439. gbmam160.seq - Other mammalian sequence entries, part 160.
2440. gbmam161.seq - Other mammalian sequence entries, part 161.
2441. gbmam162.seq - Other mammalian sequence entries, part 162.
2442. gbmam163.seq - Other mammalian sequence entries, part 163.
2443. gbmam164.seq - Other mammalian sequence entries, part 164.
2444. gbmam165.seq - Other mammalian sequence entries, part 165.
2445. gbmam166.seq - Other mammalian sequence entries, part 166.
2446. gbmam167.seq - Other mammalian sequence entries, part 167.
2447. gbmam168.seq - Other mammalian sequence entries, part 168.
2448. gbmam169.seq - Other mammalian sequence entries, part 169.
2449. gbmam17.seq - Other mammalian sequence entries, part 17.
2450. gbmam170.seq - Other mammalian sequence entries, part 170.
2451. gbmam171.seq - Other mammalian sequence entries, part 171.
2452. gbmam172.seq - Other mammalian sequence entries, part 172.
2453. gbmam173.seq - Other mammalian sequence entries, part 173.
2454. gbmam174.seq - Other mammalian sequence entries, part 174.
2455. gbmam175.seq - Other mammalian sequence entries, part 175.
2456. gbmam176.seq - Other mammalian sequence entries, part 176.
2457. gbmam177.seq - Other mammalian sequence entries, part 177.
2458. gbmam178.seq - Other mammalian sequence entries, part 178.
2459. gbmam179.seq - Other mammalian sequence entries, part 179.
2460. gbmam18.seq - Other mammalian sequence entries, part 18.
2461. gbmam180.seq - Other mammalian sequence entries, part 180.
2462. gbmam181.seq - Other mammalian sequence entries, part 181.
2463. gbmam182.seq - Other mammalian sequence entries, part 182.
2464. gbmam183.seq - Other mammalian sequence entries, part 183.
2465. gbmam184.seq - Other mammalian sequence entries, part 184.
2466. gbmam185.seq - Other mammalian sequence entries, part 185.
2467. gbmam186.seq - Other mammalian sequence entries, part 186.
2468. gbmam187.seq - Other mammalian sequence entries, part 187.
2469. gbmam188.seq - Other mammalian sequence entries, part 188.
2470. gbmam189.seq - Other mammalian sequence entries, part 189.
2471. gbmam19.seq - Other mammalian sequence entries, part 19.
2472. gbmam190.seq - Other mammalian sequence entries, part 190.
2473. gbmam191.seq - Other mammalian sequence entries, part 191.
2474. gbmam192.seq - Other mammalian sequence entries, part 192.
2475. gbmam193.seq - Other mammalian sequence entries, part 193.
2476. gbmam194.seq - Other mammalian sequence entries, part 194.
2477. gbmam195.seq - Other mammalian sequence entries, part 195.
2478. gbmam196.seq - Other mammalian sequence entries, part 196.
2479. gbmam197.seq - Other mammalian sequence entries, part 197.
2480. gbmam198.seq - Other mammalian sequence entries, part 198.
2481. gbmam199.seq - Other mammalian sequence entries, part 199.
2482. gbmam2.seq - Other mammalian sequence entries, part 2.
2483. gbmam20.seq - Other mammalian sequence entries, part 20.
2484. gbmam200.seq - Other mammalian sequence entries, part 200.
2485. gbmam201.seq - Other mammalian sequence entries, part 201.
2486. gbmam202.seq - Other mammalian sequence entries, part 202.
2487. gbmam21.seq - Other mammalian sequence entries, part 21.
2488. gbmam22.seq - Other mammalian sequence entries, part 22.
2489. gbmam23.seq - Other mammalian sequence entries, part 23.
2490. gbmam24.seq - Other mammalian sequence entries, part 24.
2491. gbmam25.seq - Other mammalian sequence entries, part 25.
2492. gbmam26.seq - Other mammalian sequence entries, part 26.
2493. gbmam27.seq - Other mammalian sequence entries, part 27.
2494. gbmam28.seq - Other mammalian sequence entries, part 28.
2495. gbmam29.seq - Other mammalian sequence entries, part 29.
2496. gbmam3.seq - Other mammalian sequence entries, part 3.
2497. gbmam30.seq - Other mammalian sequence entries, part 30.
2498. gbmam31.seq - Other mammalian sequence entries, part 31.
2499. gbmam32.seq - Other mammalian sequence entries, part 32.
2500. gbmam33.seq - Other mammalian sequence entries, part 33.
2501. gbmam34.seq - Other mammalian sequence entries, part 34.
2502. gbmam35.seq - Other mammalian sequence entries, part 35.
2503. gbmam36.seq - Other mammalian sequence entries, part 36.
2504. gbmam37.seq - Other mammalian sequence entries, part 37.
2505. gbmam38.seq - Other mammalian sequence entries, part 38.
2506. gbmam39.seq - Other mammalian sequence entries, part 39.
2507. gbmam4.seq - Other mammalian sequence entries, part 4.
2508. gbmam40.seq - Other mammalian sequence entries, part 40.
2509. gbmam41.seq - Other mammalian sequence entries, part 41.
2510. gbmam42.seq - Other mammalian sequence entries, part 42.
2511. gbmam43.seq - Other mammalian sequence entries, part 43.
2512. gbmam44.seq - Other mammalian sequence entries, part 44.
2513. gbmam45.seq - Other mammalian sequence entries, part 45.
2514. gbmam46.seq - Other mammalian sequence entries, part 46.
2515. gbmam47.seq - Other mammalian sequence entries, part 47.
2516. gbmam48.seq - Other mammalian sequence entries, part 48.
2517. gbmam49.seq - Other mammalian sequence entries, part 49.
2518. gbmam5.seq - Other mammalian sequence entries, part 5.
2519. gbmam50.seq - Other mammalian sequence entries, part 50.
2520. gbmam51.seq - Other mammalian sequence entries, part 51.
2521. gbmam52.seq - Other mammalian sequence entries, part 52.
2522. gbmam53.seq - Other mammalian sequence entries, part 53.
2523. gbmam54.seq - Other mammalian sequence entries, part 54.
2524. gbmam55.seq - Other mammalian sequence entries, part 55.
2525. gbmam56.seq - Other mammalian sequence entries, part 56.
2526. gbmam57.seq - Other mammalian sequence entries, part 57.
2527. gbmam58.seq - Other mammalian sequence entries, part 58.
2528. gbmam59.seq - Other mammalian sequence entries, part 59.
2529. gbmam6.seq - Other mammalian sequence entries, part 6.
2530. gbmam60.seq - Other mammalian sequence entries, part 60.
2531. gbmam61.seq - Other mammalian sequence entries, part 61.
2532. gbmam62.seq - Other mammalian sequence entries, part 62.
2533. gbmam63.seq - Other mammalian sequence entries, part 63.
2534. gbmam64.seq - Other mammalian sequence entries, part 64.
2535. gbmam65.seq - Other mammalian sequence entries, part 65.
2536. gbmam66.seq - Other mammalian sequence entries, part 66.
2537. gbmam67.seq - Other mammalian sequence entries, part 67.
2538. gbmam68.seq - Other mammalian sequence entries, part 68.
2539. gbmam69.seq - Other mammalian sequence entries, part 69.
2540. gbmam7.seq - Other mammalian sequence entries, part 7.
2541. gbmam70.seq - Other mammalian sequence entries, part 70.
2542. gbmam71.seq - Other mammalian sequence entries, part 71.
2543. gbmam72.seq - Other mammalian sequence entries, part 72.
2544. gbmam73.seq - Other mammalian sequence entries, part 73.
2545. gbmam74.seq - Other mammalian sequence entries, part 74.
2546. gbmam75.seq - Other mammalian sequence entries, part 75.
2547. gbmam76.seq - Other mammalian sequence entries, part 76.
2548. gbmam77.seq - Other mammalian sequence entries, part 77.
2549. gbmam78.seq - Other mammalian sequence entries, part 78.
2550. gbmam79.seq - Other mammalian sequence entries, part 79.
2551. gbmam8.seq - Other mammalian sequence entries, part 8.
2552. gbmam80.seq - Other mammalian sequence entries, part 80.
2553. gbmam81.seq - Other mammalian sequence entries, part 81.
2554. gbmam82.seq - Other mammalian sequence entries, part 82.
2555. gbmam83.seq - Other mammalian sequence entries, part 83.
2556. gbmam84.seq - Other mammalian sequence entries, part 84.
2557. gbmam85.seq - Other mammalian sequence entries, part 85.
2558. gbmam86.seq - Other mammalian sequence entries, part 86.
2559. gbmam87.seq - Other mammalian sequence entries, part 87.
2560. gbmam88.seq - Other mammalian sequence entries, part 88.
2561. gbmam89.seq - Other mammalian sequence entries, part 89.
2562. gbmam9.seq - Other mammalian sequence entries, part 9.
2563. gbmam90.seq - Other mammalian sequence entries, part 90.
2564. gbmam91.seq - Other mammalian sequence entries, part 91.
2565. gbmam92.seq - Other mammalian sequence entries, part 92.
2566. gbmam93.seq - Other mammalian sequence entries, part 93.
2567. gbmam94.seq - Other mammalian sequence entries, part 94.
2568. gbmam95.seq - Other mammalian sequence entries, part 95.
2569. gbmam96.seq - Other mammalian sequence entries, part 96.
2570. gbmam97.seq - Other mammalian sequence entries, part 97.
2571. gbmam98.seq - Other mammalian sequence entries, part 98.
2572. gbmam99.seq - Other mammalian sequence entries, part 99.
2573. gbnew.txt - Accession numbers of entries new since the previous release.
2574. gbpat1.seq - Patent sequence entries, part 1.
2575. gbpat10.seq - Patent sequence entries, part 10.
2576. gbpat11.seq - Patent sequence entries, part 11.
2577. gbpat12.seq - Patent sequence entries, part 12.
2578. gbpat13.seq - Patent sequence entries, part 13.
2579. gbpat14.seq - Patent sequence entries, part 14.
2580. gbpat15.seq - Patent sequence entries, part 15.
2581. gbpat16.seq - Patent sequence entries, part 16.
2582. gbpat17.seq - Patent sequence entries, part 17.
2583. gbpat18.seq - Patent sequence entries, part 18.
2584. gbpat19.seq - Patent sequence entries, part 19.
2585. gbpat2.seq - Patent sequence entries, part 2.
2586. gbpat20.seq - Patent sequence entries, part 20.
2587. gbpat21.seq - Patent sequence entries, part 21.
2588. gbpat22.seq - Patent sequence entries, part 22.
2589. gbpat23.seq - Patent sequence entries, part 23.
2590. gbpat24.seq - Patent sequence entries, part 24.
2591. gbpat25.seq - Patent sequence entries, part 25.
2592. gbpat26.seq - Patent sequence entries, part 26.
2593. gbpat27.seq - Patent sequence entries, part 27.
2594. gbpat28.seq - Patent sequence entries, part 28.
2595. gbpat29.seq - Patent sequence entries, part 29.
2596. gbpat3.seq - Patent sequence entries, part 3.
2597. gbpat30.seq - Patent sequence entries, part 30.
2598. gbpat31.seq - Patent sequence entries, part 31.
2599. gbpat32.seq - Patent sequence entries, part 32.
2600. gbpat33.seq - Patent sequence entries, part 33.
2601. gbpat34.seq - Patent sequence entries, part 34.
2602. gbpat35.seq - Patent sequence entries, part 35.
2603. gbpat36.seq - Patent sequence entries, part 36.
2604. gbpat37.seq - Patent sequence entries, part 37.
2605. gbpat38.seq - Patent sequence entries, part 38.
2606. gbpat39.seq - Patent sequence entries, part 39.
2607. gbpat4.seq - Patent sequence entries, part 4.
2608. gbpat40.seq - Patent sequence entries, part 40.
2609. gbpat41.seq - Patent sequence entries, part 41.
2610. gbpat42.seq - Patent sequence entries, part 42.
2611. gbpat43.seq - Patent sequence entries, part 43.
2612. gbpat44.seq - Patent sequence entries, part 44.
2613. gbpat45.seq - Patent sequence entries, part 45.
2614. gbpat46.seq - Patent sequence entries, part 46.
2615. gbpat47.seq - Patent sequence entries, part 47.
2616. gbpat48.seq - Patent sequence entries, part 48.
2617. gbpat49.seq - Patent sequence entries, part 49.
2618. gbpat5.seq - Patent sequence entries, part 5.
2619. gbpat50.seq - Patent sequence entries, part 50.
2620. gbpat51.seq - Patent sequence entries, part 51.
2621. gbpat52.seq - Patent sequence entries, part 52.
2622. gbpat53.seq - Patent sequence entries, part 53.
2623. gbpat54.seq - Patent sequence entries, part 54.
2624. gbpat55.seq - Patent sequence entries, part 55.
2625. gbpat56.seq - Patent sequence entries, part 56.
2626. gbpat57.seq - Patent sequence entries, part 57.
2627. gbpat58.seq - Patent sequence entries, part 58.
2628. gbpat59.seq - Patent sequence entries, part 59.
2629. gbpat6.seq - Patent sequence entries, part 6.
2630. gbpat60.seq - Patent sequence entries, part 60.
2631. gbpat61.seq - Patent sequence entries, part 61.
2632. gbpat62.seq - Patent sequence entries, part 62.
2633. gbpat63.seq - Patent sequence entries, part 63.
2634. gbpat64.seq - Patent sequence entries, part 64.
2635. gbpat65.seq - Patent sequence entries, part 65.
2636. gbpat66.seq - Patent sequence entries, part 66.
2637. gbpat67.seq - Patent sequence entries, part 67.
2638. gbpat68.seq - Patent sequence entries, part 68.
2639. gbpat69.seq - Patent sequence entries, part 69.
2640. gbpat7.seq - Patent sequence entries, part 7.
2641. gbpat70.seq - Patent sequence entries, part 70.
2642. gbpat71.seq - Patent sequence entries, part 71.
2643. gbpat72.seq - Patent sequence entries, part 72.
2644. gbpat73.seq - Patent sequence entries, part 73.
2645. gbpat74.seq - Patent sequence entries, part 74.
2646. gbpat75.seq - Patent sequence entries, part 75.
2647. gbpat76.seq - Patent sequence entries, part 76.
2648. gbpat77.seq - Patent sequence entries, part 77.
2649. gbpat78.seq - Patent sequence entries, part 78.
2650. gbpat79.seq - Patent sequence entries, part 79.
2651. gbpat8.seq - Patent sequence entries, part 8.
2652. gbpat80.seq - Patent sequence entries, part 80.
2653. gbpat81.seq - Patent sequence entries, part 81.
2654. gbpat82.seq - Patent sequence entries, part 82.
2655. gbpat83.seq - Patent sequence entries, part 83.
2656. gbpat84.seq - Patent sequence entries, part 84.
2657. gbpat9.seq - Patent sequence entries, part 9.
2658. gbphg1.seq - Phage sequence entries, part 1.
2659. gbphg2.seq - Phage sequence entries, part 2.
2660. gbphg3.seq - Phage sequence entries, part 3.
2661. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2662. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2663. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2664. gbpln1000.seq - Plant sequence entries (including fungi and algae), part 1000.
2665. gbpln1001.seq - Plant sequence entries (including fungi and algae), part 1001.
2666. gbpln1002.seq - Plant sequence entries (including fungi and algae), part 1002.
2667. gbpln1003.seq - Plant sequence entries (including fungi and algae), part 1003.
2668. gbpln1004.seq - Plant sequence entries (including fungi and algae), part 1004.
2669. gbpln1005.seq - Plant sequence entries (including fungi and algae), part 1005.
2670. gbpln1006.seq - Plant sequence entries (including fungi and algae), part 1006.
2671. gbpln1007.seq - Plant sequence entries (including fungi and algae), part 1007.
2672. gbpln1008.seq - Plant sequence entries (including fungi and algae), part 1008.
2673. gbpln1009.seq - Plant sequence entries (including fungi and algae), part 1009.
2674. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2675. gbpln1010.seq - Plant sequence entries (including fungi and algae), part 1010.
2676. gbpln1011.seq - Plant sequence entries (including fungi and algae), part 1011.
2677. gbpln1012.seq - Plant sequence entries (including fungi and algae), part 1012.
2678. gbpln1013.seq - Plant sequence entries (including fungi and algae), part 1013.
2679. gbpln1014.seq - Plant sequence entries (including fungi and algae), part 1014.
2680. gbpln1015.seq - Plant sequence entries (including fungi and algae), part 1015.
2681. gbpln1016.seq - Plant sequence entries (including fungi and algae), part 1016.
2682. gbpln1017.seq - Plant sequence entries (including fungi and algae), part 1017.
2683. gbpln1018.seq - Plant sequence entries (including fungi and algae), part 1018.
2684. gbpln1019.seq - Plant sequence entries (including fungi and algae), part 1019.
2685. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2686. gbpln1020.seq - Plant sequence entries (including fungi and algae), part 1020.
2687. gbpln1021.seq - Plant sequence entries (including fungi and algae), part 1021.
2688. gbpln1022.seq - Plant sequence entries (including fungi and algae), part 1022.
2689. gbpln1023.seq - Plant sequence entries (including fungi and algae), part 1023.
2690. gbpln1024.seq - Plant sequence entries (including fungi and algae), part 1024.
2691. gbpln1025.seq - Plant sequence entries (including fungi and algae), part 1025.
2692. gbpln1026.seq - Plant sequence entries (including fungi and algae), part 1026.
2693. gbpln1027.seq - Plant sequence entries (including fungi and algae), part 1027.
2694. gbpln1028.seq - Plant sequence entries (including fungi and algae), part 1028.
2695. gbpln1029.seq - Plant sequence entries (including fungi and algae), part 1029.
2696. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2697. gbpln1030.seq - Plant sequence entries (including fungi and algae), part 1030.
2698. gbpln1031.seq - Plant sequence entries (including fungi and algae), part 1031.
2699. gbpln1032.seq - Plant sequence entries (including fungi and algae), part 1032.
2700. gbpln1033.seq - Plant sequence entries (including fungi and algae), part 1033.
2701. gbpln1034.seq - Plant sequence entries (including fungi and algae), part 1034.
2702. gbpln1035.seq - Plant sequence entries (including fungi and algae), part 1035.
2703. gbpln1036.seq - Plant sequence entries (including fungi and algae), part 1036.
2704. gbpln1037.seq - Plant sequence entries (including fungi and algae), part 1037.
2705. gbpln1038.seq - Plant sequence entries (including fungi and algae), part 1038.
2706. gbpln1039.seq - Plant sequence entries (including fungi and algae), part 1039.
2707. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2708. gbpln1040.seq - Plant sequence entries (including fungi and algae), part 1040.
2709. gbpln1041.seq - Plant sequence entries (including fungi and algae), part 1041.
2710. gbpln1042.seq - Plant sequence entries (including fungi and algae), part 1042.
2711. gbpln1043.seq - Plant sequence entries (including fungi and algae), part 1043.
2712. gbpln1044.seq - Plant sequence entries (including fungi and algae), part 1044.
2713. gbpln1045.seq - Plant sequence entries (including fungi and algae), part 1045.
2714. gbpln1046.seq - Plant sequence entries (including fungi and algae), part 1046.
2715. gbpln1047.seq - Plant sequence entries (including fungi and algae), part 1047.
2716. gbpln1048.seq - Plant sequence entries (including fungi and algae), part 1048.
2717. gbpln1049.seq - Plant sequence entries (including fungi and algae), part 1049.
2718. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2719. gbpln1050.seq - Plant sequence entries (including fungi and algae), part 1050.
2720. gbpln1051.seq - Plant sequence entries (including fungi and algae), part 1051.
2721. gbpln1052.seq - Plant sequence entries (including fungi and algae), part 1052.
2722. gbpln1053.seq - Plant sequence entries (including fungi and algae), part 1053.
2723. gbpln1054.seq - Plant sequence entries (including fungi and algae), part 1054.
2724. gbpln1055.seq - Plant sequence entries (including fungi and algae), part 1055.
2725. gbpln1056.seq - Plant sequence entries (including fungi and algae), part 1056.
2726. gbpln1057.seq - Plant sequence entries (including fungi and algae), part 1057.
2727. gbpln1058.seq - Plant sequence entries (including fungi and algae), part 1058.
2728. gbpln1059.seq - Plant sequence entries (including fungi and algae), part 1059.
2729. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2730. gbpln1060.seq - Plant sequence entries (including fungi and algae), part 1060.
2731. gbpln1061.seq - Plant sequence entries (including fungi and algae), part 1061.
2732. gbpln1062.seq - Plant sequence entries (including fungi and algae), part 1062.
2733. gbpln1063.seq - Plant sequence entries (including fungi and algae), part 1063.
2734. gbpln1064.seq - Plant sequence entries (including fungi and algae), part 1064.
2735. gbpln1065.seq - Plant sequence entries (including fungi and algae), part 1065.
2736. gbpln1066.seq - Plant sequence entries (including fungi and algae), part 1066.
2737. gbpln1067.seq - Plant sequence entries (including fungi and algae), part 1067.
2738. gbpln1068.seq - Plant sequence entries (including fungi and algae), part 1068.
2739. gbpln1069.seq - Plant sequence entries (including fungi and algae), part 1069.
2740. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2741. gbpln1070.seq - Plant sequence entries (including fungi and algae), part 1070.
2742. gbpln1071.seq - Plant sequence entries (including fungi and algae), part 1071.
2743. gbpln1072.seq - Plant sequence entries (including fungi and algae), part 1072.
2744. gbpln1073.seq - Plant sequence entries (including fungi and algae), part 1073.
2745. gbpln1074.seq - Plant sequence entries (including fungi and algae), part 1074.
2746. gbpln1075.seq - Plant sequence entries (including fungi and algae), part 1075.
2747. gbpln1076.seq - Plant sequence entries (including fungi and algae), part 1076.
2748. gbpln1077.seq - Plant sequence entries (including fungi and algae), part 1077.
2749. gbpln1078.seq - Plant sequence entries (including fungi and algae), part 1078.
2750. gbpln1079.seq - Plant sequence entries (including fungi and algae), part 1079.
2751. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2752. gbpln1080.seq - Plant sequence entries (including fungi and algae), part 1080.
2753. gbpln1081.seq - Plant sequence entries (including fungi and algae), part 1081.
2754. gbpln1082.seq - Plant sequence entries (including fungi and algae), part 1082.
2755. gbpln1083.seq - Plant sequence entries (including fungi and algae), part 1083.
2756. gbpln1084.seq - Plant sequence entries (including fungi and algae), part 1084.
2757. gbpln1085.seq - Plant sequence entries (including fungi and algae), part 1085.
2758. gbpln1086.seq - Plant sequence entries (including fungi and algae), part 1086.
2759. gbpln1087.seq - Plant sequence entries (including fungi and algae), part 1087.
2760. gbpln1088.seq - Plant sequence entries (including fungi and algae), part 1088.
2761. gbpln1089.seq - Plant sequence entries (including fungi and algae), part 1089.
2762. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2763. gbpln1090.seq - Plant sequence entries (including fungi and algae), part 1090.
2764. gbpln1091.seq - Plant sequence entries (including fungi and algae), part 1091.
2765. gbpln1092.seq - Plant sequence entries (including fungi and algae), part 1092.
2766. gbpln1093.seq - Plant sequence entries (including fungi and algae), part 1093.
2767. gbpln1094.seq - Plant sequence entries (including fungi and algae), part 1094.
2768. gbpln1095.seq - Plant sequence entries (including fungi and algae), part 1095.
2769. gbpln1096.seq - Plant sequence entries (including fungi and algae), part 1096.
2770. gbpln1097.seq - Plant sequence entries (including fungi and algae), part 1097.
2771. gbpln1098.seq - Plant sequence entries (including fungi and algae), part 1098.
2772. gbpln1099.seq - Plant sequence entries (including fungi and algae), part 1099.
2773. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2774. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2775. gbpln1100.seq - Plant sequence entries (including fungi and algae), part 1100.
2776. gbpln1101.seq - Plant sequence entries (including fungi and algae), part 1101.
2777. gbpln1102.seq - Plant sequence entries (including fungi and algae), part 1102.
2778. gbpln1103.seq - Plant sequence entries (including fungi and algae), part 1103.
2779. gbpln1104.seq - Plant sequence entries (including fungi and algae), part 1104.
2780. gbpln1105.seq - Plant sequence entries (including fungi and algae), part 1105.
2781. gbpln1106.seq - Plant sequence entries (including fungi and algae), part 1106.
2782. gbpln1107.seq - Plant sequence entries (including fungi and algae), part 1107.
2783. gbpln1108.seq - Plant sequence entries (including fungi and algae), part 1108.
2784. gbpln1109.seq - Plant sequence entries (including fungi and algae), part 1109.
2785. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2786. gbpln1110.seq - Plant sequence entries (including fungi and algae), part 1110.
2787. gbpln1111.seq - Plant sequence entries (including fungi and algae), part 1111.
2788. gbpln1112.seq - Plant sequence entries (including fungi and algae), part 1112.
2789. gbpln1113.seq - Plant sequence entries (including fungi and algae), part 1113.
2790. gbpln1114.seq - Plant sequence entries (including fungi and algae), part 1114.
2791. gbpln1115.seq - Plant sequence entries (including fungi and algae), part 1115.
2792. gbpln1116.seq - Plant sequence entries (including fungi and algae), part 1116.
2793. gbpln1117.seq - Plant sequence entries (including fungi and algae), part 1117.
2794. gbpln1118.seq - Plant sequence entries (including fungi and algae), part 1118.
2795. gbpln1119.seq - Plant sequence entries (including fungi and algae), part 1119.
2796. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2797. gbpln1120.seq - Plant sequence entries (including fungi and algae), part 1120.
2798. gbpln1121.seq - Plant sequence entries (including fungi and algae), part 1121.
2799. gbpln1122.seq - Plant sequence entries (including fungi and algae), part 1122.
2800. gbpln1123.seq - Plant sequence entries (including fungi and algae), part 1123.
2801. gbpln1124.seq - Plant sequence entries (including fungi and algae), part 1124.
2802. gbpln1125.seq - Plant sequence entries (including fungi and algae), part 1125.
2803. gbpln1126.seq - Plant sequence entries (including fungi and algae), part 1126.
2804. gbpln1127.seq - Plant sequence entries (including fungi and algae), part 1127.
2805. gbpln1128.seq - Plant sequence entries (including fungi and algae), part 1128.
2806. gbpln1129.seq - Plant sequence entries (including fungi and algae), part 1129.
2807. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2808. gbpln1130.seq - Plant sequence entries (including fungi and algae), part 1130.
2809. gbpln1131.seq - Plant sequence entries (including fungi and algae), part 1131.
2810. gbpln1132.seq - Plant sequence entries (including fungi and algae), part 1132.
2811. gbpln1133.seq - Plant sequence entries (including fungi and algae), part 1133.
2812. gbpln1134.seq - Plant sequence entries (including fungi and algae), part 1134.
2813. gbpln1135.seq - Plant sequence entries (including fungi and algae), part 1135.
2814. gbpln1136.seq - Plant sequence entries (including fungi and algae), part 1136.
2815. gbpln1137.seq - Plant sequence entries (including fungi and algae), part 1137.
2816. gbpln1138.seq - Plant sequence entries (including fungi and algae), part 1138.
2817. gbpln1139.seq - Plant sequence entries (including fungi and algae), part 1139.
2818. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2819. gbpln1140.seq - Plant sequence entries (including fungi and algae), part 1140.
2820. gbpln1141.seq - Plant sequence entries (including fungi and algae), part 1141.
2821. gbpln1142.seq - Plant sequence entries (including fungi and algae), part 1142.
2822. gbpln1143.seq - Plant sequence entries (including fungi and algae), part 1143.
2823. gbpln1144.seq - Plant sequence entries (including fungi and algae), part 1144.
2824. gbpln1145.seq - Plant sequence entries (including fungi and algae), part 1145.
2825. gbpln1146.seq - Plant sequence entries (including fungi and algae), part 1146.
2826. gbpln1147.seq - Plant sequence entries (including fungi and algae), part 1147.
2827. gbpln1148.seq - Plant sequence entries (including fungi and algae), part 1148.
2828. gbpln1149.seq - Plant sequence entries (including fungi and algae), part 1149.
2829. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2830. gbpln1150.seq - Plant sequence entries (including fungi and algae), part 1150.
2831. gbpln1151.seq - Plant sequence entries (including fungi and algae), part 1151.
2832. gbpln1152.seq - Plant sequence entries (including fungi and algae), part 1152.
2833. gbpln1153.seq - Plant sequence entries (including fungi and algae), part 1153.
2834. gbpln1154.seq - Plant sequence entries (including fungi and algae), part 1154.
2835. gbpln1155.seq - Plant sequence entries (including fungi and algae), part 1155.
2836. gbpln1156.seq - Plant sequence entries (including fungi and algae), part 1156.
2837. gbpln1157.seq - Plant sequence entries (including fungi and algae), part 1157.
2838. gbpln1158.seq - Plant sequence entries (including fungi and algae), part 1158.
2839. gbpln1159.seq - Plant sequence entries (including fungi and algae), part 1159.
2840. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2841. gbpln1160.seq - Plant sequence entries (including fungi and algae), part 1160.
2842. gbpln1161.seq - Plant sequence entries (including fungi and algae), part 1161.
2843. gbpln1162.seq - Plant sequence entries (including fungi and algae), part 1162.
2844. gbpln1163.seq - Plant sequence entries (including fungi and algae), part 1163.
2845. gbpln1164.seq - Plant sequence entries (including fungi and algae), part 1164.
2846. gbpln1165.seq - Plant sequence entries (including fungi and algae), part 1165.
2847. gbpln1166.seq - Plant sequence entries (including fungi and algae), part 1166.
2848. gbpln1167.seq - Plant sequence entries (including fungi and algae), part 1167.
2849. gbpln1168.seq - Plant sequence entries (including fungi and algae), part 1168.
2850. gbpln1169.seq - Plant sequence entries (including fungi and algae), part 1169.
2851. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2852. gbpln1170.seq - Plant sequence entries (including fungi and algae), part 1170.
2853. gbpln1171.seq - Plant sequence entries (including fungi and algae), part 1171.
2854. gbpln1172.seq - Plant sequence entries (including fungi and algae), part 1172.
2855. gbpln1173.seq - Plant sequence entries (including fungi and algae), part 1173.
2856. gbpln1174.seq - Plant sequence entries (including fungi and algae), part 1174.
2857. gbpln1175.seq - Plant sequence entries (including fungi and algae), part 1175.
2858. gbpln1176.seq - Plant sequence entries (including fungi and algae), part 1176.
2859. gbpln1177.seq - Plant sequence entries (including fungi and algae), part 1177.
2860. gbpln1178.seq - Plant sequence entries (including fungi and algae), part 1178.
2861. gbpln1179.seq - Plant sequence entries (including fungi and algae), part 1179.
2862. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2863. gbpln1180.seq - Plant sequence entries (including fungi and algae), part 1180.
2864. gbpln1181.seq - Plant sequence entries (including fungi and algae), part 1181.
2865. gbpln1182.seq - Plant sequence entries (including fungi and algae), part 1182.
2866. gbpln1183.seq - Plant sequence entries (including fungi and algae), part 1183.
2867. gbpln1184.seq - Plant sequence entries (including fungi and algae), part 1184.
2868. gbpln1185.seq - Plant sequence entries (including fungi and algae), part 1185.
2869. gbpln1186.seq - Plant sequence entries (including fungi and algae), part 1186.
2870. gbpln1187.seq - Plant sequence entries (including fungi and algae), part 1187.
2871. gbpln1188.seq - Plant sequence entries (including fungi and algae), part 1188.
2872. gbpln1189.seq - Plant sequence entries (including fungi and algae), part 1189.
2873. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2874. gbpln1190.seq - Plant sequence entries (including fungi and algae), part 1190.
2875. gbpln1191.seq - Plant sequence entries (including fungi and algae), part 1191.
2876. gbpln1192.seq - Plant sequence entries (including fungi and algae), part 1192.
2877. gbpln1193.seq - Plant sequence entries (including fungi and algae), part 1193.
2878. gbpln1194.seq - Plant sequence entries (including fungi and algae), part 1194.
2879. gbpln1195.seq - Plant sequence entries (including fungi and algae), part 1195.
2880. gbpln1196.seq - Plant sequence entries (including fungi and algae), part 1196.
2881. gbpln1197.seq - Plant sequence entries (including fungi and algae), part 1197.
2882. gbpln1198.seq - Plant sequence entries (including fungi and algae), part 1198.
2883. gbpln1199.seq - Plant sequence entries (including fungi and algae), part 1199.
2884. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2885. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2886. gbpln1200.seq - Plant sequence entries (including fungi and algae), part 1200.
2887. gbpln1201.seq - Plant sequence entries (including fungi and algae), part 1201.
2888. gbpln1202.seq - Plant sequence entries (including fungi and algae), part 1202.
2889. gbpln1203.seq - Plant sequence entries (including fungi and algae), part 1203.
2890. gbpln1204.seq - Plant sequence entries (including fungi and algae), part 1204.
2891. gbpln1205.seq - Plant sequence entries (including fungi and algae), part 1205.
2892. gbpln1206.seq - Plant sequence entries (including fungi and algae), part 1206.
2893. gbpln1207.seq - Plant sequence entries (including fungi and algae), part 1207.
2894. gbpln1208.seq - Plant sequence entries (including fungi and algae), part 1208.
2895. gbpln1209.seq - Plant sequence entries (including fungi and algae), part 1209.
2896. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2897. gbpln1210.seq - Plant sequence entries (including fungi and algae), part 1210.
2898. gbpln1211.seq - Plant sequence entries (including fungi and algae), part 1211.
2899. gbpln1212.seq - Plant sequence entries (including fungi and algae), part 1212.
2900. gbpln1213.seq - Plant sequence entries (including fungi and algae), part 1213.
2901. gbpln1214.seq - Plant sequence entries (including fungi and algae), part 1214.
2902. gbpln1215.seq - Plant sequence entries (including fungi and algae), part 1215.
2903. gbpln1216.seq - Plant sequence entries (including fungi and algae), part 1216.
2904. gbpln1217.seq - Plant sequence entries (including fungi and algae), part 1217.
2905. gbpln1218.seq - Plant sequence entries (including fungi and algae), part 1218.
2906. gbpln1219.seq - Plant sequence entries (including fungi and algae), part 1219.
2907. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2908. gbpln1220.seq - Plant sequence entries (including fungi and algae), part 1220.
2909. gbpln1221.seq - Plant sequence entries (including fungi and algae), part 1221.
2910. gbpln1222.seq - Plant sequence entries (including fungi and algae), part 1222.
2911. gbpln1223.seq - Plant sequence entries (including fungi and algae), part 1223.
2912. gbpln1224.seq - Plant sequence entries (including fungi and algae), part 1224.
2913. gbpln1225.seq - Plant sequence entries (including fungi and algae), part 1225.
2914. gbpln1226.seq - Plant sequence entries (including fungi and algae), part 1226.
2915. gbpln1227.seq - Plant sequence entries (including fungi and algae), part 1227.
2916. gbpln1228.seq - Plant sequence entries (including fungi and algae), part 1228.
2917. gbpln1229.seq - Plant sequence entries (including fungi and algae), part 1229.
2918. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2919. gbpln1230.seq - Plant sequence entries (including fungi and algae), part 1230.
2920. gbpln1231.seq - Plant sequence entries (including fungi and algae), part 1231.
2921. gbpln1232.seq - Plant sequence entries (including fungi and algae), part 1232.
2922. gbpln1233.seq - Plant sequence entries (including fungi and algae), part 1233.
2923. gbpln1234.seq - Plant sequence entries (including fungi and algae), part 1234.
2924. gbpln1235.seq - Plant sequence entries (including fungi and algae), part 1235.
2925. gbpln1236.seq - Plant sequence entries (including fungi and algae), part 1236.
2926. gbpln1237.seq - Plant sequence entries (including fungi and algae), part 1237.
2927. gbpln1238.seq - Plant sequence entries (including fungi and algae), part 1238.
2928. gbpln1239.seq - Plant sequence entries (including fungi and algae), part 1239.
2929. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2930. gbpln1240.seq - Plant sequence entries (including fungi and algae), part 1240.
2931. gbpln1241.seq - Plant sequence entries (including fungi and algae), part 1241.
2932. gbpln1242.seq - Plant sequence entries (including fungi and algae), part 1242.
2933. gbpln1243.seq - Plant sequence entries (including fungi and algae), part 1243.
2934. gbpln1244.seq - Plant sequence entries (including fungi and algae), part 1244.
2935. gbpln1245.seq - Plant sequence entries (including fungi and algae), part 1245.
2936. gbpln1246.seq - Plant sequence entries (including fungi and algae), part 1246.
2937. gbpln1247.seq - Plant sequence entries (including fungi and algae), part 1247.
2938. gbpln1248.seq - Plant sequence entries (including fungi and algae), part 1248.
2939. gbpln1249.seq - Plant sequence entries (including fungi and algae), part 1249.
2940. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2941. gbpln1250.seq - Plant sequence entries (including fungi and algae), part 1250.
2942. gbpln1251.seq - Plant sequence entries (including fungi and algae), part 1251.
2943. gbpln1252.seq - Plant sequence entries (including fungi and algae), part 1252.
2944. gbpln1253.seq - Plant sequence entries (including fungi and algae), part 1253.
2945. gbpln1254.seq - Plant sequence entries (including fungi and algae), part 1254.
2946. gbpln1255.seq - Plant sequence entries (including fungi and algae), part 1255.
2947. gbpln1256.seq - Plant sequence entries (including fungi and algae), part 1256.
2948. gbpln1257.seq - Plant sequence entries (including fungi and algae), part 1257.
2949. gbpln1258.seq - Plant sequence entries (including fungi and algae), part 1258.
2950. gbpln1259.seq - Plant sequence entries (including fungi and algae), part 1259.
2951. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2952. gbpln1260.seq - Plant sequence entries (including fungi and algae), part 1260.
2953. gbpln1261.seq - Plant sequence entries (including fungi and algae), part 1261.
2954. gbpln1262.seq - Plant sequence entries (including fungi and algae), part 1262.
2955. gbpln1263.seq - Plant sequence entries (including fungi and algae), part 1263.
2956. gbpln1264.seq - Plant sequence entries (including fungi and algae), part 1264.
2957. gbpln1265.seq - Plant sequence entries (including fungi and algae), part 1265.
2958. gbpln1266.seq - Plant sequence entries (including fungi and algae), part 1266.
2959. gbpln1267.seq - Plant sequence entries (including fungi and algae), part 1267.
2960. gbpln1268.seq - Plant sequence entries (including fungi and algae), part 1268.
2961. gbpln1269.seq - Plant sequence entries (including fungi and algae), part 1269.
2962. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2963. gbpln1270.seq - Plant sequence entries (including fungi and algae), part 1270.
2964. gbpln1271.seq - Plant sequence entries (including fungi and algae), part 1271.
2965. gbpln1272.seq - Plant sequence entries (including fungi and algae), part 1272.
2966. gbpln1273.seq - Plant sequence entries (including fungi and algae), part 1273.
2967. gbpln1274.seq - Plant sequence entries (including fungi and algae), part 1274.
2968. gbpln1275.seq - Plant sequence entries (including fungi and algae), part 1275.
2969. gbpln1276.seq - Plant sequence entries (including fungi and algae), part 1276.
2970. gbpln1277.seq - Plant sequence entries (including fungi and algae), part 1277.
2971. gbpln1278.seq - Plant sequence entries (including fungi and algae), part 1278.
2972. gbpln1279.seq - Plant sequence entries (including fungi and algae), part 1279.
2973. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2974. gbpln1280.seq - Plant sequence entries (including fungi and algae), part 1280.
2975. gbpln1281.seq - Plant sequence entries (including fungi and algae), part 1281.
2976. gbpln1282.seq - Plant sequence entries (including fungi and algae), part 1282.
2977. gbpln1283.seq - Plant sequence entries (including fungi and algae), part 1283.
2978. gbpln1284.seq - Plant sequence entries (including fungi and algae), part 1284.
2979. gbpln1285.seq - Plant sequence entries (including fungi and algae), part 1285.
2980. gbpln1286.seq - Plant sequence entries (including fungi and algae), part 1286.
2981. gbpln1287.seq - Plant sequence entries (including fungi and algae), part 1287.
2982. gbpln1288.seq - Plant sequence entries (including fungi and algae), part 1288.
2983. gbpln1289.seq - Plant sequence entries (including fungi and algae), part 1289.
2984. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2985. gbpln1290.seq - Plant sequence entries (including fungi and algae), part 1290.
2986. gbpln1291.seq - Plant sequence entries (including fungi and algae), part 1291.
2987. gbpln1292.seq - Plant sequence entries (including fungi and algae), part 1292.
2988. gbpln1293.seq - Plant sequence entries (including fungi and algae), part 1293.
2989. gbpln1294.seq - Plant sequence entries (including fungi and algae), part 1294.
2990. gbpln1295.seq - Plant sequence entries (including fungi and algae), part 1295.
2991. gbpln1296.seq - Plant sequence entries (including fungi and algae), part 1296.
2992. gbpln1297.seq - Plant sequence entries (including fungi and algae), part 1297.
2993. gbpln1298.seq - Plant sequence entries (including fungi and algae), part 1298.
2994. gbpln1299.seq - Plant sequence entries (including fungi and algae), part 1299.
2995. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2996. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2997. gbpln1300.seq - Plant sequence entries (including fungi and algae), part 1300.
2998. gbpln1301.seq - Plant sequence entries (including fungi and algae), part 1301.
2999. gbpln1302.seq - Plant sequence entries (including fungi and algae), part 1302.
3000. gbpln1303.seq - Plant sequence entries (including fungi and algae), part 1303.
3001. gbpln1304.seq - Plant sequence entries (including fungi and algae), part 1304.
3002. gbpln1305.seq - Plant sequence entries (including fungi and algae), part 1305.
3003. gbpln1306.seq - Plant sequence entries (including fungi and algae), part 1306.
3004. gbpln1307.seq - Plant sequence entries (including fungi and algae), part 1307.
3005. gbpln1308.seq - Plant sequence entries (including fungi and algae), part 1308.
3006. gbpln1309.seq - Plant sequence entries (including fungi and algae), part 1309.
3007. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
3008. gbpln1310.seq - Plant sequence entries (including fungi and algae), part 1310.
3009. gbpln1311.seq - Plant sequence entries (including fungi and algae), part 1311.
3010. gbpln1312.seq - Plant sequence entries (including fungi and algae), part 1312.
3011. gbpln1313.seq - Plant sequence entries (including fungi and algae), part 1313.
3012. gbpln1314.seq - Plant sequence entries (including fungi and algae), part 1314.
3013. gbpln1315.seq - Plant sequence entries (including fungi and algae), part 1315.
3014. gbpln1316.seq - Plant sequence entries (including fungi and algae), part 1316.
3015. gbpln1317.seq - Plant sequence entries (including fungi and algae), part 1317.
3016. gbpln1318.seq - Plant sequence entries (including fungi and algae), part 1318.
3017. gbpln1319.seq - Plant sequence entries (including fungi and algae), part 1319.
3018. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
3019. gbpln1320.seq - Plant sequence entries (including fungi and algae), part 1320.
3020. gbpln1321.seq - Plant sequence entries (including fungi and algae), part 1321.
3021. gbpln1322.seq - Plant sequence entries (including fungi and algae), part 1322.
3022. gbpln1323.seq - Plant sequence entries (including fungi and algae), part 1323.
3023. gbpln1324.seq - Plant sequence entries (including fungi and algae), part 1324.
3024. gbpln1325.seq - Plant sequence entries (including fungi and algae), part 1325.
3025. gbpln1326.seq - Plant sequence entries (including fungi and algae), part 1326.
3026. gbpln1327.seq - Plant sequence entries (including fungi and algae), part 1327.
3027. gbpln1328.seq - Plant sequence entries (including fungi and algae), part 1328.
3028. gbpln1329.seq - Plant sequence entries (including fungi and algae), part 1329.
3029. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
3030. gbpln1330.seq - Plant sequence entries (including fungi and algae), part 1330.
3031. gbpln1331.seq - Plant sequence entries (including fungi and algae), part 1331.
3032. gbpln1332.seq - Plant sequence entries (including fungi and algae), part 1332.
3033. gbpln1333.seq - Plant sequence entries (including fungi and algae), part 1333.
3034. gbpln1334.seq - Plant sequence entries (including fungi and algae), part 1334.
3035. gbpln1335.seq - Plant sequence entries (including fungi and algae), part 1335.
3036. gbpln1336.seq - Plant sequence entries (including fungi and algae), part 1336.
3037. gbpln1337.seq - Plant sequence entries (including fungi and algae), part 1337.
3038. gbpln1338.seq - Plant sequence entries (including fungi and algae), part 1338.
3039. gbpln1339.seq - Plant sequence entries (including fungi and algae), part 1339.
3040. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
3041. gbpln1340.seq - Plant sequence entries (including fungi and algae), part 1340.
3042. gbpln1341.seq - Plant sequence entries (including fungi and algae), part 1341.
3043. gbpln1342.seq - Plant sequence entries (including fungi and algae), part 1342.
3044. gbpln1343.seq - Plant sequence entries (including fungi and algae), part 1343.
3045. gbpln1344.seq - Plant sequence entries (including fungi and algae), part 1344.
3046. gbpln1345.seq - Plant sequence entries (including fungi and algae), part 1345.
3047. gbpln1346.seq - Plant sequence entries (including fungi and algae), part 1346.
3048. gbpln1347.seq - Plant sequence entries (including fungi and algae), part 1347.
3049. gbpln1348.seq - Plant sequence entries (including fungi and algae), part 1348.
3050. gbpln1349.seq - Plant sequence entries (including fungi and algae), part 1349.
3051. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
3052. gbpln1350.seq - Plant sequence entries (including fungi and algae), part 1350.
3053. gbpln1351.seq - Plant sequence entries (including fungi and algae), part 1351.
3054. gbpln1352.seq - Plant sequence entries (including fungi and algae), part 1352.
3055. gbpln1353.seq - Plant sequence entries (including fungi and algae), part 1353.
3056. gbpln1354.seq - Plant sequence entries (including fungi and algae), part 1354.
3057. gbpln1355.seq - Plant sequence entries (including fungi and algae), part 1355.
3058. gbpln1356.seq - Plant sequence entries (including fungi and algae), part 1356.
3059. gbpln1357.seq - Plant sequence entries (including fungi and algae), part 1357.
3060. gbpln1358.seq - Plant sequence entries (including fungi and algae), part 1358.
3061. gbpln1359.seq - Plant sequence entries (including fungi and algae), part 1359.
3062. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
3063. gbpln1360.seq - Plant sequence entries (including fungi and algae), part 1360.
3064. gbpln1361.seq - Plant sequence entries (including fungi and algae), part 1361.
3065. gbpln1362.seq - Plant sequence entries (including fungi and algae), part 1362.
3066. gbpln1363.seq - Plant sequence entries (including fungi and algae), part 1363.
3067. gbpln1364.seq - Plant sequence entries (including fungi and algae), part 1364.
3068. gbpln1365.seq - Plant sequence entries (including fungi and algae), part 1365.
3069. gbpln1366.seq - Plant sequence entries (including fungi and algae), part 1366.
3070. gbpln1367.seq - Plant sequence entries (including fungi and algae), part 1367.
3071. gbpln1368.seq - Plant sequence entries (including fungi and algae), part 1368.
3072. gbpln1369.seq - Plant sequence entries (including fungi and algae), part 1369.
3073. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
3074. gbpln1370.seq - Plant sequence entries (including fungi and algae), part 1370.
3075. gbpln1371.seq - Plant sequence entries (including fungi and algae), part 1371.
3076. gbpln1372.seq - Plant sequence entries (including fungi and algae), part 1372.
3077. gbpln1373.seq - Plant sequence entries (including fungi and algae), part 1373.
3078. gbpln1374.seq - Plant sequence entries (including fungi and algae), part 1374.
3079. gbpln1375.seq - Plant sequence entries (including fungi and algae), part 1375.
3080. gbpln1376.seq - Plant sequence entries (including fungi and algae), part 1376.
3081. gbpln1377.seq - Plant sequence entries (including fungi and algae), part 1377.
3082. gbpln1378.seq - Plant sequence entries (including fungi and algae), part 1378.
3083. gbpln1379.seq - Plant sequence entries (including fungi and algae), part 1379.
3084. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
3085. gbpln1380.seq - Plant sequence entries (including fungi and algae), part 1380.
3086. gbpln1381.seq - Plant sequence entries (including fungi and algae), part 1381.
3087. gbpln1382.seq - Plant sequence entries (including fungi and algae), part 1382.
3088. gbpln1383.seq - Plant sequence entries (including fungi and algae), part 1383.
3089. gbpln1384.seq - Plant sequence entries (including fungi and algae), part 1384.
3090. gbpln1385.seq - Plant sequence entries (including fungi and algae), part 1385.
3091. gbpln1386.seq - Plant sequence entries (including fungi and algae), part 1386.
3092. gbpln1387.seq - Plant sequence entries (including fungi and algae), part 1387.
3093. gbpln1388.seq - Plant sequence entries (including fungi and algae), part 1388.
3094. gbpln1389.seq - Plant sequence entries (including fungi and algae), part 1389.
3095. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
3096. gbpln1390.seq - Plant sequence entries (including fungi and algae), part 1390.
3097. gbpln1391.seq - Plant sequence entries (including fungi and algae), part 1391.
3098. gbpln1392.seq - Plant sequence entries (including fungi and algae), part 1392.
3099. gbpln1393.seq - Plant sequence entries (including fungi and algae), part 1393.
3100. gbpln1394.seq - Plant sequence entries (including fungi and algae), part 1394.
3101. gbpln1395.seq - Plant sequence entries (including fungi and algae), part 1395.
3102. gbpln1396.seq - Plant sequence entries (including fungi and algae), part 1396.
3103. gbpln1397.seq - Plant sequence entries (including fungi and algae), part 1397.
3104. gbpln1398.seq - Plant sequence entries (including fungi and algae), part 1398.
3105. gbpln1399.seq - Plant sequence entries (including fungi and algae), part 1399.
3106. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
3107. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
3108. gbpln1400.seq - Plant sequence entries (including fungi and algae), part 1400.
3109. gbpln1401.seq - Plant sequence entries (including fungi and algae), part 1401.
3110. gbpln1402.seq - Plant sequence entries (including fungi and algae), part 1402.
3111. gbpln1403.seq - Plant sequence entries (including fungi and algae), part 1403.
3112. gbpln1404.seq - Plant sequence entries (including fungi and algae), part 1404.
3113. gbpln1405.seq - Plant sequence entries (including fungi and algae), part 1405.
3114. gbpln1406.seq - Plant sequence entries (including fungi and algae), part 1406.
3115. gbpln1407.seq - Plant sequence entries (including fungi and algae), part 1407.
3116. gbpln1408.seq - Plant sequence entries (including fungi and algae), part 1408.
3117. gbpln1409.seq - Plant sequence entries (including fungi and algae), part 1409.
3118. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
3119. gbpln1410.seq - Plant sequence entries (including fungi and algae), part 1410.
3120. gbpln1411.seq - Plant sequence entries (including fungi and algae), part 1411.
3121. gbpln1412.seq - Plant sequence entries (including fungi and algae), part 1412.
3122. gbpln1413.seq - Plant sequence entries (including fungi and algae), part 1413.
3123. gbpln1414.seq - Plant sequence entries (including fungi and algae), part 1414.
3124. gbpln1415.seq - Plant sequence entries (including fungi and algae), part 1415.
3125. gbpln1416.seq - Plant sequence entries (including fungi and algae), part 1416.
3126. gbpln1417.seq - Plant sequence entries (including fungi and algae), part 1417.
3127. gbpln1418.seq - Plant sequence entries (including fungi and algae), part 1418.
3128. gbpln1419.seq - Plant sequence entries (including fungi and algae), part 1419.
3129. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
3130. gbpln1420.seq - Plant sequence entries (including fungi and algae), part 1420.
3131. gbpln1421.seq - Plant sequence entries (including fungi and algae), part 1421.
3132. gbpln1422.seq - Plant sequence entries (including fungi and algae), part 1422.
3133. gbpln1423.seq - Plant sequence entries (including fungi and algae), part 1423.
3134. gbpln1424.seq - Plant sequence entries (including fungi and algae), part 1424.
3135. gbpln1425.seq - Plant sequence entries (including fungi and algae), part 1425.
3136. gbpln1426.seq - Plant sequence entries (including fungi and algae), part 1426.
3137. gbpln1427.seq - Plant sequence entries (including fungi and algae), part 1427.
3138. gbpln1428.seq - Plant sequence entries (including fungi and algae), part 1428.
3139. gbpln1429.seq - Plant sequence entries (including fungi and algae), part 1429.
3140. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
3141. gbpln1430.seq - Plant sequence entries (including fungi and algae), part 1430.
3142. gbpln1431.seq - Plant sequence entries (including fungi and algae), part 1431.
3143. gbpln1432.seq - Plant sequence entries (including fungi and algae), part 1432.
3144. gbpln1433.seq - Plant sequence entries (including fungi and algae), part 1433.
3145. gbpln1434.seq - Plant sequence entries (including fungi and algae), part 1434.
3146. gbpln1435.seq - Plant sequence entries (including fungi and algae), part 1435.
3147. gbpln1436.seq - Plant sequence entries (including fungi and algae), part 1436.
3148. gbpln1437.seq - Plant sequence entries (including fungi and algae), part 1437.
3149. gbpln1438.seq - Plant sequence entries (including fungi and algae), part 1438.
3150. gbpln1439.seq - Plant sequence entries (including fungi and algae), part 1439.
3151. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
3152. gbpln1440.seq - Plant sequence entries (including fungi and algae), part 1440.
3153. gbpln1441.seq - Plant sequence entries (including fungi and algae), part 1441.
3154. gbpln1442.seq - Plant sequence entries (including fungi and algae), part 1442.
3155. gbpln1443.seq - Plant sequence entries (including fungi and algae), part 1443.
3156. gbpln1444.seq - Plant sequence entries (including fungi and algae), part 1444.
3157. gbpln1445.seq - Plant sequence entries (including fungi and algae), part 1445.
3158. gbpln1446.seq - Plant sequence entries (including fungi and algae), part 1446.
3159. gbpln1447.seq - Plant sequence entries (including fungi and algae), part 1447.
3160. gbpln1448.seq - Plant sequence entries (including fungi and algae), part 1448.
3161. gbpln1449.seq - Plant sequence entries (including fungi and algae), part 1449.
3162. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
3163. gbpln1450.seq - Plant sequence entries (including fungi and algae), part 1450.
3164. gbpln1451.seq - Plant sequence entries (including fungi and algae), part 1451.
3165. gbpln1452.seq - Plant sequence entries (including fungi and algae), part 1452.
3166. gbpln1453.seq - Plant sequence entries (including fungi and algae), part 1453.
3167. gbpln1454.seq - Plant sequence entries (including fungi and algae), part 1454.
3168. gbpln1455.seq - Plant sequence entries (including fungi and algae), part 1455.
3169. gbpln1456.seq - Plant sequence entries (including fungi and algae), part 1456.
3170. gbpln1457.seq - Plant sequence entries (including fungi and algae), part 1457.
3171. gbpln1458.seq - Plant sequence entries (including fungi and algae), part 1458.
3172. gbpln1459.seq - Plant sequence entries (including fungi and algae), part 1459.
3173. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
3174. gbpln1460.seq - Plant sequence entries (including fungi and algae), part 1460.
3175. gbpln1461.seq - Plant sequence entries (including fungi and algae), part 1461.
3176. gbpln1462.seq - Plant sequence entries (including fungi and algae), part 1462.
3177. gbpln1463.seq - Plant sequence entries (including fungi and algae), part 1463.
3178. gbpln1464.seq - Plant sequence entries (including fungi and algae), part 1464.
3179. gbpln1465.seq - Plant sequence entries (including fungi and algae), part 1465.
3180. gbpln1466.seq - Plant sequence entries (including fungi and algae), part 1466.
3181. gbpln1467.seq - Plant sequence entries (including fungi and algae), part 1467.
3182. gbpln1468.seq - Plant sequence entries (including fungi and algae), part 1468.
3183. gbpln1469.seq - Plant sequence entries (including fungi and algae), part 1469.
3184. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
3185. gbpln1470.seq - Plant sequence entries (including fungi and algae), part 1470.
3186. gbpln1471.seq - Plant sequence entries (including fungi and algae), part 1471.
3187. gbpln1472.seq - Plant sequence entries (including fungi and algae), part 1472.
3188. gbpln1473.seq - Plant sequence entries (including fungi and algae), part 1473.
3189. gbpln1474.seq - Plant sequence entries (including fungi and algae), part 1474.
3190. gbpln1475.seq - Plant sequence entries (including fungi and algae), part 1475.
3191. gbpln1476.seq - Plant sequence entries (including fungi and algae), part 1476.
3192. gbpln1477.seq - Plant sequence entries (including fungi and algae), part 1477.
3193. gbpln1478.seq - Plant sequence entries (including fungi and algae), part 1478.
3194. gbpln1479.seq - Plant sequence entries (including fungi and algae), part 1479.
3195. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
3196. gbpln1480.seq - Plant sequence entries (including fungi and algae), part 1480.
3197. gbpln1481.seq - Plant sequence entries (including fungi and algae), part 1481.
3198. gbpln1482.seq - Plant sequence entries (including fungi and algae), part 1482.
3199. gbpln1483.seq - Plant sequence entries (including fungi and algae), part 1483.
3200. gbpln1484.seq - Plant sequence entries (including fungi and algae), part 1484.
3201. gbpln1485.seq - Plant sequence entries (including fungi and algae), part 1485.
3202. gbpln1486.seq - Plant sequence entries (including fungi and algae), part 1486.
3203. gbpln1487.seq - Plant sequence entries (including fungi and algae), part 1487.
3204. gbpln1488.seq - Plant sequence entries (including fungi and algae), part 1488.
3205. gbpln1489.seq - Plant sequence entries (including fungi and algae), part 1489.
3206. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
3207. gbpln1490.seq - Plant sequence entries (including fungi and algae), part 1490.
3208. gbpln1491.seq - Plant sequence entries (including fungi and algae), part 1491.
3209. gbpln1492.seq - Plant sequence entries (including fungi and algae), part 1492.
3210. gbpln1493.seq - Plant sequence entries (including fungi and algae), part 1493.
3211. gbpln1494.seq - Plant sequence entries (including fungi and algae), part 1494.
3212. gbpln1495.seq - Plant sequence entries (including fungi and algae), part 1495.
3213. gbpln1496.seq - Plant sequence entries (including fungi and algae), part 1496.
3214. gbpln1497.seq - Plant sequence entries (including fungi and algae), part 1497.
3215. gbpln1498.seq - Plant sequence entries (including fungi and algae), part 1498.
3216. gbpln1499.seq - Plant sequence entries (including fungi and algae), part 1499.
3217. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
3218. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
3219. gbpln1500.seq - Plant sequence entries (including fungi and algae), part 1500.
3220. gbpln1501.seq - Plant sequence entries (including fungi and algae), part 1501.
3221. gbpln1502.seq - Plant sequence entries (including fungi and algae), part 1502.
3222. gbpln1503.seq - Plant sequence entries (including fungi and algae), part 1503.
3223. gbpln1504.seq - Plant sequence entries (including fungi and algae), part 1504.
3224. gbpln1505.seq - Plant sequence entries (including fungi and algae), part 1505.
3225. gbpln1506.seq - Plant sequence entries (including fungi and algae), part 1506.
3226. gbpln1507.seq - Plant sequence entries (including fungi and algae), part 1507.
3227. gbpln1508.seq - Plant sequence entries (including fungi and algae), part 1508.
3228. gbpln1509.seq - Plant sequence entries (including fungi and algae), part 1509.
3229. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
3230. gbpln1510.seq - Plant sequence entries (including fungi and algae), part 1510.
3231. gbpln1511.seq - Plant sequence entries (including fungi and algae), part 1511.
3232. gbpln1512.seq - Plant sequence entries (including fungi and algae), part 1512.
3233. gbpln1513.seq - Plant sequence entries (including fungi and algae), part 1513.
3234. gbpln1514.seq - Plant sequence entries (including fungi and algae), part 1514.
3235. gbpln1515.seq - Plant sequence entries (including fungi and algae), part 1515.
3236. gbpln1516.seq - Plant sequence entries (including fungi and algae), part 1516.
3237. gbpln1517.seq - Plant sequence entries (including fungi and algae), part 1517.
3238. gbpln1518.seq - Plant sequence entries (including fungi and algae), part 1518.
3239. gbpln1519.seq - Plant sequence entries (including fungi and algae), part 1519.
3240. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
3241. gbpln1520.seq - Plant sequence entries (including fungi and algae), part 1520.
3242. gbpln1521.seq - Plant sequence entries (including fungi and algae), part 1521.
3243. gbpln1522.seq - Plant sequence entries (including fungi and algae), part 1522.
3244. gbpln1523.seq - Plant sequence entries (including fungi and algae), part 1523.
3245. gbpln1524.seq - Plant sequence entries (including fungi and algae), part 1524.
3246. gbpln1525.seq - Plant sequence entries (including fungi and algae), part 1525.
3247. gbpln1526.seq - Plant sequence entries (including fungi and algae), part 1526.
3248. gbpln1527.seq - Plant sequence entries (including fungi and algae), part 1527.
3249. gbpln1528.seq - Plant sequence entries (including fungi and algae), part 1528.
3250. gbpln1529.seq - Plant sequence entries (including fungi and algae), part 1529.
3251. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
3252. gbpln1530.seq - Plant sequence entries (including fungi and algae), part 1530.
3253. gbpln1531.seq - Plant sequence entries (including fungi and algae), part 1531.
3254. gbpln1532.seq - Plant sequence entries (including fungi and algae), part 1532.
3255. gbpln1533.seq - Plant sequence entries (including fungi and algae), part 1533.
3256. gbpln1534.seq - Plant sequence entries (including fungi and algae), part 1534.
3257. gbpln1535.seq - Plant sequence entries (including fungi and algae), part 1535.
3258. gbpln1536.seq - Plant sequence entries (including fungi and algae), part 1536.
3259. gbpln1537.seq - Plant sequence entries (including fungi and algae), part 1537.
3260. gbpln1538.seq - Plant sequence entries (including fungi and algae), part 1538.
3261. gbpln1539.seq - Plant sequence entries (including fungi and algae), part 1539.
3262. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
3263. gbpln1540.seq - Plant sequence entries (including fungi and algae), part 1540.
3264. gbpln1541.seq - Plant sequence entries (including fungi and algae), part 1541.
3265. gbpln1542.seq - Plant sequence entries (including fungi and algae), part 1542.
3266. gbpln1543.seq - Plant sequence entries (including fungi and algae), part 1543.
3267. gbpln1544.seq - Plant sequence entries (including fungi and algae), part 1544.
3268. gbpln1545.seq - Plant sequence entries (including fungi and algae), part 1545.
3269. gbpln1546.seq - Plant sequence entries (including fungi and algae), part 1546.
3270. gbpln1547.seq - Plant sequence entries (including fungi and algae), part 1547.
3271. gbpln1548.seq - Plant sequence entries (including fungi and algae), part 1548.
3272. gbpln1549.seq - Plant sequence entries (including fungi and algae), part 1549.
3273. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
3274. gbpln1550.seq - Plant sequence entries (including fungi and algae), part 1550.
3275. gbpln1551.seq - Plant sequence entries (including fungi and algae), part 1551.
3276. gbpln1552.seq - Plant sequence entries (including fungi and algae), part 1552.
3277. gbpln1553.seq - Plant sequence entries (including fungi and algae), part 1553.
3278. gbpln1554.seq - Plant sequence entries (including fungi and algae), part 1554.
3279. gbpln1555.seq - Plant sequence entries (including fungi and algae), part 1555.
3280. gbpln1556.seq - Plant sequence entries (including fungi and algae), part 1556.
3281. gbpln1557.seq - Plant sequence entries (including fungi and algae), part 1557.
3282. gbpln1558.seq - Plant sequence entries (including fungi and algae), part 1558.
3283. gbpln1559.seq - Plant sequence entries (including fungi and algae), part 1559.
3284. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
3285. gbpln1560.seq - Plant sequence entries (including fungi and algae), part 1560.
3286. gbpln1561.seq - Plant sequence entries (including fungi and algae), part 1561.
3287. gbpln1562.seq - Plant sequence entries (including fungi and algae), part 1562.
3288. gbpln1563.seq - Plant sequence entries (including fungi and algae), part 1563.
3289. gbpln1564.seq - Plant sequence entries (including fungi and algae), part 1564.
3290. gbpln1565.seq - Plant sequence entries (including fungi and algae), part 1565.
3291. gbpln1566.seq - Plant sequence entries (including fungi and algae), part 1566.
3292. gbpln1567.seq - Plant sequence entries (including fungi and algae), part 1567.
3293. gbpln1568.seq - Plant sequence entries (including fungi and algae), part 1568.
3294. gbpln1569.seq - Plant sequence entries (including fungi and algae), part 1569.
3295. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
3296. gbpln1570.seq - Plant sequence entries (including fungi and algae), part 1570.
3297. gbpln1571.seq - Plant sequence entries (including fungi and algae), part 1571.
3298. gbpln1572.seq - Plant sequence entries (including fungi and algae), part 1572.
3299. gbpln1573.seq - Plant sequence entries (including fungi and algae), part 1573.
3300. gbpln1574.seq - Plant sequence entries (including fungi and algae), part 1574.
3301. gbpln1575.seq - Plant sequence entries (including fungi and algae), part 1575.
3302. gbpln1576.seq - Plant sequence entries (including fungi and algae), part 1576.
3303. gbpln1577.seq - Plant sequence entries (including fungi and algae), part 1577.
3304. gbpln1578.seq - Plant sequence entries (including fungi and algae), part 1578.
3305. gbpln1579.seq - Plant sequence entries (including fungi and algae), part 1579.
3306. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
3307. gbpln1580.seq - Plant sequence entries (including fungi and algae), part 1580.
3308. gbpln1581.seq - Plant sequence entries (including fungi and algae), part 1581.
3309. gbpln1582.seq - Plant sequence entries (including fungi and algae), part 1582.
3310. gbpln1583.seq - Plant sequence entries (including fungi and algae), part 1583.
3311. gbpln1584.seq - Plant sequence entries (including fungi and algae), part 1584.
3312. gbpln1585.seq - Plant sequence entries (including fungi and algae), part 1585.
3313. gbpln1586.seq - Plant sequence entries (including fungi and algae), part 1586.
3314. gbpln1587.seq - Plant sequence entries (including fungi and algae), part 1587.
3315. gbpln1588.seq - Plant sequence entries (including fungi and algae), part 1588.
3316. gbpln1589.seq - Plant sequence entries (including fungi and algae), part 1589.
3317. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
3318. gbpln1590.seq - Plant sequence entries (including fungi and algae), part 1590.
3319. gbpln1591.seq - Plant sequence entries (including fungi and algae), part 1591.
3320. gbpln1592.seq - Plant sequence entries (including fungi and algae), part 1592.
3321. gbpln1593.seq - Plant sequence entries (including fungi and algae), part 1593.
3322. gbpln1594.seq - Plant sequence entries (including fungi and algae), part 1594.
3323. gbpln1595.seq - Plant sequence entries (including fungi and algae), part 1595.
3324. gbpln1596.seq - Plant sequence entries (including fungi and algae), part 1596.
3325. gbpln1597.seq - Plant sequence entries (including fungi and algae), part 1597.
3326. gbpln1598.seq - Plant sequence entries (including fungi and algae), part 1598.
3327. gbpln1599.seq - Plant sequence entries (including fungi and algae), part 1599.
3328. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
3329. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
3330. gbpln1600.seq - Plant sequence entries (including fungi and algae), part 1600.
3331. gbpln1601.seq - Plant sequence entries (including fungi and algae), part 1601.
3332. gbpln1602.seq - Plant sequence entries (including fungi and algae), part 1602.
3333. gbpln1603.seq - Plant sequence entries (including fungi and algae), part 1603.
3334. gbpln1604.seq - Plant sequence entries (including fungi and algae), part 1604.
3335. gbpln1605.seq - Plant sequence entries (including fungi and algae), part 1605.
3336. gbpln1606.seq - Plant sequence entries (including fungi and algae), part 1606.
3337. gbpln1607.seq - Plant sequence entries (including fungi and algae), part 1607.
3338. gbpln1608.seq - Plant sequence entries (including fungi and algae), part 1608.
3339. gbpln1609.seq - Plant sequence entries (including fungi and algae), part 1609.
3340. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
3341. gbpln1610.seq - Plant sequence entries (including fungi and algae), part 1610.
3342. gbpln1611.seq - Plant sequence entries (including fungi and algae), part 1611.
3343. gbpln1612.seq - Plant sequence entries (including fungi and algae), part 1612.
3344. gbpln1613.seq - Plant sequence entries (including fungi and algae), part 1613.
3345. gbpln1614.seq - Plant sequence entries (including fungi and algae), part 1614.
3346. gbpln1615.seq - Plant sequence entries (including fungi and algae), part 1615.
3347. gbpln1616.seq - Plant sequence entries (including fungi and algae), part 1616.
3348. gbpln1617.seq - Plant sequence entries (including fungi and algae), part 1617.
3349. gbpln1618.seq - Plant sequence entries (including fungi and algae), part 1618.
3350. gbpln1619.seq - Plant sequence entries (including fungi and algae), part 1619.
3351. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
3352. gbpln1620.seq - Plant sequence entries (including fungi and algae), part 1620.
3353. gbpln1621.seq - Plant sequence entries (including fungi and algae), part 1621.
3354. gbpln1622.seq - Plant sequence entries (including fungi and algae), part 1622.
3355. gbpln1623.seq - Plant sequence entries (including fungi and algae), part 1623.
3356. gbpln1624.seq - Plant sequence entries (including fungi and algae), part 1624.
3357. gbpln1625.seq - Plant sequence entries (including fungi and algae), part 1625.
3358. gbpln1626.seq - Plant sequence entries (including fungi and algae), part 1626.
3359. gbpln1627.seq - Plant sequence entries (including fungi and algae), part 1627.
3360. gbpln1628.seq - Plant sequence entries (including fungi and algae), part 1628.
3361. gbpln1629.seq - Plant sequence entries (including fungi and algae), part 1629.
3362. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
3363. gbpln1630.seq - Plant sequence entries (including fungi and algae), part 1630.
3364. gbpln1631.seq - Plant sequence entries (including fungi and algae), part 1631.
3365. gbpln1632.seq - Plant sequence entries (including fungi and algae), part 1632.
3366. gbpln1633.seq - Plant sequence entries (including fungi and algae), part 1633.
3367. gbpln1634.seq - Plant sequence entries (including fungi and algae), part 1634.
3368. gbpln1635.seq - Plant sequence entries (including fungi and algae), part 1635.
3369. gbpln1636.seq - Plant sequence entries (including fungi and algae), part 1636.
3370. gbpln1637.seq - Plant sequence entries (including fungi and algae), part 1637.
3371. gbpln1638.seq - Plant sequence entries (including fungi and algae), part 1638.
3372. gbpln1639.seq - Plant sequence entries (including fungi and algae), part 1639.
3373. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
3374. gbpln1640.seq - Plant sequence entries (including fungi and algae), part 1640.
3375. gbpln1641.seq - Plant sequence entries (including fungi and algae), part 1641.
3376. gbpln1642.seq - Plant sequence entries (including fungi and algae), part 1642.
3377. gbpln1643.seq - Plant sequence entries (including fungi and algae), part 1643.
3378. gbpln1644.seq - Plant sequence entries (including fungi and algae), part 1644.
3379. gbpln1645.seq - Plant sequence entries (including fungi and algae), part 1645.
3380. gbpln1646.seq - Plant sequence entries (including fungi and algae), part 1646.
3381. gbpln1647.seq - Plant sequence entries (including fungi and algae), part 1647.
3382. gbpln1648.seq - Plant sequence entries (including fungi and algae), part 1648.
3383. gbpln1649.seq - Plant sequence entries (including fungi and algae), part 1649.
3384. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
3385. gbpln1650.seq - Plant sequence entries (including fungi and algae), part 1650.
3386. gbpln1651.seq - Plant sequence entries (including fungi and algae), part 1651.
3387. gbpln1652.seq - Plant sequence entries (including fungi and algae), part 1652.
3388. gbpln1653.seq - Plant sequence entries (including fungi and algae), part 1653.
3389. gbpln1654.seq - Plant sequence entries (including fungi and algae), part 1654.
3390. gbpln1655.seq - Plant sequence entries (including fungi and algae), part 1655.
3391. gbpln1656.seq - Plant sequence entries (including fungi and algae), part 1656.
3392. gbpln1657.seq - Plant sequence entries (including fungi and algae), part 1657.
3393. gbpln1658.seq - Plant sequence entries (including fungi and algae), part 1658.
3394. gbpln1659.seq - Plant sequence entries (including fungi and algae), part 1659.
3395. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
3396. gbpln1660.seq - Plant sequence entries (including fungi and algae), part 1660.
3397. gbpln1661.seq - Plant sequence entries (including fungi and algae), part 1661.
3398. gbpln1662.seq - Plant sequence entries (including fungi and algae), part 1662.
3399. gbpln1663.seq - Plant sequence entries (including fungi and algae), part 1663.
3400. gbpln1664.seq - Plant sequence entries (including fungi and algae), part 1664.
3401. gbpln1665.seq - Plant sequence entries (including fungi and algae), part 1665.
3402. gbpln1666.seq - Plant sequence entries (including fungi and algae), part 1666.
3403. gbpln1667.seq - Plant sequence entries (including fungi and algae), part 1667.
3404. gbpln1668.seq - Plant sequence entries (including fungi and algae), part 1668.
3405. gbpln1669.seq - Plant sequence entries (including fungi and algae), part 1669.
3406. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
3407. gbpln1670.seq - Plant sequence entries (including fungi and algae), part 1670.
3408. gbpln1671.seq - Plant sequence entries (including fungi and algae), part 1671.
3409. gbpln1672.seq - Plant sequence entries (including fungi and algae), part 1672.
3410. gbpln1673.seq - Plant sequence entries (including fungi and algae), part 1673.
3411. gbpln1674.seq - Plant sequence entries (including fungi and algae), part 1674.
3412. gbpln1675.seq - Plant sequence entries (including fungi and algae), part 1675.
3413. gbpln1676.seq - Plant sequence entries (including fungi and algae), part 1676.
3414. gbpln1677.seq - Plant sequence entries (including fungi and algae), part 1677.
3415. gbpln1678.seq - Plant sequence entries (including fungi and algae), part 1678.
3416. gbpln1679.seq - Plant sequence entries (including fungi and algae), part 1679.
3417. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
3418. gbpln1680.seq - Plant sequence entries (including fungi and algae), part 1680.
3419. gbpln1681.seq - Plant sequence entries (including fungi and algae), part 1681.
3420. gbpln1682.seq - Plant sequence entries (including fungi and algae), part 1682.
3421. gbpln1683.seq - Plant sequence entries (including fungi and algae), part 1683.
3422. gbpln1684.seq - Plant sequence entries (including fungi and algae), part 1684.
3423. gbpln1685.seq - Plant sequence entries (including fungi and algae), part 1685.
3424. gbpln1686.seq - Plant sequence entries (including fungi and algae), part 1686.
3425. gbpln1687.seq - Plant sequence entries (including fungi and algae), part 1687.
3426. gbpln1688.seq - Plant sequence entries (including fungi and algae), part 1688.
3427. gbpln1689.seq - Plant sequence entries (including fungi and algae), part 1689.
3428. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
3429. gbpln1690.seq - Plant sequence entries (including fungi and algae), part 1690.
3430. gbpln1691.seq - Plant sequence entries (including fungi and algae), part 1691.
3431. gbpln1692.seq - Plant sequence entries (including fungi and algae), part 1692.
3432. gbpln1693.seq - Plant sequence entries (including fungi and algae), part 1693.
3433. gbpln1694.seq - Plant sequence entries (including fungi and algae), part 1694.
3434. gbpln1695.seq - Plant sequence entries (including fungi and algae), part 1695.
3435. gbpln1696.seq - Plant sequence entries (including fungi and algae), part 1696.
3436. gbpln1697.seq - Plant sequence entries (including fungi and algae), part 1697.
3437. gbpln1698.seq - Plant sequence entries (including fungi and algae), part 1698.
3438. gbpln1699.seq - Plant sequence entries (including fungi and algae), part 1699.
3439. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
3440. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
3441. gbpln1700.seq - Plant sequence entries (including fungi and algae), part 1700.
3442. gbpln1701.seq - Plant sequence entries (including fungi and algae), part 1701.
3443. gbpln1702.seq - Plant sequence entries (including fungi and algae), part 1702.
3444. gbpln1703.seq - Plant sequence entries (including fungi and algae), part 1703.
3445. gbpln1704.seq - Plant sequence entries (including fungi and algae), part 1704.
3446. gbpln1705.seq - Plant sequence entries (including fungi and algae), part 1705.
3447. gbpln1706.seq - Plant sequence entries (including fungi and algae), part 1706.
3448. gbpln1707.seq - Plant sequence entries (including fungi and algae), part 1707.
3449. gbpln1708.seq - Plant sequence entries (including fungi and algae), part 1708.
3450. gbpln1709.seq - Plant sequence entries (including fungi and algae), part 1709.
3451. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
3452. gbpln1710.seq - Plant sequence entries (including fungi and algae), part 1710.
3453. gbpln1711.seq - Plant sequence entries (including fungi and algae), part 1711.
3454. gbpln1712.seq - Plant sequence entries (including fungi and algae), part 1712.
3455. gbpln1713.seq - Plant sequence entries (including fungi and algae), part 1713.
3456. gbpln1714.seq - Plant sequence entries (including fungi and algae), part 1714.
3457. gbpln1715.seq - Plant sequence entries (including fungi and algae), part 1715.
3458. gbpln1716.seq - Plant sequence entries (including fungi and algae), part 1716.
3459. gbpln1717.seq - Plant sequence entries (including fungi and algae), part 1717.
3460. gbpln1718.seq - Plant sequence entries (including fungi and algae), part 1718.
3461. gbpln1719.seq - Plant sequence entries (including fungi and algae), part 1719.
3462. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
3463. gbpln1720.seq - Plant sequence entries (including fungi and algae), part 1720.
3464. gbpln1721.seq - Plant sequence entries (including fungi and algae), part 1721.
3465. gbpln1722.seq - Plant sequence entries (including fungi and algae), part 1722.
3466. gbpln1723.seq - Plant sequence entries (including fungi and algae), part 1723.
3467. gbpln1724.seq - Plant sequence entries (including fungi and algae), part 1724.
3468. gbpln1725.seq - Plant sequence entries (including fungi and algae), part 1725.
3469. gbpln1726.seq - Plant sequence entries (including fungi and algae), part 1726.
3470. gbpln1727.seq - Plant sequence entries (including fungi and algae), part 1727.
3471. gbpln1728.seq - Plant sequence entries (including fungi and algae), part 1728.
3472. gbpln1729.seq - Plant sequence entries (including fungi and algae), part 1729.
3473. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
3474. gbpln1730.seq - Plant sequence entries (including fungi and algae), part 1730.
3475. gbpln1731.seq - Plant sequence entries (including fungi and algae), part 1731.
3476. gbpln1732.seq - Plant sequence entries (including fungi and algae), part 1732.
3477. gbpln1733.seq - Plant sequence entries (including fungi and algae), part 1733.
3478. gbpln1734.seq - Plant sequence entries (including fungi and algae), part 1734.
3479. gbpln1735.seq - Plant sequence entries (including fungi and algae), part 1735.
3480. gbpln1736.seq - Plant sequence entries (including fungi and algae), part 1736.
3481. gbpln1737.seq - Plant sequence entries (including fungi and algae), part 1737.
3482. gbpln1738.seq - Plant sequence entries (including fungi and algae), part 1738.
3483. gbpln1739.seq - Plant sequence entries (including fungi and algae), part 1739.
3484. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
3485. gbpln1740.seq - Plant sequence entries (including fungi and algae), part 1740.
3486. gbpln1741.seq - Plant sequence entries (including fungi and algae), part 1741.
3487. gbpln1742.seq - Plant sequence entries (including fungi and algae), part 1742.
3488. gbpln1743.seq - Plant sequence entries (including fungi and algae), part 1743.
3489. gbpln1744.seq - Plant sequence entries (including fungi and algae), part 1744.
3490. gbpln1745.seq - Plant sequence entries (including fungi and algae), part 1745.
3491. gbpln1746.seq - Plant sequence entries (including fungi and algae), part 1746.
3492. gbpln1747.seq - Plant sequence entries (including fungi and algae), part 1747.
3493. gbpln1748.seq - Plant sequence entries (including fungi and algae), part 1748.
3494. gbpln1749.seq - Plant sequence entries (including fungi and algae), part 1749.
3495. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
3496. gbpln1750.seq - Plant sequence entries (including fungi and algae), part 1750.
3497. gbpln1751.seq - Plant sequence entries (including fungi and algae), part 1751.
3498. gbpln1752.seq - Plant sequence entries (including fungi and algae), part 1752.
3499. gbpln1753.seq - Plant sequence entries (including fungi and algae), part 1753.
3500. gbpln1754.seq - Plant sequence entries (including fungi and algae), part 1754.
3501. gbpln1755.seq - Plant sequence entries (including fungi and algae), part 1755.
3502. gbpln1756.seq - Plant sequence entries (including fungi and algae), part 1756.
3503. gbpln1757.seq - Plant sequence entries (including fungi and algae), part 1757.
3504. gbpln1758.seq - Plant sequence entries (including fungi and algae), part 1758.
3505. gbpln1759.seq - Plant sequence entries (including fungi and algae), part 1759.
3506. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
3507. gbpln1760.seq - Plant sequence entries (including fungi and algae), part 1760.
3508. gbpln1761.seq - Plant sequence entries (including fungi and algae), part 1761.
3509. gbpln1762.seq - Plant sequence entries (including fungi and algae), part 1762.
3510. gbpln1763.seq - Plant sequence entries (including fungi and algae), part 1763.
3511. gbpln1764.seq - Plant sequence entries (including fungi and algae), part 1764.
3512. gbpln1765.seq - Plant sequence entries (including fungi and algae), part 1765.
3513. gbpln1766.seq - Plant sequence entries (including fungi and algae), part 1766.
3514. gbpln1767.seq - Plant sequence entries (including fungi and algae), part 1767.
3515. gbpln1768.seq - Plant sequence entries (including fungi and algae), part 1768.
3516. gbpln1769.seq - Plant sequence entries (including fungi and algae), part 1769.
3517. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
3518. gbpln1770.seq - Plant sequence entries (including fungi and algae), part 1770.
3519. gbpln1771.seq - Plant sequence entries (including fungi and algae), part 1771.
3520. gbpln1772.seq - Plant sequence entries (including fungi and algae), part 1772.
3521. gbpln1773.seq - Plant sequence entries (including fungi and algae), part 1773.
3522. gbpln1774.seq - Plant sequence entries (including fungi and algae), part 1774.
3523. gbpln1775.seq - Plant sequence entries (including fungi and algae), part 1775.
3524. gbpln1776.seq - Plant sequence entries (including fungi and algae), part 1776.
3525. gbpln1777.seq - Plant sequence entries (including fungi and algae), part 1777.
3526. gbpln1778.seq - Plant sequence entries (including fungi and algae), part 1778.
3527. gbpln1779.seq - Plant sequence entries (including fungi and algae), part 1779.
3528. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
3529. gbpln1780.seq - Plant sequence entries (including fungi and algae), part 1780.
3530. gbpln1781.seq - Plant sequence entries (including fungi and algae), part 1781.
3531. gbpln1782.seq - Plant sequence entries (including fungi and algae), part 1782.
3532. gbpln1783.seq - Plant sequence entries (including fungi and algae), part 1783.
3533. gbpln1784.seq - Plant sequence entries (including fungi and algae), part 1784.
3534. gbpln1785.seq - Plant sequence entries (including fungi and algae), part 1785.
3535. gbpln1786.seq - Plant sequence entries (including fungi and algae), part 1786.
3536. gbpln1787.seq - Plant sequence entries (including fungi and algae), part 1787.
3537. gbpln1788.seq - Plant sequence entries (including fungi and algae), part 1788.
3538. gbpln1789.seq - Plant sequence entries (including fungi and algae), part 1789.
3539. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
3540. gbpln1790.seq - Plant sequence entries (including fungi and algae), part 1790.
3541. gbpln1791.seq - Plant sequence entries (including fungi and algae), part 1791.
3542. gbpln1792.seq - Plant sequence entries (including fungi and algae), part 1792.
3543. gbpln1793.seq - Plant sequence entries (including fungi and algae), part 1793.
3544. gbpln1794.seq - Plant sequence entries (including fungi and algae), part 1794.
3545. gbpln1795.seq - Plant sequence entries (including fungi and algae), part 1795.
3546. gbpln1796.seq - Plant sequence entries (including fungi and algae), part 1796.
3547. gbpln1797.seq - Plant sequence entries (including fungi and algae), part 1797.
3548. gbpln1798.seq - Plant sequence entries (including fungi and algae), part 1798.
3549. gbpln1799.seq - Plant sequence entries (including fungi and algae), part 1799.
3550. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
3551. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
3552. gbpln1800.seq - Plant sequence entries (including fungi and algae), part 1800.
3553. gbpln1801.seq - Plant sequence entries (including fungi and algae), part 1801.
3554. gbpln1802.seq - Plant sequence entries (including fungi and algae), part 1802.
3555. gbpln1803.seq - Plant sequence entries (including fungi and algae), part 1803.
3556. gbpln1804.seq - Plant sequence entries (including fungi and algae), part 1804.
3557. gbpln1805.seq - Plant sequence entries (including fungi and algae), part 1805.
3558. gbpln1806.seq - Plant sequence entries (including fungi and algae), part 1806.
3559. gbpln1807.seq - Plant sequence entries (including fungi and algae), part 1807.
3560. gbpln1808.seq - Plant sequence entries (including fungi and algae), part 1808.
3561. gbpln1809.seq - Plant sequence entries (including fungi and algae), part 1809.
3562. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
3563. gbpln1810.seq - Plant sequence entries (including fungi and algae), part 1810.
3564. gbpln1811.seq - Plant sequence entries (including fungi and algae), part 1811.
3565. gbpln1812.seq - Plant sequence entries (including fungi and algae), part 1812.
3566. gbpln1813.seq - Plant sequence entries (including fungi and algae), part 1813.
3567. gbpln1814.seq - Plant sequence entries (including fungi and algae), part 1814.
3568. gbpln1815.seq - Plant sequence entries (including fungi and algae), part 1815.
3569. gbpln1816.seq - Plant sequence entries (including fungi and algae), part 1816.
3570. gbpln1817.seq - Plant sequence entries (including fungi and algae), part 1817.
3571. gbpln1818.seq - Plant sequence entries (including fungi and algae), part 1818.
3572. gbpln1819.seq - Plant sequence entries (including fungi and algae), part 1819.
3573. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
3574. gbpln1820.seq - Plant sequence entries (including fungi and algae), part 1820.
3575. gbpln1821.seq - Plant sequence entries (including fungi and algae), part 1821.
3576. gbpln1822.seq - Plant sequence entries (including fungi and algae), part 1822.
3577. gbpln1823.seq - Plant sequence entries (including fungi and algae), part 1823.
3578. gbpln1824.seq - Plant sequence entries (including fungi and algae), part 1824.
3579. gbpln1825.seq - Plant sequence entries (including fungi and algae), part 1825.
3580. gbpln1826.seq - Plant sequence entries (including fungi and algae), part 1826.
3581. gbpln1827.seq - Plant sequence entries (including fungi and algae), part 1827.
3582. gbpln1828.seq - Plant sequence entries (including fungi and algae), part 1828.
3583. gbpln1829.seq - Plant sequence entries (including fungi and algae), part 1829.
3584. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
3585. gbpln1830.seq - Plant sequence entries (including fungi and algae), part 1830.
3586. gbpln1831.seq - Plant sequence entries (including fungi and algae), part 1831.
3587. gbpln1832.seq - Plant sequence entries (including fungi and algae), part 1832.
3588. gbpln1833.seq - Plant sequence entries (including fungi and algae), part 1833.
3589. gbpln1834.seq - Plant sequence entries (including fungi and algae), part 1834.
3590. gbpln1835.seq - Plant sequence entries (including fungi and algae), part 1835.
3591. gbpln1836.seq - Plant sequence entries (including fungi and algae), part 1836.
3592. gbpln1837.seq - Plant sequence entries (including fungi and algae), part 1837.
3593. gbpln1838.seq - Plant sequence entries (including fungi and algae), part 1838.
3594. gbpln1839.seq - Plant sequence entries (including fungi and algae), part 1839.
3595. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
3596. gbpln1840.seq - Plant sequence entries (including fungi and algae), part 1840.
3597. gbpln1841.seq - Plant sequence entries (including fungi and algae), part 1841.
3598. gbpln1842.seq - Plant sequence entries (including fungi and algae), part 1842.
3599. gbpln1843.seq - Plant sequence entries (including fungi and algae), part 1843.
3600. gbpln1844.seq - Plant sequence entries (including fungi and algae), part 1844.
3601. gbpln1845.seq - Plant sequence entries (including fungi and algae), part 1845.
3602. gbpln1846.seq - Plant sequence entries (including fungi and algae), part 1846.
3603. gbpln1847.seq - Plant sequence entries (including fungi and algae), part 1847.
3604. gbpln1848.seq - Plant sequence entries (including fungi and algae), part 1848.
3605. gbpln1849.seq - Plant sequence entries (including fungi and algae), part 1849.
3606. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
3607. gbpln1850.seq - Plant sequence entries (including fungi and algae), part 1850.
3608. gbpln1851.seq - Plant sequence entries (including fungi and algae), part 1851.
3609. gbpln1852.seq - Plant sequence entries (including fungi and algae), part 1852.
3610. gbpln1853.seq - Plant sequence entries (including fungi and algae), part 1853.
3611. gbpln1854.seq - Plant sequence entries (including fungi and algae), part 1854.
3612. gbpln1855.seq - Plant sequence entries (including fungi and algae), part 1855.
3613. gbpln1856.seq - Plant sequence entries (including fungi and algae), part 1856.
3614. gbpln1857.seq - Plant sequence entries (including fungi and algae), part 1857.
3615. gbpln1858.seq - Plant sequence entries (including fungi and algae), part 1858.
3616. gbpln1859.seq - Plant sequence entries (including fungi and algae), part 1859.
3617. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
3618. gbpln1860.seq - Plant sequence entries (including fungi and algae), part 1860.
3619. gbpln1861.seq - Plant sequence entries (including fungi and algae), part 1861.
3620. gbpln1862.seq - Plant sequence entries (including fungi and algae), part 1862.
3621. gbpln1863.seq - Plant sequence entries (including fungi and algae), part 1863.
3622. gbpln1864.seq - Plant sequence entries (including fungi and algae), part 1864.
3623. gbpln1865.seq - Plant sequence entries (including fungi and algae), part 1865.
3624. gbpln1866.seq - Plant sequence entries (including fungi and algae), part 1866.
3625. gbpln1867.seq - Plant sequence entries (including fungi and algae), part 1867.
3626. gbpln1868.seq - Plant sequence entries (including fungi and algae), part 1868.
3627. gbpln1869.seq - Plant sequence entries (including fungi and algae), part 1869.
3628. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
3629. gbpln1870.seq - Plant sequence entries (including fungi and algae), part 1870.
3630. gbpln1871.seq - Plant sequence entries (including fungi and algae), part 1871.
3631. gbpln1872.seq - Plant sequence entries (including fungi and algae), part 1872.
3632. gbpln1873.seq - Plant sequence entries (including fungi and algae), part 1873.
3633. gbpln1874.seq - Plant sequence entries (including fungi and algae), part 1874.
3634. gbpln1875.seq - Plant sequence entries (including fungi and algae), part 1875.
3635. gbpln1876.seq - Plant sequence entries (including fungi and algae), part 1876.
3636. gbpln1877.seq - Plant sequence entries (including fungi and algae), part 1877.
3637. gbpln1878.seq - Plant sequence entries (including fungi and algae), part 1878.
3638. gbpln1879.seq - Plant sequence entries (including fungi and algae), part 1879.
3639. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
3640. gbpln1880.seq - Plant sequence entries (including fungi and algae), part 1880.
3641. gbpln1881.seq - Plant sequence entries (including fungi and algae), part 1881.
3642. gbpln1882.seq - Plant sequence entries (including fungi and algae), part 1882.
3643. gbpln1883.seq - Plant sequence entries (including fungi and algae), part 1883.
3644. gbpln1884.seq - Plant sequence entries (including fungi and algae), part 1884.
3645. gbpln1885.seq - Plant sequence entries (including fungi and algae), part 1885.
3646. gbpln1886.seq - Plant sequence entries (including fungi and algae), part 1886.
3647. gbpln1887.seq - Plant sequence entries (including fungi and algae), part 1887.
3648. gbpln1888.seq - Plant sequence entries (including fungi and algae), part 1888.
3649. gbpln1889.seq - Plant sequence entries (including fungi and algae), part 1889.
3650. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
3651. gbpln1890.seq - Plant sequence entries (including fungi and algae), part 1890.
3652. gbpln1891.seq - Plant sequence entries (including fungi and algae), part 1891.
3653. gbpln1892.seq - Plant sequence entries (including fungi and algae), part 1892.
3654. gbpln1893.seq - Plant sequence entries (including fungi and algae), part 1893.
3655. gbpln1894.seq - Plant sequence entries (including fungi and algae), part 1894.
3656. gbpln1895.seq - Plant sequence entries (including fungi and algae), part 1895.
3657. gbpln1896.seq - Plant sequence entries (including fungi and algae), part 1896.
3658. gbpln1897.seq - Plant sequence entries (including fungi and algae), part 1897.
3659. gbpln1898.seq - Plant sequence entries (including fungi and algae), part 1898.
3660. gbpln1899.seq - Plant sequence entries (including fungi and algae), part 1899.
3661. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
3662. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
3663. gbpln1900.seq - Plant sequence entries (including fungi and algae), part 1900.
3664. gbpln1901.seq - Plant sequence entries (including fungi and algae), part 1901.
3665. gbpln1902.seq - Plant sequence entries (including fungi and algae), part 1902.
3666. gbpln1903.seq - Plant sequence entries (including fungi and algae), part 1903.
3667. gbpln1904.seq - Plant sequence entries (including fungi and algae), part 1904.
3668. gbpln1905.seq - Plant sequence entries (including fungi and algae), part 1905.
3669. gbpln1906.seq - Plant sequence entries (including fungi and algae), part 1906.
3670. gbpln1907.seq - Plant sequence entries (including fungi and algae), part 1907.
3671. gbpln1908.seq - Plant sequence entries (including fungi and algae), part 1908.
3672. gbpln1909.seq - Plant sequence entries (including fungi and algae), part 1909.
3673. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
3674. gbpln1910.seq - Plant sequence entries (including fungi and algae), part 1910.
3675. gbpln1911.seq - Plant sequence entries (including fungi and algae), part 1911.
3676. gbpln1912.seq - Plant sequence entries (including fungi and algae), part 1912.
3677. gbpln1913.seq - Plant sequence entries (including fungi and algae), part 1913.
3678. gbpln1914.seq - Plant sequence entries (including fungi and algae), part 1914.
3679. gbpln1915.seq - Plant sequence entries (including fungi and algae), part 1915.
3680. gbpln1916.seq - Plant sequence entries (including fungi and algae), part 1916.
3681. gbpln1917.seq - Plant sequence entries (including fungi and algae), part 1917.
3682. gbpln1918.seq - Plant sequence entries (including fungi and algae), part 1918.
3683. gbpln1919.seq - Plant sequence entries (including fungi and algae), part 1919.
3684. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
3685. gbpln1920.seq - Plant sequence entries (including fungi and algae), part 1920.
3686. gbpln1921.seq - Plant sequence entries (including fungi and algae), part 1921.
3687. gbpln1922.seq - Plant sequence entries (including fungi and algae), part 1922.
3688. gbpln1923.seq - Plant sequence entries (including fungi and algae), part 1923.
3689. gbpln1924.seq - Plant sequence entries (including fungi and algae), part 1924.
3690. gbpln1925.seq - Plant sequence entries (including fungi and algae), part 1925.
3691. gbpln1926.seq - Plant sequence entries (including fungi and algae), part 1926.
3692. gbpln1927.seq - Plant sequence entries (including fungi and algae), part 1927.
3693. gbpln1928.seq - Plant sequence entries (including fungi and algae), part 1928.
3694. gbpln1929.seq - Plant sequence entries (including fungi and algae), part 1929.
3695. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
3696. gbpln1930.seq - Plant sequence entries (including fungi and algae), part 1930.
3697. gbpln1931.seq - Plant sequence entries (including fungi and algae), part 1931.
3698. gbpln1932.seq - Plant sequence entries (including fungi and algae), part 1932.
3699. gbpln1933.seq - Plant sequence entries (including fungi and algae), part 1933.
3700. gbpln1934.seq - Plant sequence entries (including fungi and algae), part 1934.
3701. gbpln1935.seq - Plant sequence entries (including fungi and algae), part 1935.
3702. gbpln1936.seq - Plant sequence entries (including fungi and algae), part 1936.
3703. gbpln1937.seq - Plant sequence entries (including fungi and algae), part 1937.
3704. gbpln1938.seq - Plant sequence entries (including fungi and algae), part 1938.
3705. gbpln1939.seq - Plant sequence entries (including fungi and algae), part 1939.
3706. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
3707. gbpln1940.seq - Plant sequence entries (including fungi and algae), part 1940.
3708. gbpln1941.seq - Plant sequence entries (including fungi and algae), part 1941.
3709. gbpln1942.seq - Plant sequence entries (including fungi and algae), part 1942.
3710. gbpln1943.seq - Plant sequence entries (including fungi and algae), part 1943.
3711. gbpln1944.seq - Plant sequence entries (including fungi and algae), part 1944.
3712. gbpln1945.seq - Plant sequence entries (including fungi and algae), part 1945.
3713. gbpln1946.seq - Plant sequence entries (including fungi and algae), part 1946.
3714. gbpln1947.seq - Plant sequence entries (including fungi and algae), part 1947.
3715. gbpln1948.seq - Plant sequence entries (including fungi and algae), part 1948.
3716. gbpln1949.seq - Plant sequence entries (including fungi and algae), part 1949.
3717. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
3718. gbpln1950.seq - Plant sequence entries (including fungi and algae), part 1950.
3719. gbpln1951.seq - Plant sequence entries (including fungi and algae), part 1951.
3720. gbpln1952.seq - Plant sequence entries (including fungi and algae), part 1952.
3721. gbpln1953.seq - Plant sequence entries (including fungi and algae), part 1953.
3722. gbpln1954.seq - Plant sequence entries (including fungi and algae), part 1954.
3723. gbpln1955.seq - Plant sequence entries (including fungi and algae), part 1955.
3724. gbpln1956.seq - Plant sequence entries (including fungi and algae), part 1956.
3725. gbpln1957.seq - Plant sequence entries (including fungi and algae), part 1957.
3726. gbpln1958.seq - Plant sequence entries (including fungi and algae), part 1958.
3727. gbpln1959.seq - Plant sequence entries (including fungi and algae), part 1959.
3728. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
3729. gbpln1960.seq - Plant sequence entries (including fungi and algae), part 1960.
3730. gbpln1961.seq - Plant sequence entries (including fungi and algae), part 1961.
3731. gbpln1962.seq - Plant sequence entries (including fungi and algae), part 1962.
3732. gbpln1963.seq - Plant sequence entries (including fungi and algae), part 1963.
3733. gbpln1964.seq - Plant sequence entries (including fungi and algae), part 1964.
3734. gbpln1965.seq - Plant sequence entries (including fungi and algae), part 1965.
3735. gbpln1966.seq - Plant sequence entries (including fungi and algae), part 1966.
3736. gbpln1967.seq - Plant sequence entries (including fungi and algae), part 1967.
3737. gbpln1968.seq - Plant sequence entries (including fungi and algae), part 1968.
3738. gbpln1969.seq - Plant sequence entries (including fungi and algae), part 1969.
3739. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
3740. gbpln1970.seq - Plant sequence entries (including fungi and algae), part 1970.
3741. gbpln1971.seq - Plant sequence entries (including fungi and algae), part 1971.
3742. gbpln1972.seq - Plant sequence entries (including fungi and algae), part 1972.
3743. gbpln1973.seq - Plant sequence entries (including fungi and algae), part 1973.
3744. gbpln1974.seq - Plant sequence entries (including fungi and algae), part 1974.
3745. gbpln1975.seq - Plant sequence entries (including fungi and algae), part 1975.
3746. gbpln1976.seq - Plant sequence entries (including fungi and algae), part 1976.
3747. gbpln1977.seq - Plant sequence entries (including fungi and algae), part 1977.
3748. gbpln1978.seq - Plant sequence entries (including fungi and algae), part 1978.
3749. gbpln1979.seq - Plant sequence entries (including fungi and algae), part 1979.
3750. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
3751. gbpln1980.seq - Plant sequence entries (including fungi and algae), part 1980.
3752. gbpln1981.seq - Plant sequence entries (including fungi and algae), part 1981.
3753. gbpln1982.seq - Plant sequence entries (including fungi and algae), part 1982.
3754. gbpln1983.seq - Plant sequence entries (including fungi and algae), part 1983.
3755. gbpln1984.seq - Plant sequence entries (including fungi and algae), part 1984.
3756. gbpln1985.seq - Plant sequence entries (including fungi and algae), part 1985.
3757. gbpln1986.seq - Plant sequence entries (including fungi and algae), part 1986.
3758. gbpln1987.seq - Plant sequence entries (including fungi and algae), part 1987.
3759. gbpln1988.seq - Plant sequence entries (including fungi and algae), part 1988.
3760. gbpln1989.seq - Plant sequence entries (including fungi and algae), part 1989.
3761. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
3762. gbpln1990.seq - Plant sequence entries (including fungi and algae), part 1990.
3763. gbpln1991.seq - Plant sequence entries (including fungi and algae), part 1991.
3764. gbpln1992.seq - Plant sequence entries (including fungi and algae), part 1992.
3765. gbpln1993.seq - Plant sequence entries (including fungi and algae), part 1993.
3766. gbpln1994.seq - Plant sequence entries (including fungi and algae), part 1994.
3767. gbpln1995.seq - Plant sequence entries (including fungi and algae), part 1995.
3768. gbpln1996.seq - Plant sequence entries (including fungi and algae), part 1996.
3769. gbpln1997.seq - Plant sequence entries (including fungi and algae), part 1997.
3770. gbpln1998.seq - Plant sequence entries (including fungi and algae), part 1998.
3771. gbpln1999.seq - Plant sequence entries (including fungi and algae), part 1999.
3772. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
3773. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
3774. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
3775. gbpln2000.seq - Plant sequence entries (including fungi and algae), part 2000.
3776. gbpln2001.seq - Plant sequence entries (including fungi and algae), part 2001.
3777. gbpln2002.seq - Plant sequence entries (including fungi and algae), part 2002.
3778. gbpln2003.seq - Plant sequence entries (including fungi and algae), part 2003.
3779. gbpln2004.seq - Plant sequence entries (including fungi and algae), part 2004.
3780. gbpln2005.seq - Plant sequence entries (including fungi and algae), part 2005.
3781. gbpln2006.seq - Plant sequence entries (including fungi and algae), part 2006.
3782. gbpln2007.seq - Plant sequence entries (including fungi and algae), part 2007.
3783. gbpln2008.seq - Plant sequence entries (including fungi and algae), part 2008.
3784. gbpln2009.seq - Plant sequence entries (including fungi and algae), part 2009.
3785. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
3786. gbpln2010.seq - Plant sequence entries (including fungi and algae), part 2010.
3787. gbpln2011.seq - Plant sequence entries (including fungi and algae), part 2011.
3788. gbpln2012.seq - Plant sequence entries (including fungi and algae), part 2012.
3789. gbpln2013.seq - Plant sequence entries (including fungi and algae), part 2013.
3790. gbpln2014.seq - Plant sequence entries (including fungi and algae), part 2014.
3791. gbpln2015.seq - Plant sequence entries (including fungi and algae), part 2015.
3792. gbpln2016.seq - Plant sequence entries (including fungi and algae), part 2016.
3793. gbpln2017.seq - Plant sequence entries (including fungi and algae), part 2017.
3794. gbpln2018.seq - Plant sequence entries (including fungi and algae), part 2018.
3795. gbpln2019.seq - Plant sequence entries (including fungi and algae), part 2019.
3796. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
3797. gbpln2020.seq - Plant sequence entries (including fungi and algae), part 2020.
3798. gbpln2021.seq - Plant sequence entries (including fungi and algae), part 2021.
3799. gbpln2022.seq - Plant sequence entries (including fungi and algae), part 2022.
3800. gbpln2023.seq - Plant sequence entries (including fungi and algae), part 2023.
3801. gbpln2024.seq - Plant sequence entries (including fungi and algae), part 2024.
3802. gbpln2025.seq - Plant sequence entries (including fungi and algae), part 2025.
3803. gbpln2026.seq - Plant sequence entries (including fungi and algae), part 2026.
3804. gbpln2027.seq - Plant sequence entries (including fungi and algae), part 2027.
3805. gbpln2028.seq - Plant sequence entries (including fungi and algae), part 2028.
3806. gbpln2029.seq - Plant sequence entries (including fungi and algae), part 2029.
3807. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
3808. gbpln2030.seq - Plant sequence entries (including fungi and algae), part 2030.
3809. gbpln2031.seq - Plant sequence entries (including fungi and algae), part 2031.
3810. gbpln2032.seq - Plant sequence entries (including fungi and algae), part 2032.
3811. gbpln2033.seq - Plant sequence entries (including fungi and algae), part 2033.
3812. gbpln2034.seq - Plant sequence entries (including fungi and algae), part 2034.
3813. gbpln2035.seq - Plant sequence entries (including fungi and algae), part 2035.
3814. gbpln2036.seq - Plant sequence entries (including fungi and algae), part 2036.
3815. gbpln2037.seq - Plant sequence entries (including fungi and algae), part 2037.
3816. gbpln2038.seq - Plant sequence entries (including fungi and algae), part 2038.
3817. gbpln2039.seq - Plant sequence entries (including fungi and algae), part 2039.
3818. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
3819. gbpln2040.seq - Plant sequence entries (including fungi and algae), part 2040.
3820. gbpln2041.seq - Plant sequence entries (including fungi and algae), part 2041.
3821. gbpln2042.seq - Plant sequence entries (including fungi and algae), part 2042.
3822. gbpln2043.seq - Plant sequence entries (including fungi and algae), part 2043.
3823. gbpln2044.seq - Plant sequence entries (including fungi and algae), part 2044.
3824. gbpln2045.seq - Plant sequence entries (including fungi and algae), part 2045.
3825. gbpln2046.seq - Plant sequence entries (including fungi and algae), part 2046.
3826. gbpln2047.seq - Plant sequence entries (including fungi and algae), part 2047.
3827. gbpln2048.seq - Plant sequence entries (including fungi and algae), part 2048.
3828. gbpln2049.seq - Plant sequence entries (including fungi and algae), part 2049.
3829. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
3830. gbpln2050.seq - Plant sequence entries (including fungi and algae), part 2050.
3831. gbpln2051.seq - Plant sequence entries (including fungi and algae), part 2051.
3832. gbpln2052.seq - Plant sequence entries (including fungi and algae), part 2052.
3833. gbpln2053.seq - Plant sequence entries (including fungi and algae), part 2053.
3834. gbpln2054.seq - Plant sequence entries (including fungi and algae), part 2054.
3835. gbpln2055.seq - Plant sequence entries (including fungi and algae), part 2055.
3836. gbpln2056.seq - Plant sequence entries (including fungi and algae), part 2056.
3837. gbpln2057.seq - Plant sequence entries (including fungi and algae), part 2057.
3838. gbpln2058.seq - Plant sequence entries (including fungi and algae), part 2058.
3839. gbpln2059.seq - Plant sequence entries (including fungi and algae), part 2059.
3840. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
3841. gbpln2060.seq - Plant sequence entries (including fungi and algae), part 2060.
3842. gbpln2061.seq - Plant sequence entries (including fungi and algae), part 2061.
3843. gbpln2062.seq - Plant sequence entries (including fungi and algae), part 2062.
3844. gbpln2063.seq - Plant sequence entries (including fungi and algae), part 2063.
3845. gbpln2064.seq - Plant sequence entries (including fungi and algae), part 2064.
3846. gbpln2065.seq - Plant sequence entries (including fungi and algae), part 2065.
3847. gbpln2066.seq - Plant sequence entries (including fungi and algae), part 2066.
3848. gbpln2067.seq - Plant sequence entries (including fungi and algae), part 2067.
3849. gbpln2068.seq - Plant sequence entries (including fungi and algae), part 2068.
3850. gbpln2069.seq - Plant sequence entries (including fungi and algae), part 2069.
3851. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
3852. gbpln2070.seq - Plant sequence entries (including fungi and algae), part 2070.
3853. gbpln2071.seq - Plant sequence entries (including fungi and algae), part 2071.
3854. gbpln2072.seq - Plant sequence entries (including fungi and algae), part 2072.
3855. gbpln2073.seq - Plant sequence entries (including fungi and algae), part 2073.
3856. gbpln2074.seq - Plant sequence entries (including fungi and algae), part 2074.
3857. gbpln2075.seq - Plant sequence entries (including fungi and algae), part 2075.
3858. gbpln2076.seq - Plant sequence entries (including fungi and algae), part 2076.
3859. gbpln2077.seq - Plant sequence entries (including fungi and algae), part 2077.
3860. gbpln2078.seq - Plant sequence entries (including fungi and algae), part 2078.
3861. gbpln2079.seq - Plant sequence entries (including fungi and algae), part 2079.
3862. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
3863. gbpln2080.seq - Plant sequence entries (including fungi and algae), part 2080.
3864. gbpln2081.seq - Plant sequence entries (including fungi and algae), part 2081.
3865. gbpln2082.seq - Plant sequence entries (including fungi and algae), part 2082.
3866. gbpln2083.seq - Plant sequence entries (including fungi and algae), part 2083.
3867. gbpln2084.seq - Plant sequence entries (including fungi and algae), part 2084.
3868. gbpln2085.seq - Plant sequence entries (including fungi and algae), part 2085.
3869. gbpln2086.seq - Plant sequence entries (including fungi and algae), part 2086.
3870. gbpln2087.seq - Plant sequence entries (including fungi and algae), part 2087.
3871. gbpln2088.seq - Plant sequence entries (including fungi and algae), part 2088.
3872. gbpln2089.seq - Plant sequence entries (including fungi and algae), part 2089.
3873. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
3874. gbpln2090.seq - Plant sequence entries (including fungi and algae), part 2090.
3875. gbpln2091.seq - Plant sequence entries (including fungi and algae), part 2091.
3876. gbpln2092.seq - Plant sequence entries (including fungi and algae), part 2092.
3877. gbpln2093.seq - Plant sequence entries (including fungi and algae), part 2093.
3878. gbpln2094.seq - Plant sequence entries (including fungi and algae), part 2094.
3879. gbpln2095.seq - Plant sequence entries (including fungi and algae), part 2095.
3880. gbpln2096.seq - Plant sequence entries (including fungi and algae), part 2096.
3881. gbpln2097.seq - Plant sequence entries (including fungi and algae), part 2097.
3882. gbpln2098.seq - Plant sequence entries (including fungi and algae), part 2098.
3883. gbpln2099.seq - Plant sequence entries (including fungi and algae), part 2099.
3884. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
3885. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
3886. gbpln2100.seq - Plant sequence entries (including fungi and algae), part 2100.
3887. gbpln2101.seq - Plant sequence entries (including fungi and algae), part 2101.
3888. gbpln2102.seq - Plant sequence entries (including fungi and algae), part 2102.
3889. gbpln2103.seq - Plant sequence entries (including fungi and algae), part 2103.
3890. gbpln2104.seq - Plant sequence entries (including fungi and algae), part 2104.
3891. gbpln2105.seq - Plant sequence entries (including fungi and algae), part 2105.
3892. gbpln2106.seq - Plant sequence entries (including fungi and algae), part 2106.
3893. gbpln2107.seq - Plant sequence entries (including fungi and algae), part 2107.
3894. gbpln2108.seq - Plant sequence entries (including fungi and algae), part 2108.
3895. gbpln2109.seq - Plant sequence entries (including fungi and algae), part 2109.
3896. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
3897. gbpln2110.seq - Plant sequence entries (including fungi and algae), part 2110.
3898. gbpln2111.seq - Plant sequence entries (including fungi and algae), part 2111.
3899. gbpln2112.seq - Plant sequence entries (including fungi and algae), part 2112.
3900. gbpln2113.seq - Plant sequence entries (including fungi and algae), part 2113.
3901. gbpln2114.seq - Plant sequence entries (including fungi and algae), part 2114.
3902. gbpln2115.seq - Plant sequence entries (including fungi and algae), part 2115.
3903. gbpln2116.seq - Plant sequence entries (including fungi and algae), part 2116.
3904. gbpln2117.seq - Plant sequence entries (including fungi and algae), part 2117.
3905. gbpln2118.seq - Plant sequence entries (including fungi and algae), part 2118.
3906. gbpln2119.seq - Plant sequence entries (including fungi and algae), part 2119.
3907. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
3908. gbpln2120.seq - Plant sequence entries (including fungi and algae), part 2120.
3909. gbpln2121.seq - Plant sequence entries (including fungi and algae), part 2121.
3910. gbpln2122.seq - Plant sequence entries (including fungi and algae), part 2122.
3911. gbpln2123.seq - Plant sequence entries (including fungi and algae), part 2123.
3912. gbpln2124.seq - Plant sequence entries (including fungi and algae), part 2124.
3913. gbpln2125.seq - Plant sequence entries (including fungi and algae), part 2125.
3914. gbpln2126.seq - Plant sequence entries (including fungi and algae), part 2126.
3915. gbpln2127.seq - Plant sequence entries (including fungi and algae), part 2127.
3916. gbpln2128.seq - Plant sequence entries (including fungi and algae), part 2128.
3917. gbpln2129.seq - Plant sequence entries (including fungi and algae), part 2129.
3918. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
3919. gbpln2130.seq - Plant sequence entries (including fungi and algae), part 2130.
3920. gbpln2131.seq - Plant sequence entries (including fungi and algae), part 2131.
3921. gbpln2132.seq - Plant sequence entries (including fungi and algae), part 2132.
3922. gbpln2133.seq - Plant sequence entries (including fungi and algae), part 2133.
3923. gbpln2134.seq - Plant sequence entries (including fungi and algae), part 2134.
3924. gbpln2135.seq - Plant sequence entries (including fungi and algae), part 2135.
3925. gbpln2136.seq - Plant sequence entries (including fungi and algae), part 2136.
3926. gbpln2137.seq - Plant sequence entries (including fungi and algae), part 2137.
3927. gbpln2138.seq - Plant sequence entries (including fungi and algae), part 2138.
3928. gbpln2139.seq - Plant sequence entries (including fungi and algae), part 2139.
3929. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
3930. gbpln2140.seq - Plant sequence entries (including fungi and algae), part 2140.
3931. gbpln2141.seq - Plant sequence entries (including fungi and algae), part 2141.
3932. gbpln2142.seq - Plant sequence entries (including fungi and algae), part 2142.
3933. gbpln2143.seq - Plant sequence entries (including fungi and algae), part 2143.
3934. gbpln2144.seq - Plant sequence entries (including fungi and algae), part 2144.
3935. gbpln2145.seq - Plant sequence entries (including fungi and algae), part 2145.
3936. gbpln2146.seq - Plant sequence entries (including fungi and algae), part 2146.
3937. gbpln2147.seq - Plant sequence entries (including fungi and algae), part 2147.
3938. gbpln2148.seq - Plant sequence entries (including fungi and algae), part 2148.
3939. gbpln2149.seq - Plant sequence entries (including fungi and algae), part 2149.
3940. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
3941. gbpln2150.seq - Plant sequence entries (including fungi and algae), part 2150.
3942. gbpln2151.seq - Plant sequence entries (including fungi and algae), part 2151.
3943. gbpln2152.seq - Plant sequence entries (including fungi and algae), part 2152.
3944. gbpln2153.seq - Plant sequence entries (including fungi and algae), part 2153.
3945. gbpln2154.seq - Plant sequence entries (including fungi and algae), part 2154.
3946. gbpln2155.seq - Plant sequence entries (including fungi and algae), part 2155.
3947. gbpln2156.seq - Plant sequence entries (including fungi and algae), part 2156.
3948. gbpln2157.seq - Plant sequence entries (including fungi and algae), part 2157.
3949. gbpln2158.seq - Plant sequence entries (including fungi and algae), part 2158.
3950. gbpln2159.seq - Plant sequence entries (including fungi and algae), part 2159.
3951. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
3952. gbpln2160.seq - Plant sequence entries (including fungi and algae), part 2160.
3953. gbpln2161.seq - Plant sequence entries (including fungi and algae), part 2161.
3954. gbpln2162.seq - Plant sequence entries (including fungi and algae), part 2162.
3955. gbpln2163.seq - Plant sequence entries (including fungi and algae), part 2163.
3956. gbpln2164.seq - Plant sequence entries (including fungi and algae), part 2164.
3957. gbpln2165.seq - Plant sequence entries (including fungi and algae), part 2165.
3958. gbpln2166.seq - Plant sequence entries (including fungi and algae), part 2166.
3959. gbpln2167.seq - Plant sequence entries (including fungi and algae), part 2167.
3960. gbpln2168.seq - Plant sequence entries (including fungi and algae), part 2168.
3961. gbpln2169.seq - Plant sequence entries (including fungi and algae), part 2169.
3962. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
3963. gbpln2170.seq - Plant sequence entries (including fungi and algae), part 2170.
3964. gbpln2171.seq - Plant sequence entries (including fungi and algae), part 2171.
3965. gbpln2172.seq - Plant sequence entries (including fungi and algae), part 2172.
3966. gbpln2173.seq - Plant sequence entries (including fungi and algae), part 2173.
3967. gbpln2174.seq - Plant sequence entries (including fungi and algae), part 2174.
3968. gbpln2175.seq - Plant sequence entries (including fungi and algae), part 2175.
3969. gbpln2176.seq - Plant sequence entries (including fungi and algae), part 2176.
3970. gbpln2177.seq - Plant sequence entries (including fungi and algae), part 2177.
3971. gbpln2178.seq - Plant sequence entries (including fungi and algae), part 2178.
3972. gbpln2179.seq - Plant sequence entries (including fungi and algae), part 2179.
3973. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
3974. gbpln2180.seq - Plant sequence entries (including fungi and algae), part 2180.
3975. gbpln2181.seq - Plant sequence entries (including fungi and algae), part 2181.
3976. gbpln2182.seq - Plant sequence entries (including fungi and algae), part 2182.
3977. gbpln2183.seq - Plant sequence entries (including fungi and algae), part 2183.
3978. gbpln2184.seq - Plant sequence entries (including fungi and algae), part 2184.
3979. gbpln2185.seq - Plant sequence entries (including fungi and algae), part 2185.
3980. gbpln2186.seq - Plant sequence entries (including fungi and algae), part 2186.
3981. gbpln2187.seq - Plant sequence entries (including fungi and algae), part 2187.
3982. gbpln2188.seq - Plant sequence entries (including fungi and algae), part 2188.
3983. gbpln2189.seq - Plant sequence entries (including fungi and algae), part 2189.
3984. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
3985. gbpln2190.seq - Plant sequence entries (including fungi and algae), part 2190.
3986. gbpln2191.seq - Plant sequence entries (including fungi and algae), part 2191.
3987. gbpln2192.seq - Plant sequence entries (including fungi and algae), part 2192.
3988. gbpln2193.seq - Plant sequence entries (including fungi and algae), part 2193.
3989. gbpln2194.seq - Plant sequence entries (including fungi and algae), part 2194.
3990. gbpln2195.seq - Plant sequence entries (including fungi and algae), part 2195.
3991. gbpln2196.seq - Plant sequence entries (including fungi and algae), part 2196.
3992. gbpln2197.seq - Plant sequence entries (including fungi and algae), part 2197.
3993. gbpln2198.seq - Plant sequence entries (including fungi and algae), part 2198.
3994. gbpln2199.seq - Plant sequence entries (including fungi and algae), part 2199.
3995. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
3996. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
3997. gbpln2200.seq - Plant sequence entries (including fungi and algae), part 2200.
3998. gbpln2201.seq - Plant sequence entries (including fungi and algae), part 2201.
3999. gbpln2202.seq - Plant sequence entries (including fungi and algae), part 2202.
4000. gbpln2203.seq - Plant sequence entries (including fungi and algae), part 2203.
4001. gbpln2204.seq - Plant sequence entries (including fungi and algae), part 2204.
4002. gbpln2205.seq - Plant sequence entries (including fungi and algae), part 2205.
4003. gbpln2206.seq - Plant sequence entries (including fungi and algae), part 2206.
4004. gbpln2207.seq - Plant sequence entries (including fungi and algae), part 2207.
4005. gbpln2208.seq - Plant sequence entries (including fungi and algae), part 2208.
4006. gbpln2209.seq - Plant sequence entries (including fungi and algae), part 2209.
4007. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
4008. gbpln2210.seq - Plant sequence entries (including fungi and algae), part 2210.
4009. gbpln2211.seq - Plant sequence entries (including fungi and algae), part 2211.
4010. gbpln2212.seq - Plant sequence entries (including fungi and algae), part 2212.
4011. gbpln2213.seq - Plant sequence entries (including fungi and algae), part 2213.
4012. gbpln2214.seq - Plant sequence entries (including fungi and algae), part 2214.
4013. gbpln2215.seq - Plant sequence entries (including fungi and algae), part 2215.
4014. gbpln2216.seq - Plant sequence entries (including fungi and algae), part 2216.
4015. gbpln2217.seq - Plant sequence entries (including fungi and algae), part 2217.
4016. gbpln2218.seq - Plant sequence entries (including fungi and algae), part 2218.
4017. gbpln2219.seq - Plant sequence entries (including fungi and algae), part 2219.
4018. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
4019. gbpln2220.seq - Plant sequence entries (including fungi and algae), part 2220.
4020. gbpln2221.seq - Plant sequence entries (including fungi and algae), part 2221.
4021. gbpln2222.seq - Plant sequence entries (including fungi and algae), part 2222.
4022. gbpln2223.seq - Plant sequence entries (including fungi and algae), part 2223.
4023. gbpln2224.seq - Plant sequence entries (including fungi and algae), part 2224.
4024. gbpln2225.seq - Plant sequence entries (including fungi and algae), part 2225.
4025. gbpln2226.seq - Plant sequence entries (including fungi and algae), part 2226.
4026. gbpln2227.seq - Plant sequence entries (including fungi and algae), part 2227.
4027. gbpln2228.seq - Plant sequence entries (including fungi and algae), part 2228.
4028. gbpln2229.seq - Plant sequence entries (including fungi and algae), part 2229.
4029. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
4030. gbpln2230.seq - Plant sequence entries (including fungi and algae), part 2230.
4031. gbpln2231.seq - Plant sequence entries (including fungi and algae), part 2231.
4032. gbpln2232.seq - Plant sequence entries (including fungi and algae), part 2232.
4033. gbpln2233.seq - Plant sequence entries (including fungi and algae), part 2233.
4034. gbpln2234.seq - Plant sequence entries (including fungi and algae), part 2234.
4035. gbpln2235.seq - Plant sequence entries (including fungi and algae), part 2235.
4036. gbpln2236.seq - Plant sequence entries (including fungi and algae), part 2236.
4037. gbpln2237.seq - Plant sequence entries (including fungi and algae), part 2237.
4038. gbpln2238.seq - Plant sequence entries (including fungi and algae), part 2238.
4039. gbpln2239.seq - Plant sequence entries (including fungi and algae), part 2239.
4040. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
4041. gbpln2240.seq - Plant sequence entries (including fungi and algae), part 2240.
4042. gbpln2241.seq - Plant sequence entries (including fungi and algae), part 2241.
4043. gbpln2242.seq - Plant sequence entries (including fungi and algae), part 2242.
4044. gbpln2243.seq - Plant sequence entries (including fungi and algae), part 2243.
4045. gbpln2244.seq - Plant sequence entries (including fungi and algae), part 2244.
4046. gbpln2245.seq - Plant sequence entries (including fungi and algae), part 2245.
4047. gbpln2246.seq - Plant sequence entries (including fungi and algae), part 2246.
4048. gbpln2247.seq - Plant sequence entries (including fungi and algae), part 2247.
4049. gbpln2248.seq - Plant sequence entries (including fungi and algae), part 2248.
4050. gbpln2249.seq - Plant sequence entries (including fungi and algae), part 2249.
4051. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
4052. gbpln2250.seq - Plant sequence entries (including fungi and algae), part 2250.
4053. gbpln2251.seq - Plant sequence entries (including fungi and algae), part 2251.
4054. gbpln2252.seq - Plant sequence entries (including fungi and algae), part 2252.
4055. gbpln2253.seq - Plant sequence entries (including fungi and algae), part 2253.
4056. gbpln2254.seq - Plant sequence entries (including fungi and algae), part 2254.
4057. gbpln2255.seq - Plant sequence entries (including fungi and algae), part 2255.
4058. gbpln2256.seq - Plant sequence entries (including fungi and algae), part 2256.
4059. gbpln2257.seq - Plant sequence entries (including fungi and algae), part 2257.
4060. gbpln2258.seq - Plant sequence entries (including fungi and algae), part 2258.
4061. gbpln2259.seq - Plant sequence entries (including fungi and algae), part 2259.
4062. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
4063. gbpln2260.seq - Plant sequence entries (including fungi and algae), part 2260.
4064. gbpln2261.seq - Plant sequence entries (including fungi and algae), part 2261.
4065. gbpln2262.seq - Plant sequence entries (including fungi and algae), part 2262.
4066. gbpln2263.seq - Plant sequence entries (including fungi and algae), part 2263.
4067. gbpln2264.seq - Plant sequence entries (including fungi and algae), part 2264.
4068. gbpln2265.seq - Plant sequence entries (including fungi and algae), part 2265.
4069. gbpln2266.seq - Plant sequence entries (including fungi and algae), part 2266.
4070. gbpln2267.seq - Plant sequence entries (including fungi and algae), part 2267.
4071. gbpln2268.seq - Plant sequence entries (including fungi and algae), part 2268.
4072. gbpln2269.seq - Plant sequence entries (including fungi and algae), part 2269.
4073. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
4074. gbpln2270.seq - Plant sequence entries (including fungi and algae), part 2270.
4075. gbpln2271.seq - Plant sequence entries (including fungi and algae), part 2271.
4076. gbpln2272.seq - Plant sequence entries (including fungi and algae), part 2272.
4077. gbpln2273.seq - Plant sequence entries (including fungi and algae), part 2273.
4078. gbpln2274.seq - Plant sequence entries (including fungi and algae), part 2274.
4079. gbpln2275.seq - Plant sequence entries (including fungi and algae), part 2275.
4080. gbpln2276.seq - Plant sequence entries (including fungi and algae), part 2276.
4081. gbpln2277.seq - Plant sequence entries (including fungi and algae), part 2277.
4082. gbpln2278.seq - Plant sequence entries (including fungi and algae), part 2278.
4083. gbpln2279.seq - Plant sequence entries (including fungi and algae), part 2279.
4084. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
4085. gbpln2280.seq - Plant sequence entries (including fungi and algae), part 2280.
4086. gbpln2281.seq - Plant sequence entries (including fungi and algae), part 2281.
4087. gbpln2282.seq - Plant sequence entries (including fungi and algae), part 2282.
4088. gbpln2283.seq - Plant sequence entries (including fungi and algae), part 2283.
4089. gbpln2284.seq - Plant sequence entries (including fungi and algae), part 2284.
4090. gbpln2285.seq - Plant sequence entries (including fungi and algae), part 2285.
4091. gbpln2286.seq - Plant sequence entries (including fungi and algae), part 2286.
4092. gbpln2287.seq - Plant sequence entries (including fungi and algae), part 2287.
4093. gbpln2288.seq - Plant sequence entries (including fungi and algae), part 2288.
4094. gbpln2289.seq - Plant sequence entries (including fungi and algae), part 2289.
4095. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
4096. gbpln2290.seq - Plant sequence entries (including fungi and algae), part 2290.
4097. gbpln2291.seq - Plant sequence entries (including fungi and algae), part 2291.
4098. gbpln2292.seq - Plant sequence entries (including fungi and algae), part 2292.
4099. gbpln2293.seq - Plant sequence entries (including fungi and algae), part 2293.
4100. gbpln2294.seq - Plant sequence entries (including fungi and algae), part 2294.
4101. gbpln2295.seq - Plant sequence entries (including fungi and algae), part 2295.
4102. gbpln2296.seq - Plant sequence entries (including fungi and algae), part 2296.
4103. gbpln2297.seq - Plant sequence entries (including fungi and algae), part 2297.
4104. gbpln2298.seq - Plant sequence entries (including fungi and algae), part 2298.
4105. gbpln2299.seq - Plant sequence entries (including fungi and algae), part 2299.
4106. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
4107. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
4108. gbpln2300.seq - Plant sequence entries (including fungi and algae), part 2300.
4109. gbpln2301.seq - Plant sequence entries (including fungi and algae), part 2301.
4110. gbpln2302.seq - Plant sequence entries (including fungi and algae), part 2302.
4111. gbpln2303.seq - Plant sequence entries (including fungi and algae), part 2303.
4112. gbpln2304.seq - Plant sequence entries (including fungi and algae), part 2304.
4113. gbpln2305.seq - Plant sequence entries (including fungi and algae), part 2305.
4114. gbpln2306.seq - Plant sequence entries (including fungi and algae), part 2306.
4115. gbpln2307.seq - Plant sequence entries (including fungi and algae), part 2307.
4116. gbpln2308.seq - Plant sequence entries (including fungi and algae), part 2308.
4117. gbpln2309.seq - Plant sequence entries (including fungi and algae), part 2309.
4118. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
4119. gbpln2310.seq - Plant sequence entries (including fungi and algae), part 2310.
4120. gbpln2311.seq - Plant sequence entries (including fungi and algae), part 2311.
4121. gbpln2312.seq - Plant sequence entries (including fungi and algae), part 2312.
4122. gbpln2313.seq - Plant sequence entries (including fungi and algae), part 2313.
4123. gbpln2314.seq - Plant sequence entries (including fungi and algae), part 2314.
4124. gbpln2315.seq - Plant sequence entries (including fungi and algae), part 2315.
4125. gbpln2316.seq - Plant sequence entries (including fungi and algae), part 2316.
4126. gbpln2317.seq - Plant sequence entries (including fungi and algae), part 2317.
4127. gbpln2318.seq - Plant sequence entries (including fungi and algae), part 2318.
4128. gbpln2319.seq - Plant sequence entries (including fungi and algae), part 2319.
4129. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
4130. gbpln2320.seq - Plant sequence entries (including fungi and algae), part 2320.
4131. gbpln2321.seq - Plant sequence entries (including fungi and algae), part 2321.
4132. gbpln2322.seq - Plant sequence entries (including fungi and algae), part 2322.
4133. gbpln2323.seq - Plant sequence entries (including fungi and algae), part 2323.
4134. gbpln2324.seq - Plant sequence entries (including fungi and algae), part 2324.
4135. gbpln2325.seq - Plant sequence entries (including fungi and algae), part 2325.
4136. gbpln2326.seq - Plant sequence entries (including fungi and algae), part 2326.
4137. gbpln2327.seq - Plant sequence entries (including fungi and algae), part 2327.
4138. gbpln2328.seq - Plant sequence entries (including fungi and algae), part 2328.
4139. gbpln2329.seq - Plant sequence entries (including fungi and algae), part 2329.
4140. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
4141. gbpln2330.seq - Plant sequence entries (including fungi and algae), part 2330.
4142. gbpln2331.seq - Plant sequence entries (including fungi and algae), part 2331.
4143. gbpln2332.seq - Plant sequence entries (including fungi and algae), part 2332.
4144. gbpln2333.seq - Plant sequence entries (including fungi and algae), part 2333.
4145. gbpln2334.seq - Plant sequence entries (including fungi and algae), part 2334.
4146. gbpln2335.seq - Plant sequence entries (including fungi and algae), part 2335.
4147. gbpln2336.seq - Plant sequence entries (including fungi and algae), part 2336.
4148. gbpln2337.seq - Plant sequence entries (including fungi and algae), part 2337.
4149. gbpln2338.seq - Plant sequence entries (including fungi and algae), part 2338.
4150. gbpln2339.seq - Plant sequence entries (including fungi and algae), part 2339.
4151. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
4152. gbpln2340.seq - Plant sequence entries (including fungi and algae), part 2340.
4153. gbpln2341.seq - Plant sequence entries (including fungi and algae), part 2341.
4154. gbpln2342.seq - Plant sequence entries (including fungi and algae), part 2342.
4155. gbpln2343.seq - Plant sequence entries (including fungi and algae), part 2343.
4156. gbpln2344.seq - Plant sequence entries (including fungi and algae), part 2344.
4157. gbpln2345.seq - Plant sequence entries (including fungi and algae), part 2345.
4158. gbpln2346.seq - Plant sequence entries (including fungi and algae), part 2346.
4159. gbpln2347.seq - Plant sequence entries (including fungi and algae), part 2347.
4160. gbpln2348.seq - Plant sequence entries (including fungi and algae), part 2348.
4161. gbpln2349.seq - Plant sequence entries (including fungi and algae), part 2349.
4162. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
4163. gbpln2350.seq - Plant sequence entries (including fungi and algae), part 2350.
4164. gbpln2351.seq - Plant sequence entries (including fungi and algae), part 2351.
4165. gbpln2352.seq - Plant sequence entries (including fungi and algae), part 2352.
4166. gbpln2353.seq - Plant sequence entries (including fungi and algae), part 2353.
4167. gbpln2354.seq - Plant sequence entries (including fungi and algae), part 2354.
4168. gbpln2355.seq - Plant sequence entries (including fungi and algae), part 2355.
4169. gbpln2356.seq - Plant sequence entries (including fungi and algae), part 2356.
4170. gbpln2357.seq - Plant sequence entries (including fungi and algae), part 2357.
4171. gbpln2358.seq - Plant sequence entries (including fungi and algae), part 2358.
4172. gbpln2359.seq - Plant sequence entries (including fungi and algae), part 2359.
4173. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
4174. gbpln2360.seq - Plant sequence entries (including fungi and algae), part 2360.
4175. gbpln2361.seq - Plant sequence entries (including fungi and algae), part 2361.
4176. gbpln2362.seq - Plant sequence entries (including fungi and algae), part 2362.
4177. gbpln2363.seq - Plant sequence entries (including fungi and algae), part 2363.
4178. gbpln2364.seq - Plant sequence entries (including fungi and algae), part 2364.
4179. gbpln2365.seq - Plant sequence entries (including fungi and algae), part 2365.
4180. gbpln2366.seq - Plant sequence entries (including fungi and algae), part 2366.
4181. gbpln2367.seq - Plant sequence entries (including fungi and algae), part 2367.
4182. gbpln2368.seq - Plant sequence entries (including fungi and algae), part 2368.
4183. gbpln2369.seq - Plant sequence entries (including fungi and algae), part 2369.
4184. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
4185. gbpln2370.seq - Plant sequence entries (including fungi and algae), part 2370.
4186. gbpln2371.seq - Plant sequence entries (including fungi and algae), part 2371.
4187. gbpln2372.seq - Plant sequence entries (including fungi and algae), part 2372.
4188. gbpln2373.seq - Plant sequence entries (including fungi and algae), part 2373.
4189. gbpln2374.seq - Plant sequence entries (including fungi and algae), part 2374.
4190. gbpln2375.seq - Plant sequence entries (including fungi and algae), part 2375.
4191. gbpln2376.seq - Plant sequence entries (including fungi and algae), part 2376.
4192. gbpln2377.seq - Plant sequence entries (including fungi and algae), part 2377.
4193. gbpln2378.seq - Plant sequence entries (including fungi and algae), part 2378.
4194. gbpln2379.seq - Plant sequence entries (including fungi and algae), part 2379.
4195. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
4196. gbpln2380.seq - Plant sequence entries (including fungi and algae), part 2380.
4197. gbpln2381.seq - Plant sequence entries (including fungi and algae), part 2381.
4198. gbpln2382.seq - Plant sequence entries (including fungi and algae), part 2382.
4199. gbpln2383.seq - Plant sequence entries (including fungi and algae), part 2383.
4200. gbpln2384.seq - Plant sequence entries (including fungi and algae), part 2384.
4201. gbpln2385.seq - Plant sequence entries (including fungi and algae), part 2385.
4202. gbpln2386.seq - Plant sequence entries (including fungi and algae), part 2386.
4203. gbpln2387.seq - Plant sequence entries (including fungi and algae), part 2387.
4204. gbpln2388.seq - Plant sequence entries (including fungi and algae), part 2388.
4205. gbpln2389.seq - Plant sequence entries (including fungi and algae), part 2389.
4206. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
4207. gbpln2390.seq - Plant sequence entries (including fungi and algae), part 2390.
4208. gbpln2391.seq - Plant sequence entries (including fungi and algae), part 2391.
4209. gbpln2392.seq - Plant sequence entries (including fungi and algae), part 2392.
4210. gbpln2393.seq - Plant sequence entries (including fungi and algae), part 2393.
4211. gbpln2394.seq - Plant sequence entries (including fungi and algae), part 2394.
4212. gbpln2395.seq - Plant sequence entries (including fungi and algae), part 2395.
4213. gbpln2396.seq - Plant sequence entries (including fungi and algae), part 2396.
4214. gbpln2397.seq - Plant sequence entries (including fungi and algae), part 2397.
4215. gbpln2398.seq - Plant sequence entries (including fungi and algae), part 2398.
4216. gbpln2399.seq - Plant sequence entries (including fungi and algae), part 2399.
4217. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
4218. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
4219. gbpln2400.seq - Plant sequence entries (including fungi and algae), part 2400.
4220. gbpln2401.seq - Plant sequence entries (including fungi and algae), part 2401.
4221. gbpln2402.seq - Plant sequence entries (including fungi and algae), part 2402.
4222. gbpln2403.seq - Plant sequence entries (including fungi and algae), part 2403.
4223. gbpln2404.seq - Plant sequence entries (including fungi and algae), part 2404.
4224. gbpln2405.seq - Plant sequence entries (including fungi and algae), part 2405.
4225. gbpln2406.seq - Plant sequence entries (including fungi and algae), part 2406.
4226. gbpln2407.seq - Plant sequence entries (including fungi and algae), part 2407.
4227. gbpln2408.seq - Plant sequence entries (including fungi and algae), part 2408.
4228. gbpln2409.seq - Plant sequence entries (including fungi and algae), part 2409.
4229. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
4230. gbpln2410.seq - Plant sequence entries (including fungi and algae), part 2410.
4231. gbpln2411.seq - Plant sequence entries (including fungi and algae), part 2411.
4232. gbpln2412.seq - Plant sequence entries (including fungi and algae), part 2412.
4233. gbpln2413.seq - Plant sequence entries (including fungi and algae), part 2413.
4234. gbpln2414.seq - Plant sequence entries (including fungi and algae), part 2414.
4235. gbpln2415.seq - Plant sequence entries (including fungi and algae), part 2415.
4236. gbpln2416.seq - Plant sequence entries (including fungi and algae), part 2416.
4237. gbpln2417.seq - Plant sequence entries (including fungi and algae), part 2417.
4238. gbpln2418.seq - Plant sequence entries (including fungi and algae), part 2418.
4239. gbpln2419.seq - Plant sequence entries (including fungi and algae), part 2419.
4240. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
4241. gbpln2420.seq - Plant sequence entries (including fungi and algae), part 2420.
4242. gbpln2421.seq - Plant sequence entries (including fungi and algae), part 2421.
4243. gbpln2422.seq - Plant sequence entries (including fungi and algae), part 2422.
4244. gbpln2423.seq - Plant sequence entries (including fungi and algae), part 2423.
4245. gbpln2424.seq - Plant sequence entries (including fungi and algae), part 2424.
4246. gbpln2425.seq - Plant sequence entries (including fungi and algae), part 2425.
4247. gbpln2426.seq - Plant sequence entries (including fungi and algae), part 2426.
4248. gbpln2427.seq - Plant sequence entries (including fungi and algae), part 2427.
4249. gbpln2428.seq - Plant sequence entries (including fungi and algae), part 2428.
4250. gbpln2429.seq - Plant sequence entries (including fungi and algae), part 2429.
4251. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
4252. gbpln2430.seq - Plant sequence entries (including fungi and algae), part 2430.
4253. gbpln2431.seq - Plant sequence entries (including fungi and algae), part 2431.
4254. gbpln2432.seq - Plant sequence entries (including fungi and algae), part 2432.
4255. gbpln2433.seq - Plant sequence entries (including fungi and algae), part 2433.
4256. gbpln2434.seq - Plant sequence entries (including fungi and algae), part 2434.
4257. gbpln2435.seq - Plant sequence entries (including fungi and algae), part 2435.
4258. gbpln2436.seq - Plant sequence entries (including fungi and algae), part 2436.
4259. gbpln2437.seq - Plant sequence entries (including fungi and algae), part 2437.
4260. gbpln2438.seq - Plant sequence entries (including fungi and algae), part 2438.
4261. gbpln2439.seq - Plant sequence entries (including fungi and algae), part 2439.
4262. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
4263. gbpln2440.seq - Plant sequence entries (including fungi and algae), part 2440.
4264. gbpln2441.seq - Plant sequence entries (including fungi and algae), part 2441.
4265. gbpln2442.seq - Plant sequence entries (including fungi and algae), part 2442.
4266. gbpln2443.seq - Plant sequence entries (including fungi and algae), part 2443.
4267. gbpln2444.seq - Plant sequence entries (including fungi and algae), part 2444.
4268. gbpln2445.seq - Plant sequence entries (including fungi and algae), part 2445.
4269. gbpln2446.seq - Plant sequence entries (including fungi and algae), part 2446.
4270. gbpln2447.seq - Plant sequence entries (including fungi and algae), part 2447.
4271. gbpln2448.seq - Plant sequence entries (including fungi and algae), part 2448.
4272. gbpln2449.seq - Plant sequence entries (including fungi and algae), part 2449.
4273. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
4274. gbpln2450.seq - Plant sequence entries (including fungi and algae), part 2450.
4275. gbpln2451.seq - Plant sequence entries (including fungi and algae), part 2451.
4276. gbpln2452.seq - Plant sequence entries (including fungi and algae), part 2452.
4277. gbpln2453.seq - Plant sequence entries (including fungi and algae), part 2453.
4278. gbpln2454.seq - Plant sequence entries (including fungi and algae), part 2454.
4279. gbpln2455.seq - Plant sequence entries (including fungi and algae), part 2455.
4280. gbpln2456.seq - Plant sequence entries (including fungi and algae), part 2456.
4281. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
4282. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
4283. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
4284. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
4285. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
4286. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
4287. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
4288. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
4289. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
4290. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
4291. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
4292. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
4293. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
4294. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
4295. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
4296. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
4297. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
4298. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
4299. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
4300. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
4301. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
4302. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
4303. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
4304. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
4305. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
4306. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
4307. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
4308. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
4309. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
4310. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
4311. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
4312. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
4313. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
4314. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
4315. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
4316. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
4317. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
4318. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
4319. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
4320. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
4321. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
4322. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
4323. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
4324. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
4325. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
4326. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
4327. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
4328. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
4329. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
4330. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
4331. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
4332. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
4333. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
4334. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
4335. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
4336. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
4337. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
4338. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
4339. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
4340. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
4341. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
4342. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
4343. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
4344. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
4345. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
4346. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
4347. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
4348. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
4349. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
4350. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
4351. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
4352. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
4353. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
4354. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
4355. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
4356. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
4357. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
4358. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
4359. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
4360. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
4361. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
4362. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
4363. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
4364. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
4365. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
4366. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
4367. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
4368. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
4369. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
4370. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
4371. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
4372. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
4373. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
4374. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
4375. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
4376. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
4377. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
4378. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
4379. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
4380. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
4381. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
4382. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
4383. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
4384. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
4385. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
4386. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
4387. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
4388. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
4389. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
4390. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
4391. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
4392. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
4393. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
4394. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
4395. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
4396. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
4397. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
4398. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
4399. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
4400. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
4401. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
4402. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
4403. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
4404. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
4405. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
4406. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
4407. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
4408. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
4409. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
4410. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
4411. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
4412. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
4413. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
4414. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
4415. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
4416. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
4417. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
4418. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
4419. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
4420. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
4421. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
4422. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
4423. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
4424. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
4425. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
4426. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
4427. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
4428. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
4429. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
4430. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
4431. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
4432. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
4433. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
4434. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
4435. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
4436. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
4437. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
4438. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
4439. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
4440. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
4441. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
4442. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
4443. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
4444. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
4445. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
4446. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
4447. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
4448. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
4449. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
4450. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
4451. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
4452. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
4453. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
4454. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
4455. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
4456. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
4457. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
4458. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
4459. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
4460. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
4461. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
4462. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
4463. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
4464. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
4465. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
4466. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
4467. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
4468. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
4469. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
4470. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
4471. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
4472. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
4473. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
4474. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
4475. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
4476. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
4477. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
4478. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
4479. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
4480. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
4481. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
4482. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
4483. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
4484. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
4485. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
4486. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
4487. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
4488. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
4489. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
4490. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
4491. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
4492. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
4493. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
4494. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
4495. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
4496. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
4497. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
4498. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
4499. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
4500. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
4501. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
4502. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
4503. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
4504. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
4505. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
4506. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
4507. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
4508. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
4509. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
4510. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
4511. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
4512. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
4513. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
4514. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
4515. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
4516. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
4517. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
4518. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
4519. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
4520. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
4521. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
4522. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
4523. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
4524. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
4525. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
4526. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
4527. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
4528. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
4529. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
4530. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
4531. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
4532. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
4533. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
4534. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
4535. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
4536. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
4537. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
4538. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
4539. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
4540. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
4541. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
4542. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
4543. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
4544. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
4545. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
4546. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
4547. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
4548. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
4549. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
4550. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
4551. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
4552. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
4553. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
4554. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
4555. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
4556. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
4557. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
4558. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
4559. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
4560. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
4561. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
4562. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
4563. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
4564. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
4565. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
4566. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
4567. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
4568. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
4569. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
4570. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
4571. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
4572. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
4573. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
4574. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
4575. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
4576. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
4577. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
4578. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
4579. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
4580. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
4581. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
4582. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
4583. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
4584. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
4585. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
4586. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
4587. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
4588. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
4589. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
4590. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
4591. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
4592. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
4593. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
4594. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
4595. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
4596. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
4597. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
4598. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
4599. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
4600. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
4601. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
4602. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
4603. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
4604. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
4605. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
4606. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
4607. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
4608. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
4609. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
4610. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
4611. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
4612. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
4613. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
4614. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
4615. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
4616. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
4617. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
4618. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
4619. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
4620. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
4621. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
4622. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
4623. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
4624. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
4625. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
4626. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
4627. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
4628. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
4629. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
4630. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
4631. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
4632. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
4633. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
4634. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
4635. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
4636. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
4637. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
4638. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
4639. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
4640. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
4641. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
4642. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
4643. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
4644. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
4645. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
4646. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
4647. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
4648. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
4649. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
4650. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
4651. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
4652. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
4653. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
4654. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
4655. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
4656. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
4657. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
4658. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
4659. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
4660. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
4661. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
4662. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
4663. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
4664. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
4665. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
4666. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
4667. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
4668. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
4669. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
4670. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
4671. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
4672. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
4673. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
4674. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
4675. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
4676. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
4677. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
4678. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
4679. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
4680. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
4681. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
4682. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
4683. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
4684. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
4685. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
4686. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
4687. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
4688. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
4689. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
4690. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
4691. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
4692. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
4693. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
4694. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
4695. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
4696. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
4697. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
4698. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
4699. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
4700. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
4701. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
4702. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
4703. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
4704. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
4705. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
4706. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
4707. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
4708. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
4709. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
4710. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
4711. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
4712. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
4713. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
4714. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
4715. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
4716. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
4717. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
4718. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
4719. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
4720. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
4721. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
4722. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
4723. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
4724. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
4725. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
4726. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
4727. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
4728. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
4729. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
4730. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
4731. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
4732. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
4733. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
4734. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
4735. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
4736. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
4737. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
4738. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
4739. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
4740. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
4741. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
4742. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
4743. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
4744. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
4745. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
4746. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665.
4747. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666.
4748. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667.
4749. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668.
4750. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669.
4751. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
4752. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670.
4753. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671.
4754. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672.
4755. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673.
4756. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674.
4757. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675.
4758. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676.
4759. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677.
4760. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678.
4761. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679.
4762. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
4763. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680.
4764. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681.
4765. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682.
4766. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683.
4767. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684.
4768. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685.
4769. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686.
4770. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687.
4771. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688.
4772. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689.
4773. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
4774. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690.
4775. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691.
4776. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692.
4777. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693.
4778. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694.
4779. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695.
4780. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696.
4781. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697.
4782. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698.
4783. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699.
4784. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
4785. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
4786. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700.
4787. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701.
4788. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702.
4789. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703.
4790. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704.
4791. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705.
4792. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706.
4793. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707.
4794. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708.
4795. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709.
4796. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
4797. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710.
4798. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711.
4799. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712.
4800. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713.
4801. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714.
4802. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715.
4803. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716.
4804. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717.
4805. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718.
4806. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719.
4807. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
4808. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720.
4809. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721.
4810. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722.
4811. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723.
4812. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724.
4813. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725.
4814. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726.
4815. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727.
4816. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728.
4817. gbpln729.seq - Plant sequence entries (including fungi and algae), part 729.
4818. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
4819. gbpln730.seq - Plant sequence entries (including fungi and algae), part 730.
4820. gbpln731.seq - Plant sequence entries (including fungi and algae), part 731.
4821. gbpln732.seq - Plant sequence entries (including fungi and algae), part 732.
4822. gbpln733.seq - Plant sequence entries (including fungi and algae), part 733.
4823. gbpln734.seq - Plant sequence entries (including fungi and algae), part 734.
4824. gbpln735.seq - Plant sequence entries (including fungi and algae), part 735.
4825. gbpln736.seq - Plant sequence entries (including fungi and algae), part 736.
4826. gbpln737.seq - Plant sequence entries (including fungi and algae), part 737.
4827. gbpln738.seq - Plant sequence entries (including fungi and algae), part 738.
4828. gbpln739.seq - Plant sequence entries (including fungi and algae), part 739.
4829. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
4830. gbpln740.seq - Plant sequence entries (including fungi and algae), part 740.
4831. gbpln741.seq - Plant sequence entries (including fungi and algae), part 741.
4832. gbpln742.seq - Plant sequence entries (including fungi and algae), part 742.
4833. gbpln743.seq - Plant sequence entries (including fungi and algae), part 743.
4834. gbpln744.seq - Plant sequence entries (including fungi and algae), part 744.
4835. gbpln745.seq - Plant sequence entries (including fungi and algae), part 745.
4836. gbpln746.seq - Plant sequence entries (including fungi and algae), part 746.
4837. gbpln747.seq - Plant sequence entries (including fungi and algae), part 747.
4838. gbpln748.seq - Plant sequence entries (including fungi and algae), part 748.
4839. gbpln749.seq - Plant sequence entries (including fungi and algae), part 749.
4840. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
4841. gbpln750.seq - Plant sequence entries (including fungi and algae), part 750.
4842. gbpln751.seq - Plant sequence entries (including fungi and algae), part 751.
4843. gbpln752.seq - Plant sequence entries (including fungi and algae), part 752.
4844. gbpln753.seq - Plant sequence entries (including fungi and algae), part 753.
4845. gbpln754.seq - Plant sequence entries (including fungi and algae), part 754.
4846. gbpln755.seq - Plant sequence entries (including fungi and algae), part 755.
4847. gbpln756.seq - Plant sequence entries (including fungi and algae), part 756.
4848. gbpln757.seq - Plant sequence entries (including fungi and algae), part 757.
4849. gbpln758.seq - Plant sequence entries (including fungi and algae), part 758.
4850. gbpln759.seq - Plant sequence entries (including fungi and algae), part 759.
4851. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
4852. gbpln760.seq - Plant sequence entries (including fungi and algae), part 760.
4853. gbpln761.seq - Plant sequence entries (including fungi and algae), part 761.
4854. gbpln762.seq - Plant sequence entries (including fungi and algae), part 762.
4855. gbpln763.seq - Plant sequence entries (including fungi and algae), part 763.
4856. gbpln764.seq - Plant sequence entries (including fungi and algae), part 764.
4857. gbpln765.seq - Plant sequence entries (including fungi and algae), part 765.
4858. gbpln766.seq - Plant sequence entries (including fungi and algae), part 766.
4859. gbpln767.seq - Plant sequence entries (including fungi and algae), part 767.
4860. gbpln768.seq - Plant sequence entries (including fungi and algae), part 768.
4861. gbpln769.seq - Plant sequence entries (including fungi and algae), part 769.
4862. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
4863. gbpln770.seq - Plant sequence entries (including fungi and algae), part 770.
4864. gbpln771.seq - Plant sequence entries (including fungi and algae), part 771.
4865. gbpln772.seq - Plant sequence entries (including fungi and algae), part 772.
4866. gbpln773.seq - Plant sequence entries (including fungi and algae), part 773.
4867. gbpln774.seq - Plant sequence entries (including fungi and algae), part 774.
4868. gbpln775.seq - Plant sequence entries (including fungi and algae), part 775.
4869. gbpln776.seq - Plant sequence entries (including fungi and algae), part 776.
4870. gbpln777.seq - Plant sequence entries (including fungi and algae), part 777.
4871. gbpln778.seq - Plant sequence entries (including fungi and algae), part 778.
4872. gbpln779.seq - Plant sequence entries (including fungi and algae), part 779.
4873. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
4874. gbpln780.seq - Plant sequence entries (including fungi and algae), part 780.
4875. gbpln781.seq - Plant sequence entries (including fungi and algae), part 781.
4876. gbpln782.seq - Plant sequence entries (including fungi and algae), part 782.
4877. gbpln783.seq - Plant sequence entries (including fungi and algae), part 783.
4878. gbpln784.seq - Plant sequence entries (including fungi and algae), part 784.
4879. gbpln785.seq - Plant sequence entries (including fungi and algae), part 785.
4880. gbpln786.seq - Plant sequence entries (including fungi and algae), part 786.
4881. gbpln787.seq - Plant sequence entries (including fungi and algae), part 787.
4882. gbpln788.seq - Plant sequence entries (including fungi and algae), part 788.
4883. gbpln789.seq - Plant sequence entries (including fungi and algae), part 789.
4884. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
4885. gbpln790.seq - Plant sequence entries (including fungi and algae), part 790.
4886. gbpln791.seq - Plant sequence entries (including fungi and algae), part 791.
4887. gbpln792.seq - Plant sequence entries (including fungi and algae), part 792.
4888. gbpln793.seq - Plant sequence entries (including fungi and algae), part 793.
4889. gbpln794.seq - Plant sequence entries (including fungi and algae), part 794.
4890. gbpln795.seq - Plant sequence entries (including fungi and algae), part 795.
4891. gbpln796.seq - Plant sequence entries (including fungi and algae), part 796.
4892. gbpln797.seq - Plant sequence entries (including fungi and algae), part 797.
4893. gbpln798.seq - Plant sequence entries (including fungi and algae), part 798.
4894. gbpln799.seq - Plant sequence entries (including fungi and algae), part 799.
4895. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
4896. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
4897. gbpln800.seq - Plant sequence entries (including fungi and algae), part 800.
4898. gbpln801.seq - Plant sequence entries (including fungi and algae), part 801.
4899. gbpln802.seq - Plant sequence entries (including fungi and algae), part 802.
4900. gbpln803.seq - Plant sequence entries (including fungi and algae), part 803.
4901. gbpln804.seq - Plant sequence entries (including fungi and algae), part 804.
4902. gbpln805.seq - Plant sequence entries (including fungi and algae), part 805.
4903. gbpln806.seq - Plant sequence entries (including fungi and algae), part 806.
4904. gbpln807.seq - Plant sequence entries (including fungi and algae), part 807.
4905. gbpln808.seq - Plant sequence entries (including fungi and algae), part 808.
4906. gbpln809.seq - Plant sequence entries (including fungi and algae), part 809.
4907. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
4908. gbpln810.seq - Plant sequence entries (including fungi and algae), part 810.
4909. gbpln811.seq - Plant sequence entries (including fungi and algae), part 811.
4910. gbpln812.seq - Plant sequence entries (including fungi and algae), part 812.
4911. gbpln813.seq - Plant sequence entries (including fungi and algae), part 813.
4912. gbpln814.seq - Plant sequence entries (including fungi and algae), part 814.
4913. gbpln815.seq - Plant sequence entries (including fungi and algae), part 815.
4914. gbpln816.seq - Plant sequence entries (including fungi and algae), part 816.
4915. gbpln817.seq - Plant sequence entries (including fungi and algae), part 817.
4916. gbpln818.seq - Plant sequence entries (including fungi and algae), part 818.
4917. gbpln819.seq - Plant sequence entries (including fungi and algae), part 819.
4918. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
4919. gbpln820.seq - Plant sequence entries (including fungi and algae), part 820.
4920. gbpln821.seq - Plant sequence entries (including fungi and algae), part 821.
4921. gbpln822.seq - Plant sequence entries (including fungi and algae), part 822.
4922. gbpln823.seq - Plant sequence entries (including fungi and algae), part 823.
4923. gbpln824.seq - Plant sequence entries (including fungi and algae), part 824.
4924. gbpln825.seq - Plant sequence entries (including fungi and algae), part 825.
4925. gbpln826.seq - Plant sequence entries (including fungi and algae), part 826.
4926. gbpln827.seq - Plant sequence entries (including fungi and algae), part 827.
4927. gbpln828.seq - Plant sequence entries (including fungi and algae), part 828.
4928. gbpln829.seq - Plant sequence entries (including fungi and algae), part 829.
4929. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
4930. gbpln830.seq - Plant sequence entries (including fungi and algae), part 830.
4931. gbpln831.seq - Plant sequence entries (including fungi and algae), part 831.
4932. gbpln832.seq - Plant sequence entries (including fungi and algae), part 832.
4933. gbpln833.seq - Plant sequence entries (including fungi and algae), part 833.
4934. gbpln834.seq - Plant sequence entries (including fungi and algae), part 834.
4935. gbpln835.seq - Plant sequence entries (including fungi and algae), part 835.
4936. gbpln836.seq - Plant sequence entries (including fungi and algae), part 836.
4937. gbpln837.seq - Plant sequence entries (including fungi and algae), part 837.
4938. gbpln838.seq - Plant sequence entries (including fungi and algae), part 838.
4939. gbpln839.seq - Plant sequence entries (including fungi and algae), part 839.
4940. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
4941. gbpln840.seq - Plant sequence entries (including fungi and algae), part 840.
4942. gbpln841.seq - Plant sequence entries (including fungi and algae), part 841.
4943. gbpln842.seq - Plant sequence entries (including fungi and algae), part 842.
4944. gbpln843.seq - Plant sequence entries (including fungi and algae), part 843.
4945. gbpln844.seq - Plant sequence entries (including fungi and algae), part 844.
4946. gbpln845.seq - Plant sequence entries (including fungi and algae), part 845.
4947. gbpln846.seq - Plant sequence entries (including fungi and algae), part 846.
4948. gbpln847.seq - Plant sequence entries (including fungi and algae), part 847.
4949. gbpln848.seq - Plant sequence entries (including fungi and algae), part 848.
4950. gbpln849.seq - Plant sequence entries (including fungi and algae), part 849.
4951. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
4952. gbpln850.seq - Plant sequence entries (including fungi and algae), part 850.
4953. gbpln851.seq - Plant sequence entries (including fungi and algae), part 851.
4954. gbpln852.seq - Plant sequence entries (including fungi and algae), part 852.
4955. gbpln853.seq - Plant sequence entries (including fungi and algae), part 853.
4956. gbpln854.seq - Plant sequence entries (including fungi and algae), part 854.
4957. gbpln855.seq - Plant sequence entries (including fungi and algae), part 855.
4958. gbpln856.seq - Plant sequence entries (including fungi and algae), part 856.
4959. gbpln857.seq - Plant sequence entries (including fungi and algae), part 857.
4960. gbpln858.seq - Plant sequence entries (including fungi and algae), part 858.
4961. gbpln859.seq - Plant sequence entries (including fungi and algae), part 859.
4962. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
4963. gbpln860.seq - Plant sequence entries (including fungi and algae), part 860.
4964. gbpln861.seq - Plant sequence entries (including fungi and algae), part 861.
4965. gbpln862.seq - Plant sequence entries (including fungi and algae), part 862.
4966. gbpln863.seq - Plant sequence entries (including fungi and algae), part 863.
4967. gbpln864.seq - Plant sequence entries (including fungi and algae), part 864.
4968. gbpln865.seq - Plant sequence entries (including fungi and algae), part 865.
4969. gbpln866.seq - Plant sequence entries (including fungi and algae), part 866.
4970. gbpln867.seq - Plant sequence entries (including fungi and algae), part 867.
4971. gbpln868.seq - Plant sequence entries (including fungi and algae), part 868.
4972. gbpln869.seq - Plant sequence entries (including fungi and algae), part 869.
4973. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
4974. gbpln870.seq - Plant sequence entries (including fungi and algae), part 870.
4975. gbpln871.seq - Plant sequence entries (including fungi and algae), part 871.
4976. gbpln872.seq - Plant sequence entries (including fungi and algae), part 872.
4977. gbpln873.seq - Plant sequence entries (including fungi and algae), part 873.
4978. gbpln874.seq - Plant sequence entries (including fungi and algae), part 874.
4979. gbpln875.seq - Plant sequence entries (including fungi and algae), part 875.
4980. gbpln876.seq - Plant sequence entries (including fungi and algae), part 876.
4981. gbpln877.seq - Plant sequence entries (including fungi and algae), part 877.
4982. gbpln878.seq - Plant sequence entries (including fungi and algae), part 878.
4983. gbpln879.seq - Plant sequence entries (including fungi and algae), part 879.
4984. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
4985. gbpln880.seq - Plant sequence entries (including fungi and algae), part 880.
4986. gbpln881.seq - Plant sequence entries (including fungi and algae), part 881.
4987. gbpln882.seq - Plant sequence entries (including fungi and algae), part 882.
4988. gbpln883.seq - Plant sequence entries (including fungi and algae), part 883.
4989. gbpln884.seq - Plant sequence entries (including fungi and algae), part 884.
4990. gbpln885.seq - Plant sequence entries (including fungi and algae), part 885.
4991. gbpln886.seq - Plant sequence entries (including fungi and algae), part 886.
4992. gbpln887.seq - Plant sequence entries (including fungi and algae), part 887.
4993. gbpln888.seq - Plant sequence entries (including fungi and algae), part 888.
4994. gbpln889.seq - Plant sequence entries (including fungi and algae), part 889.
4995. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
4996. gbpln890.seq - Plant sequence entries (including fungi and algae), part 890.
4997. gbpln891.seq - Plant sequence entries (including fungi and algae), part 891.
4998. gbpln892.seq - Plant sequence entries (including fungi and algae), part 892.
4999. gbpln893.seq - Plant sequence entries (including fungi and algae), part 893.
5000. gbpln894.seq - Plant sequence entries (including fungi and algae), part 894.
5001. gbpln895.seq - Plant sequence entries (including fungi and algae), part 895.
5002. gbpln896.seq - Plant sequence entries (including fungi and algae), part 896.
5003. gbpln897.seq - Plant sequence entries (including fungi and algae), part 897.
5004. gbpln898.seq - Plant sequence entries (including fungi and algae), part 898.
5005. gbpln899.seq - Plant sequence entries (including fungi and algae), part 899.
5006. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
5007. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
5008. gbpln900.seq - Plant sequence entries (including fungi and algae), part 900.
5009. gbpln901.seq - Plant sequence entries (including fungi and algae), part 901.
5010. gbpln902.seq - Plant sequence entries (including fungi and algae), part 902.
5011. gbpln903.seq - Plant sequence entries (including fungi and algae), part 903.
5012. gbpln904.seq - Plant sequence entries (including fungi and algae), part 904.
5013. gbpln905.seq - Plant sequence entries (including fungi and algae), part 905.
5014. gbpln906.seq - Plant sequence entries (including fungi and algae), part 906.
5015. gbpln907.seq - Plant sequence entries (including fungi and algae), part 907.
5016. gbpln908.seq - Plant sequence entries (including fungi and algae), part 908.
5017. gbpln909.seq - Plant sequence entries (including fungi and algae), part 909.
5018. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
5019. gbpln910.seq - Plant sequence entries (including fungi and algae), part 910.
5020. gbpln911.seq - Plant sequence entries (including fungi and algae), part 911.
5021. gbpln912.seq - Plant sequence entries (including fungi and algae), part 912.
5022. gbpln913.seq - Plant sequence entries (including fungi and algae), part 913.
5023. gbpln914.seq - Plant sequence entries (including fungi and algae), part 914.
5024. gbpln915.seq - Plant sequence entries (including fungi and algae), part 915.
5025. gbpln916.seq - Plant sequence entries (including fungi and algae), part 916.
5026. gbpln917.seq - Plant sequence entries (including fungi and algae), part 917.
5027. gbpln918.seq - Plant sequence entries (including fungi and algae), part 918.
5028. gbpln919.seq - Plant sequence entries (including fungi and algae), part 919.
5029. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
5030. gbpln920.seq - Plant sequence entries (including fungi and algae), part 920.
5031. gbpln921.seq - Plant sequence entries (including fungi and algae), part 921.
5032. gbpln922.seq - Plant sequence entries (including fungi and algae), part 922.
5033. gbpln923.seq - Plant sequence entries (including fungi and algae), part 923.
5034. gbpln924.seq - Plant sequence entries (including fungi and algae), part 924.
5035. gbpln925.seq - Plant sequence entries (including fungi and algae), part 925.
5036. gbpln926.seq - Plant sequence entries (including fungi and algae), part 926.
5037. gbpln927.seq - Plant sequence entries (including fungi and algae), part 927.
5038. gbpln928.seq - Plant sequence entries (including fungi and algae), part 928.
5039. gbpln929.seq - Plant sequence entries (including fungi and algae), part 929.
5040. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
5041. gbpln930.seq - Plant sequence entries (including fungi and algae), part 930.
5042. gbpln931.seq - Plant sequence entries (including fungi and algae), part 931.
5043. gbpln932.seq - Plant sequence entries (including fungi and algae), part 932.
5044. gbpln933.seq - Plant sequence entries (including fungi and algae), part 933.
5045. gbpln934.seq - Plant sequence entries (including fungi and algae), part 934.
5046. gbpln935.seq - Plant sequence entries (including fungi and algae), part 935.
5047. gbpln936.seq - Plant sequence entries (including fungi and algae), part 936.
5048. gbpln937.seq - Plant sequence entries (including fungi and algae), part 937.
5049. gbpln938.seq - Plant sequence entries (including fungi and algae), part 938.
5050. gbpln939.seq - Plant sequence entries (including fungi and algae), part 939.
5051. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
5052. gbpln940.seq - Plant sequence entries (including fungi and algae), part 940.
5053. gbpln941.seq - Plant sequence entries (including fungi and algae), part 941.
5054. gbpln942.seq - Plant sequence entries (including fungi and algae), part 942.
5055. gbpln943.seq - Plant sequence entries (including fungi and algae), part 943.
5056. gbpln944.seq - Plant sequence entries (including fungi and algae), part 944.
5057. gbpln945.seq - Plant sequence entries (including fungi and algae), part 945.
5058. gbpln946.seq - Plant sequence entries (including fungi and algae), part 946.
5059. gbpln947.seq - Plant sequence entries (including fungi and algae), part 947.
5060. gbpln948.seq - Plant sequence entries (including fungi and algae), part 948.
5061. gbpln949.seq - Plant sequence entries (including fungi and algae), part 949.
5062. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
5063. gbpln950.seq - Plant sequence entries (including fungi and algae), part 950.
5064. gbpln951.seq - Plant sequence entries (including fungi and algae), part 951.
5065. gbpln952.seq - Plant sequence entries (including fungi and algae), part 952.
5066. gbpln953.seq - Plant sequence entries (including fungi and algae), part 953.
5067. gbpln954.seq - Plant sequence entries (including fungi and algae), part 954.
5068. gbpln955.seq - Plant sequence entries (including fungi and algae), part 955.
5069. gbpln956.seq - Plant sequence entries (including fungi and algae), part 956.
5070. gbpln957.seq - Plant sequence entries (including fungi and algae), part 957.
5071. gbpln958.seq - Plant sequence entries (including fungi and algae), part 958.
5072. gbpln959.seq - Plant sequence entries (including fungi and algae), part 959.
5073. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
5074. gbpln960.seq - Plant sequence entries (including fungi and algae), part 960.
5075. gbpln961.seq - Plant sequence entries (including fungi and algae), part 961.
5076. gbpln962.seq - Plant sequence entries (including fungi and algae), part 962.
5077. gbpln963.seq - Plant sequence entries (including fungi and algae), part 963.
5078. gbpln964.seq - Plant sequence entries (including fungi and algae), part 964.
5079. gbpln965.seq - Plant sequence entries (including fungi and algae), part 965.
5080. gbpln966.seq - Plant sequence entries (including fungi and algae), part 966.
5081. gbpln967.seq - Plant sequence entries (including fungi and algae), part 967.
5082. gbpln968.seq - Plant sequence entries (including fungi and algae), part 968.
5083. gbpln969.seq - Plant sequence entries (including fungi and algae), part 969.
5084. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
5085. gbpln970.seq - Plant sequence entries (including fungi and algae), part 970.
5086. gbpln971.seq - Plant sequence entries (including fungi and algae), part 971.
5087. gbpln972.seq - Plant sequence entries (including fungi and algae), part 972.
5088. gbpln973.seq - Plant sequence entries (including fungi and algae), part 973.
5089. gbpln974.seq - Plant sequence entries (including fungi and algae), part 974.
5090. gbpln975.seq - Plant sequence entries (including fungi and algae), part 975.
5091. gbpln976.seq - Plant sequence entries (including fungi and algae), part 976.
5092. gbpln977.seq - Plant sequence entries (including fungi and algae), part 977.
5093. gbpln978.seq - Plant sequence entries (including fungi and algae), part 978.
5094. gbpln979.seq - Plant sequence entries (including fungi and algae), part 979.
5095. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
5096. gbpln980.seq - Plant sequence entries (including fungi and algae), part 980.
5097. gbpln981.seq - Plant sequence entries (including fungi and algae), part 981.
5098. gbpln982.seq - Plant sequence entries (including fungi and algae), part 982.
5099. gbpln983.seq - Plant sequence entries (including fungi and algae), part 983.
5100. gbpln984.seq - Plant sequence entries (including fungi and algae), part 984.
5101. gbpln985.seq - Plant sequence entries (including fungi and algae), part 985.
5102. gbpln986.seq - Plant sequence entries (including fungi and algae), part 986.
5103. gbpln987.seq - Plant sequence entries (including fungi and algae), part 987.
5104. gbpln988.seq - Plant sequence entries (including fungi and algae), part 988.
5105. gbpln989.seq - Plant sequence entries (including fungi and algae), part 989.
5106. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
5107. gbpln990.seq - Plant sequence entries (including fungi and algae), part 990.
5108. gbpln991.seq - Plant sequence entries (including fungi and algae), part 991.
5109. gbpln992.seq - Plant sequence entries (including fungi and algae), part 992.
5110. gbpln993.seq - Plant sequence entries (including fungi and algae), part 993.
5111. gbpln994.seq - Plant sequence entries (including fungi and algae), part 994.
5112. gbpln995.seq - Plant sequence entries (including fungi and algae), part 995.
5113. gbpln996.seq - Plant sequence entries (including fungi and algae), part 996.
5114. gbpln997.seq - Plant sequence entries (including fungi and algae), part 997.
5115. gbpln998.seq - Plant sequence entries (including fungi and algae), part 998.
5116. gbpln999.seq - Plant sequence entries (including fungi and algae), part 999.
5117. gbpri1.seq - Primate sequence entries, part 1.
5118. gbpri10.seq - Primate sequence entries, part 10.
5119. gbpri11.seq - Primate sequence entries, part 11.
5120. gbpri12.seq - Primate sequence entries, part 12.
5121. gbpri13.seq - Primate sequence entries, part 13.
5122. gbpri14.seq - Primate sequence entries, part 14.
5123. gbpri15.seq - Primate sequence entries, part 15.
5124. gbpri16.seq - Primate sequence entries, part 16.
5125. gbpri17.seq - Primate sequence entries, part 17.
5126. gbpri18.seq - Primate sequence entries, part 18.
5127. gbpri19.seq - Primate sequence entries, part 19.
5128. gbpri2.seq - Primate sequence entries, part 2.
5129. gbpri20.seq - Primate sequence entries, part 20.
5130. gbpri21.seq - Primate sequence entries, part 21.
5131. gbpri22.seq - Primate sequence entries, part 22.
5132. gbpri23.seq - Primate sequence entries, part 23.
5133. gbpri24.seq - Primate sequence entries, part 24.
5134. gbpri25.seq - Primate sequence entries, part 25.
5135. gbpri26.seq - Primate sequence entries, part 26.
5136. gbpri27.seq - Primate sequence entries, part 27.
5137. gbpri28.seq - Primate sequence entries, part 28.
5138. gbpri3.seq - Primate sequence entries, part 3.
5139. gbpri4.seq - Primate sequence entries, part 4.
5140. gbpri5.seq - Primate sequence entries, part 5.
5141. gbpri6.seq - Primate sequence entries, part 6.
5142. gbpri7.seq - Primate sequence entries, part 7.
5143. gbpri8.seq - Primate sequence entries, part 8.
5144. gbpri9.seq - Primate sequence entries, part 9.
5145. gbrel.txt - Release notes (this document).
5146. gbrod1.seq - Rodent sequence entries, part 1.
5147. gbrod10.seq - Rodent sequence entries, part 10.
5148. gbrod100.seq - Rodent sequence entries, part 100.
5149. gbrod101.seq - Rodent sequence entries, part 101.
5150. gbrod102.seq - Rodent sequence entries, part 102.
5151. gbrod103.seq - Rodent sequence entries, part 103.
5152. gbrod104.seq - Rodent sequence entries, part 104.
5153. gbrod105.seq - Rodent sequence entries, part 105.
5154. gbrod106.seq - Rodent sequence entries, part 106.
5155. gbrod107.seq - Rodent sequence entries, part 107.
5156. gbrod108.seq - Rodent sequence entries, part 108.
5157. gbrod109.seq - Rodent sequence entries, part 109.
5158. gbrod11.seq - Rodent sequence entries, part 11.
5159. gbrod110.seq - Rodent sequence entries, part 110.
5160. gbrod111.seq - Rodent sequence entries, part 111.
5161. gbrod112.seq - Rodent sequence entries, part 112.
5162. gbrod113.seq - Rodent sequence entries, part 113.
5163. gbrod114.seq - Rodent sequence entries, part 114.
5164. gbrod115.seq - Rodent sequence entries, part 115.
5165. gbrod12.seq - Rodent sequence entries, part 12.
5166. gbrod13.seq - Rodent sequence entries, part 13.
5167. gbrod14.seq - Rodent sequence entries, part 14.
5168. gbrod15.seq - Rodent sequence entries, part 15.
5169. gbrod16.seq - Rodent sequence entries, part 16.
5170. gbrod17.seq - Rodent sequence entries, part 17.
5171. gbrod18.seq - Rodent sequence entries, part 18.
5172. gbrod19.seq - Rodent sequence entries, part 19.
5173. gbrod2.seq - Rodent sequence entries, part 2.
5174. gbrod20.seq - Rodent sequence entries, part 20.
5175. gbrod21.seq - Rodent sequence entries, part 21.
5176. gbrod22.seq - Rodent sequence entries, part 22.
5177. gbrod23.seq - Rodent sequence entries, part 23.
5178. gbrod24.seq - Rodent sequence entries, part 24.
5179. gbrod25.seq - Rodent sequence entries, part 25.
5180. gbrod26.seq - Rodent sequence entries, part 26.
5181. gbrod27.seq - Rodent sequence entries, part 27.
5182. gbrod28.seq - Rodent sequence entries, part 28.
5183. gbrod29.seq - Rodent sequence entries, part 29.
5184. gbrod3.seq - Rodent sequence entries, part 3.
5185. gbrod30.seq - Rodent sequence entries, part 30.
5186. gbrod31.seq - Rodent sequence entries, part 31.
5187. gbrod32.seq - Rodent sequence entries, part 32.
5188. gbrod33.seq - Rodent sequence entries, part 33.
5189. gbrod34.seq - Rodent sequence entries, part 34.
5190. gbrod35.seq - Rodent sequence entries, part 35.
5191. gbrod36.seq - Rodent sequence entries, part 36.
5192. gbrod37.seq - Rodent sequence entries, part 37.
5193. gbrod38.seq - Rodent sequence entries, part 38.
5194. gbrod39.seq - Rodent sequence entries, part 39.
5195. gbrod4.seq - Rodent sequence entries, part 4.
5196. gbrod40.seq - Rodent sequence entries, part 40.
5197. gbrod41.seq - Rodent sequence entries, part 41.
5198. gbrod42.seq - Rodent sequence entries, part 42.
5199. gbrod43.seq - Rodent sequence entries, part 43.
5200. gbrod44.seq - Rodent sequence entries, part 44.
5201. gbrod45.seq - Rodent sequence entries, part 45.
5202. gbrod46.seq - Rodent sequence entries, part 46.
5203. gbrod47.seq - Rodent sequence entries, part 47.
5204. gbrod48.seq - Rodent sequence entries, part 48.
5205. gbrod49.seq - Rodent sequence entries, part 49.
5206. gbrod5.seq - Rodent sequence entries, part 5.
5207. gbrod50.seq - Rodent sequence entries, part 50.
5208. gbrod51.seq - Rodent sequence entries, part 51.
5209. gbrod52.seq - Rodent sequence entries, part 52.
5210. gbrod53.seq - Rodent sequence entries, part 53.
5211. gbrod54.seq - Rodent sequence entries, part 54.
5212. gbrod55.seq - Rodent sequence entries, part 55.
5213. gbrod56.seq - Rodent sequence entries, part 56.
5214. gbrod57.seq - Rodent sequence entries, part 57.
5215. gbrod58.seq - Rodent sequence entries, part 58.
5216. gbrod59.seq - Rodent sequence entries, part 59.
5217. gbrod6.seq - Rodent sequence entries, part 6.
5218. gbrod60.seq - Rodent sequence entries, part 60.
5219. gbrod61.seq - Rodent sequence entries, part 61.
5220. gbrod62.seq - Rodent sequence entries, part 62.
5221. gbrod63.seq - Rodent sequence entries, part 63.
5222. gbrod64.seq - Rodent sequence entries, part 64.
5223. gbrod65.seq - Rodent sequence entries, part 65.
5224. gbrod66.seq - Rodent sequence entries, part 66.
5225. gbrod67.seq - Rodent sequence entries, part 67.
5226. gbrod68.seq - Rodent sequence entries, part 68.
5227. gbrod69.seq - Rodent sequence entries, part 69.
5228. gbrod7.seq - Rodent sequence entries, part 7.
5229. gbrod70.seq - Rodent sequence entries, part 70.
5230. gbrod71.seq - Rodent sequence entries, part 71.
5231. gbrod72.seq - Rodent sequence entries, part 72.
5232. gbrod73.seq - Rodent sequence entries, part 73.
5233. gbrod74.seq - Rodent sequence entries, part 74.
5234. gbrod75.seq - Rodent sequence entries, part 75.
5235. gbrod76.seq - Rodent sequence entries, part 76.
5236. gbrod77.seq - Rodent sequence entries, part 77.
5237. gbrod78.seq - Rodent sequence entries, part 78.
5238. gbrod79.seq - Rodent sequence entries, part 79.
5239. gbrod8.seq - Rodent sequence entries, part 8.
5240. gbrod80.seq - Rodent sequence entries, part 80.
5241. gbrod81.seq - Rodent sequence entries, part 81.
5242. gbrod82.seq - Rodent sequence entries, part 82.
5243. gbrod83.seq - Rodent sequence entries, part 83.
5244. gbrod84.seq - Rodent sequence entries, part 84.
5245. gbrod85.seq - Rodent sequence entries, part 85.
5246. gbrod86.seq - Rodent sequence entries, part 86.
5247. gbrod87.seq - Rodent sequence entries, part 87.
5248. gbrod88.seq - Rodent sequence entries, part 88.
5249. gbrod89.seq - Rodent sequence entries, part 89.
5250. gbrod9.seq - Rodent sequence entries, part 9.
5251. gbrod90.seq - Rodent sequence entries, part 90.
5252. gbrod91.seq - Rodent sequence entries, part 91.
5253. gbrod92.seq - Rodent sequence entries, part 92.
5254. gbrod93.seq - Rodent sequence entries, part 93.
5255. gbrod94.seq - Rodent sequence entries, part 94.
5256. gbrod95.seq - Rodent sequence entries, part 95.
5257. gbrod96.seq - Rodent sequence entries, part 96.
5258. gbrod97.seq - Rodent sequence entries, part 97.
5259. gbrod98.seq - Rodent sequence entries, part 98.
5260. gbrod99.seq - Rodent sequence entries, part 99.
5261. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
5262. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
5263. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
5264. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
5265. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
5266. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
5267. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
5268. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
5269. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
5270. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
5271. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
5272. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
5273. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
5274. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
5275. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
5276. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
5277. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
5278. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
5279. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
5280. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
5281. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
5282. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
5283. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
5284. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
5285. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
5286. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
5287. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
5288. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
5289. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
5290. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
5291. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
5292. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
5293. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
5294. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
5295. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
5296. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
5297. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
5298. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
5299. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
5300. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
5301. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
5302. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
5303. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
5304. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
5305. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
5306. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
5307. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
5308. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
5309. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
5310. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
5311. gbuna1.seq - Unannotated sequence entries, part 1.
5312. gbvrl1.seq - Viral sequence entries, part 1.
5313. gbvrl10.seq - Viral sequence entries, part 10.
5314. gbvrl100.seq - Viral sequence entries, part 100.
5315. gbvrl101.seq - Viral sequence entries, part 101.
5316. gbvrl102.seq - Viral sequence entries, part 102.
5317. gbvrl103.seq - Viral sequence entries, part 103.
5318. gbvrl104.seq - Viral sequence entries, part 104.
5319. gbvrl105.seq - Viral sequence entries, part 105.
5320. gbvrl106.seq - Viral sequence entries, part 106.
5321. gbvrl107.seq - Viral sequence entries, part 107.
5322. gbvrl108.seq - Viral sequence entries, part 108.
5323. gbvrl109.seq - Viral sequence entries, part 109.
5324. gbvrl11.seq - Viral sequence entries, part 11.
5325. gbvrl110.seq - Viral sequence entries, part 110.
5326. gbvrl111.seq - Viral sequence entries, part 111.
5327. gbvrl112.seq - Viral sequence entries, part 112.
5328. gbvrl113.seq - Viral sequence entries, part 113.
5329. gbvrl114.seq - Viral sequence entries, part 114.
5330. gbvrl115.seq - Viral sequence entries, part 115.
5331. gbvrl116.seq - Viral sequence entries, part 116.
5332. gbvrl117.seq - Viral sequence entries, part 117.
5333. gbvrl118.seq - Viral sequence entries, part 118.
5334. gbvrl119.seq - Viral sequence entries, part 119.
5335. gbvrl12.seq - Viral sequence entries, part 12.
5336. gbvrl120.seq - Viral sequence entries, part 120.
5337. gbvrl121.seq - Viral sequence entries, part 121.
5338. gbvrl122.seq - Viral sequence entries, part 122.
5339. gbvrl123.seq - Viral sequence entries, part 123.
5340. gbvrl124.seq - Viral sequence entries, part 124.
5341. gbvrl125.seq - Viral sequence entries, part 125.
5342. gbvrl126.seq - Viral sequence entries, part 126.
5343. gbvrl127.seq - Viral sequence entries, part 127.
5344. gbvrl128.seq - Viral sequence entries, part 128.
5345. gbvrl129.seq - Viral sequence entries, part 129.
5346. gbvrl13.seq - Viral sequence entries, part 13.
5347. gbvrl130.seq - Viral sequence entries, part 130.
5348. gbvrl131.seq - Viral sequence entries, part 131.
5349. gbvrl132.seq - Viral sequence entries, part 132.
5350. gbvrl133.seq - Viral sequence entries, part 133.
5351. gbvrl134.seq - Viral sequence entries, part 134.
5352. gbvrl135.seq - Viral sequence entries, part 135.
5353. gbvrl136.seq - Viral sequence entries, part 136.
5354. gbvrl137.seq - Viral sequence entries, part 137.
5355. gbvrl138.seq - Viral sequence entries, part 138.
5356. gbvrl139.seq - Viral sequence entries, part 139.
5357. gbvrl14.seq - Viral sequence entries, part 14.
5358. gbvrl140.seq - Viral sequence entries, part 140.
5359. gbvrl141.seq - Viral sequence entries, part 141.
5360. gbvrl142.seq - Viral sequence entries, part 142.
5361. gbvrl143.seq - Viral sequence entries, part 143.
5362. gbvrl144.seq - Viral sequence entries, part 144.
5363. gbvrl145.seq - Viral sequence entries, part 145.
5364. gbvrl146.seq - Viral sequence entries, part 146.
5365. gbvrl147.seq - Viral sequence entries, part 147.
5366. gbvrl148.seq - Viral sequence entries, part 148.
5367. gbvrl149.seq - Viral sequence entries, part 149.
5368. gbvrl15.seq - Viral sequence entries, part 15.
5369. gbvrl150.seq - Viral sequence entries, part 150.
5370. gbvrl151.seq - Viral sequence entries, part 151.
5371. gbvrl152.seq - Viral sequence entries, part 152.
5372. gbvrl153.seq - Viral sequence entries, part 153.
5373. gbvrl154.seq - Viral sequence entries, part 154.
5374. gbvrl155.seq - Viral sequence entries, part 155.
5375. gbvrl156.seq - Viral sequence entries, part 156.
5376. gbvrl157.seq - Viral sequence entries, part 157.
5377. gbvrl158.seq - Viral sequence entries, part 158.
5378. gbvrl159.seq - Viral sequence entries, part 159.
5379. gbvrl16.seq - Viral sequence entries, part 16.
5380. gbvrl160.seq - Viral sequence entries, part 160.
5381. gbvrl161.seq - Viral sequence entries, part 161.
5382. gbvrl162.seq - Viral sequence entries, part 162.
5383. gbvrl163.seq - Viral sequence entries, part 163.
5384. gbvrl164.seq - Viral sequence entries, part 164.
5385. gbvrl165.seq - Viral sequence entries, part 165.
5386. gbvrl166.seq - Viral sequence entries, part 166.
5387. gbvrl167.seq - Viral sequence entries, part 167.
5388. gbvrl168.seq - Viral sequence entries, part 168.
5389. gbvrl169.seq - Viral sequence entries, part 169.
5390. gbvrl17.seq - Viral sequence entries, part 17.
5391. gbvrl170.seq - Viral sequence entries, part 170.
5392. gbvrl171.seq - Viral sequence entries, part 171.
5393. gbvrl172.seq - Viral sequence entries, part 172.
5394. gbvrl173.seq - Viral sequence entries, part 173.
5395. gbvrl174.seq - Viral sequence entries, part 174.
5396. gbvrl175.seq - Viral sequence entries, part 175.
5397. gbvrl176.seq - Viral sequence entries, part 176.
5398. gbvrl177.seq - Viral sequence entries, part 177.
5399. gbvrl178.seq - Viral sequence entries, part 178.
5400. gbvrl179.seq - Viral sequence entries, part 179.
5401. gbvrl18.seq - Viral sequence entries, part 18.
5402. gbvrl180.seq - Viral sequence entries, part 180.
5403. gbvrl181.seq - Viral sequence entries, part 181.
5404. gbvrl182.seq - Viral sequence entries, part 182.
5405. gbvrl183.seq - Viral sequence entries, part 183.
5406. gbvrl184.seq - Viral sequence entries, part 184.
5407. gbvrl185.seq - Viral sequence entries, part 185.
5408. gbvrl186.seq - Viral sequence entries, part 186.
5409. gbvrl187.seq - Viral sequence entries, part 187.
5410. gbvrl188.seq - Viral sequence entries, part 188.
5411. gbvrl189.seq - Viral sequence entries, part 189.
5412. gbvrl19.seq - Viral sequence entries, part 19.
5413. gbvrl190.seq - Viral sequence entries, part 190.
5414. gbvrl191.seq - Viral sequence entries, part 191.
5415. gbvrl192.seq - Viral sequence entries, part 192.
5416. gbvrl193.seq - Viral sequence entries, part 193.
5417. gbvrl194.seq - Viral sequence entries, part 194.
5418. gbvrl195.seq - Viral sequence entries, part 195.
5419. gbvrl196.seq - Viral sequence entries, part 196.
5420. gbvrl197.seq - Viral sequence entries, part 197.
5421. gbvrl198.seq - Viral sequence entries, part 198.
5422. gbvrl199.seq - Viral sequence entries, part 199.
5423. gbvrl2.seq - Viral sequence entries, part 2.
5424. gbvrl20.seq - Viral sequence entries, part 20.
5425. gbvrl200.seq - Viral sequence entries, part 200.
5426. gbvrl201.seq - Viral sequence entries, part 201.
5427. gbvrl202.seq - Viral sequence entries, part 202.
5428. gbvrl203.seq - Viral sequence entries, part 203.
5429. gbvrl204.seq - Viral sequence entries, part 204.
5430. gbvrl205.seq - Viral sequence entries, part 205.
5431. gbvrl206.seq - Viral sequence entries, part 206.
5432. gbvrl207.seq - Viral sequence entries, part 207.
5433. gbvrl208.seq - Viral sequence entries, part 208.
5434. gbvrl209.seq - Viral sequence entries, part 209.
5435. gbvrl21.seq - Viral sequence entries, part 21.
5436. gbvrl210.seq - Viral sequence entries, part 210.
5437. gbvrl211.seq - Viral sequence entries, part 211.
5438. gbvrl212.seq - Viral sequence entries, part 212.
5439. gbvrl213.seq - Viral sequence entries, part 213.
5440. gbvrl214.seq - Viral sequence entries, part 214.
5441. gbvrl215.seq - Viral sequence entries, part 215.
5442. gbvrl216.seq - Viral sequence entries, part 216.
5443. gbvrl217.seq - Viral sequence entries, part 217.
5444. gbvrl218.seq - Viral sequence entries, part 218.
5445. gbvrl219.seq - Viral sequence entries, part 219.
5446. gbvrl22.seq - Viral sequence entries, part 22.
5447. gbvrl220.seq - Viral sequence entries, part 220.
5448. gbvrl221.seq - Viral sequence entries, part 221.
5449. gbvrl222.seq - Viral sequence entries, part 222.
5450. gbvrl223.seq - Viral sequence entries, part 223.
5451. gbvrl224.seq - Viral sequence entries, part 224.
5452. gbvrl225.seq - Viral sequence entries, part 225.
5453. gbvrl226.seq - Viral sequence entries, part 226.
5454. gbvrl227.seq - Viral sequence entries, part 227.
5455. gbvrl228.seq - Viral sequence entries, part 228.
5456. gbvrl229.seq - Viral sequence entries, part 229.
5457. gbvrl23.seq - Viral sequence entries, part 23.
5458. gbvrl230.seq - Viral sequence entries, part 230.
5459. gbvrl231.seq - Viral sequence entries, part 231.
5460. gbvrl232.seq - Viral sequence entries, part 232.
5461. gbvrl233.seq - Viral sequence entries, part 233.
5462. gbvrl234.seq - Viral sequence entries, part 234.
5463. gbvrl235.seq - Viral sequence entries, part 235.
5464. gbvrl236.seq - Viral sequence entries, part 236.
5465. gbvrl237.seq - Viral sequence entries, part 237.
5466. gbvrl238.seq - Viral sequence entries, part 238.
5467. gbvrl239.seq - Viral sequence entries, part 239.
5468. gbvrl24.seq - Viral sequence entries, part 24.
5469. gbvrl240.seq - Viral sequence entries, part 240.
5470. gbvrl241.seq - Viral sequence entries, part 241.
5471. gbvrl242.seq - Viral sequence entries, part 242.
5472. gbvrl243.seq - Viral sequence entries, part 243.
5473. gbvrl244.seq - Viral sequence entries, part 244.
5474. gbvrl245.seq - Viral sequence entries, part 245.
5475. gbvrl246.seq - Viral sequence entries, part 246.
5476. gbvrl247.seq - Viral sequence entries, part 247.
5477. gbvrl248.seq - Viral sequence entries, part 248.
5478. gbvrl249.seq - Viral sequence entries, part 249.
5479. gbvrl25.seq - Viral sequence entries, part 25.
5480. gbvrl250.seq - Viral sequence entries, part 250.
5481. gbvrl251.seq - Viral sequence entries, part 251.
5482. gbvrl252.seq - Viral sequence entries, part 252.
5483. gbvrl253.seq - Viral sequence entries, part 253.
5484. gbvrl254.seq - Viral sequence entries, part 254.
5485. gbvrl255.seq - Viral sequence entries, part 255.
5486. gbvrl256.seq - Viral sequence entries, part 256.
5487. gbvrl257.seq - Viral sequence entries, part 257.
5488. gbvrl258.seq - Viral sequence entries, part 258.
5489. gbvrl259.seq - Viral sequence entries, part 259.
5490. gbvrl26.seq - Viral sequence entries, part 26.
5491. gbvrl260.seq - Viral sequence entries, part 260.
5492. gbvrl261.seq - Viral sequence entries, part 261.
5493. gbvrl262.seq - Viral sequence entries, part 262.
5494. gbvrl263.seq - Viral sequence entries, part 263.
5495. gbvrl264.seq - Viral sequence entries, part 264.
5496. gbvrl265.seq - Viral sequence entries, part 265.
5497. gbvrl266.seq - Viral sequence entries, part 266.
5498. gbvrl267.seq - Viral sequence entries, part 267.
5499. gbvrl268.seq - Viral sequence entries, part 268.
5500. gbvrl269.seq - Viral sequence entries, part 269.
5501. gbvrl27.seq - Viral sequence entries, part 27.
5502. gbvrl270.seq - Viral sequence entries, part 270.
5503. gbvrl271.seq - Viral sequence entries, part 271.
5504. gbvrl272.seq - Viral sequence entries, part 272.
5505. gbvrl273.seq - Viral sequence entries, part 273.
5506. gbvrl274.seq - Viral sequence entries, part 274.
5507. gbvrl275.seq - Viral sequence entries, part 275.
5508. gbvrl276.seq - Viral sequence entries, part 276.
5509. gbvrl277.seq - Viral sequence entries, part 277.
5510. gbvrl278.seq - Viral sequence entries, part 278.
5511. gbvrl279.seq - Viral sequence entries, part 279.
5512. gbvrl28.seq - Viral sequence entries, part 28.
5513. gbvrl280.seq - Viral sequence entries, part 280.
5514. gbvrl281.seq - Viral sequence entries, part 281.
5515. gbvrl282.seq - Viral sequence entries, part 282.
5516. gbvrl283.seq - Viral sequence entries, part 283.
5517. gbvrl284.seq - Viral sequence entries, part 284.
5518. gbvrl285.seq - Viral sequence entries, part 285.
5519. gbvrl286.seq - Viral sequence entries, part 286.
5520. gbvrl287.seq - Viral sequence entries, part 287.
5521. gbvrl288.seq - Viral sequence entries, part 288.
5522. gbvrl289.seq - Viral sequence entries, part 289.
5523. gbvrl29.seq - Viral sequence entries, part 29.
5524. gbvrl290.seq - Viral sequence entries, part 290.
5525. gbvrl291.seq - Viral sequence entries, part 291.
5526. gbvrl292.seq - Viral sequence entries, part 292.
5527. gbvrl293.seq - Viral sequence entries, part 293.
5528. gbvrl294.seq - Viral sequence entries, part 294.
5529. gbvrl295.seq - Viral sequence entries, part 295.
5530. gbvrl296.seq - Viral sequence entries, part 296.
5531. gbvrl297.seq - Viral sequence entries, part 297.
5532. gbvrl298.seq - Viral sequence entries, part 298.
5533. gbvrl299.seq - Viral sequence entries, part 299.
5534. gbvrl3.seq - Viral sequence entries, part 3.
5535. gbvrl30.seq - Viral sequence entries, part 30.
5536. gbvrl300.seq - Viral sequence entries, part 300.
5537. gbvrl301.seq - Viral sequence entries, part 301.
5538. gbvrl302.seq - Viral sequence entries, part 302.
5539. gbvrl303.seq - Viral sequence entries, part 303.
5540. gbvrl304.seq - Viral sequence entries, part 304.
5541. gbvrl305.seq - Viral sequence entries, part 305.
5542. gbvrl306.seq - Viral sequence entries, part 306.
5543. gbvrl307.seq - Viral sequence entries, part 307.
5544. gbvrl308.seq - Viral sequence entries, part 308.
5545. gbvrl309.seq - Viral sequence entries, part 309.
5546. gbvrl31.seq - Viral sequence entries, part 31.
5547. gbvrl310.seq - Viral sequence entries, part 310.
5548. gbvrl311.seq - Viral sequence entries, part 311.
5549. gbvrl312.seq - Viral sequence entries, part 312.
5550. gbvrl313.seq - Viral sequence entries, part 313.
5551. gbvrl314.seq - Viral sequence entries, part 314.
5552. gbvrl315.seq - Viral sequence entries, part 315.
5553. gbvrl316.seq - Viral sequence entries, part 316.
5554. gbvrl317.seq - Viral sequence entries, part 317.
5555. gbvrl318.seq - Viral sequence entries, part 318.
5556. gbvrl319.seq - Viral sequence entries, part 319.
5557. gbvrl32.seq - Viral sequence entries, part 32.
5558. gbvrl320.seq - Viral sequence entries, part 320.
5559. gbvrl321.seq - Viral sequence entries, part 321.
5560. gbvrl322.seq - Viral sequence entries, part 322.
5561. gbvrl323.seq - Viral sequence entries, part 323.
5562. gbvrl324.seq - Viral sequence entries, part 324.
5563. gbvrl325.seq - Viral sequence entries, part 325.
5564. gbvrl326.seq - Viral sequence entries, part 326.
5565. gbvrl327.seq - Viral sequence entries, part 327.
5566. gbvrl328.seq - Viral sequence entries, part 328.
5567. gbvrl329.seq - Viral sequence entries, part 329.
5568. gbvrl33.seq - Viral sequence entries, part 33.
5569. gbvrl330.seq - Viral sequence entries, part 330.
5570. gbvrl331.seq - Viral sequence entries, part 331.
5571. gbvrl332.seq - Viral sequence entries, part 332.
5572. gbvrl333.seq - Viral sequence entries, part 333.
5573. gbvrl334.seq - Viral sequence entries, part 334.
5574. gbvrl335.seq - Viral sequence entries, part 335.
5575. gbvrl336.seq - Viral sequence entries, part 336.
5576. gbvrl337.seq - Viral sequence entries, part 337.
5577. gbvrl338.seq - Viral sequence entries, part 338.
5578. gbvrl339.seq - Viral sequence entries, part 339.
5579. gbvrl34.seq - Viral sequence entries, part 34.
5580. gbvrl340.seq - Viral sequence entries, part 340.
5581. gbvrl35.seq - Viral sequence entries, part 35.
5582. gbvrl36.seq - Viral sequence entries, part 36.
5583. gbvrl37.seq - Viral sequence entries, part 37.
5584. gbvrl38.seq - Viral sequence entries, part 38.
5585. gbvrl39.seq - Viral sequence entries, part 39.
5586. gbvrl4.seq - Viral sequence entries, part 4.
5587. gbvrl40.seq - Viral sequence entries, part 40.
5588. gbvrl41.seq - Viral sequence entries, part 41.
5589. gbvrl42.seq - Viral sequence entries, part 42.
5590. gbvrl43.seq - Viral sequence entries, part 43.
5591. gbvrl44.seq - Viral sequence entries, part 44.
5592. gbvrl45.seq - Viral sequence entries, part 45.
5593. gbvrl46.seq - Viral sequence entries, part 46.
5594. gbvrl47.seq - Viral sequence entries, part 47.
5595. gbvrl48.seq - Viral sequence entries, part 48.
5596. gbvrl49.seq - Viral sequence entries, part 49.
5597. gbvrl5.seq - Viral sequence entries, part 5.
5598. gbvrl50.seq - Viral sequence entries, part 50.
5599. gbvrl51.seq - Viral sequence entries, part 51.
5600. gbvrl52.seq - Viral sequence entries, part 52.
5601. gbvrl53.seq - Viral sequence entries, part 53.
5602. gbvrl54.seq - Viral sequence entries, part 54.
5603. gbvrl55.seq - Viral sequence entries, part 55.
5604. gbvrl56.seq - Viral sequence entries, part 56.
5605. gbvrl57.seq - Viral sequence entries, part 57.
5606. gbvrl58.seq - Viral sequence entries, part 58.
5607. gbvrl59.seq - Viral sequence entries, part 59.
5608. gbvrl6.seq - Viral sequence entries, part 6.
5609. gbvrl60.seq - Viral sequence entries, part 60.
5610. gbvrl61.seq - Viral sequence entries, part 61.
5611. gbvrl62.seq - Viral sequence entries, part 62.
5612. gbvrl63.seq - Viral sequence entries, part 63.
5613. gbvrl64.seq - Viral sequence entries, part 64.
5614. gbvrl65.seq - Viral sequence entries, part 65.
5615. gbvrl66.seq - Viral sequence entries, part 66.
5616. gbvrl67.seq - Viral sequence entries, part 67.
5617. gbvrl68.seq - Viral sequence entries, part 68.
5618. gbvrl69.seq - Viral sequence entries, part 69.
5619. gbvrl7.seq - Viral sequence entries, part 7.
5620. gbvrl70.seq - Viral sequence entries, part 70.
5621. gbvrl71.seq - Viral sequence entries, part 71.
5622. gbvrl72.seq - Viral sequence entries, part 72.
5623. gbvrl73.seq - Viral sequence entries, part 73.
5624. gbvrl74.seq - Viral sequence entries, part 74.
5625. gbvrl75.seq - Viral sequence entries, part 75.
5626. gbvrl76.seq - Viral sequence entries, part 76.
5627. gbvrl77.seq - Viral sequence entries, part 77.
5628. gbvrl78.seq - Viral sequence entries, part 78.
5629. gbvrl79.seq - Viral sequence entries, part 79.
5630. gbvrl8.seq - Viral sequence entries, part 8.
5631. gbvrl80.seq - Viral sequence entries, part 80.
5632. gbvrl81.seq - Viral sequence entries, part 81.
5633. gbvrl82.seq - Viral sequence entries, part 82.
5634. gbvrl83.seq - Viral sequence entries, part 83.
5635. gbvrl84.seq - Viral sequence entries, part 84.
5636. gbvrl85.seq - Viral sequence entries, part 85.
5637. gbvrl86.seq - Viral sequence entries, part 86.
5638. gbvrl87.seq - Viral sequence entries, part 87.
5639. gbvrl88.seq - Viral sequence entries, part 88.
5640. gbvrl89.seq - Viral sequence entries, part 89.
5641. gbvrl9.seq - Viral sequence entries, part 9.
5642. gbvrl90.seq - Viral sequence entries, part 90.
5643. gbvrl91.seq - Viral sequence entries, part 91.
5644. gbvrl92.seq - Viral sequence entries, part 92.
5645. gbvrl93.seq - Viral sequence entries, part 93.
5646. gbvrl94.seq - Viral sequence entries, part 94.
5647. gbvrl95.seq - Viral sequence entries, part 95.
5648. gbvrl96.seq - Viral sequence entries, part 96.
5649. gbvrl97.seq - Viral sequence entries, part 97.
5650. gbvrl98.seq - Viral sequence entries, part 98.
5651. gbvrl99.seq - Viral sequence entries, part 99.
5652. gbvrt1.seq - Other vertebrate sequence entries, part 1.
5653. gbvrt10.seq - Other vertebrate sequence entries, part 10.
5654. gbvrt100.seq - Other vertebrate sequence entries, part 100.
5655. gbvrt101.seq - Other vertebrate sequence entries, part 101.
5656. gbvrt102.seq - Other vertebrate sequence entries, part 102.
5657. gbvrt103.seq - Other vertebrate sequence entries, part 103.
5658. gbvrt104.seq - Other vertebrate sequence entries, part 104.
5659. gbvrt105.seq - Other vertebrate sequence entries, part 105.
5660. gbvrt106.seq - Other vertebrate sequence entries, part 106.
5661. gbvrt107.seq - Other vertebrate sequence entries, part 107.
5662. gbvrt108.seq - Other vertebrate sequence entries, part 108.
5663. gbvrt109.seq - Other vertebrate sequence entries, part 109.
5664. gbvrt11.seq - Other vertebrate sequence entries, part 11.
5665. gbvrt110.seq - Other vertebrate sequence entries, part 110.
5666. gbvrt111.seq - Other vertebrate sequence entries, part 111.
5667. gbvrt112.seq - Other vertebrate sequence entries, part 112.
5668. gbvrt113.seq - Other vertebrate sequence entries, part 113.
5669. gbvrt114.seq - Other vertebrate sequence entries, part 114.
5670. gbvrt115.seq - Other vertebrate sequence entries, part 115.
5671. gbvrt116.seq - Other vertebrate sequence entries, part 116.
5672. gbvrt117.seq - Other vertebrate sequence entries, part 117.
5673. gbvrt118.seq - Other vertebrate sequence entries, part 118.
5674. gbvrt119.seq - Other vertebrate sequence entries, part 119.
5675. gbvrt12.seq - Other vertebrate sequence entries, part 12.
5676. gbvrt120.seq - Other vertebrate sequence entries, part 120.
5677. gbvrt121.seq - Other vertebrate sequence entries, part 121.
5678. gbvrt122.seq - Other vertebrate sequence entries, part 122.
5679. gbvrt123.seq - Other vertebrate sequence entries, part 123.
5680. gbvrt124.seq - Other vertebrate sequence entries, part 124.
5681. gbvrt125.seq - Other vertebrate sequence entries, part 125.
5682. gbvrt126.seq - Other vertebrate sequence entries, part 126.
5683. gbvrt127.seq - Other vertebrate sequence entries, part 127.
5684. gbvrt128.seq - Other vertebrate sequence entries, part 128.
5685. gbvrt129.seq - Other vertebrate sequence entries, part 129.
5686. gbvrt13.seq - Other vertebrate sequence entries, part 13.
5687. gbvrt130.seq - Other vertebrate sequence entries, part 130.
5688. gbvrt131.seq - Other vertebrate sequence entries, part 131.
5689. gbvrt132.seq - Other vertebrate sequence entries, part 132.
5690. gbvrt133.seq - Other vertebrate sequence entries, part 133.
5691. gbvrt134.seq - Other vertebrate sequence entries, part 134.
5692. gbvrt135.seq - Other vertebrate sequence entries, part 135.
5693. gbvrt136.seq - Other vertebrate sequence entries, part 136.
5694. gbvrt137.seq - Other vertebrate sequence entries, part 137.
5695. gbvrt138.seq - Other vertebrate sequence entries, part 138.
5696. gbvrt139.seq - Other vertebrate sequence entries, part 139.
5697. gbvrt14.seq - Other vertebrate sequence entries, part 14.
5698. gbvrt140.seq - Other vertebrate sequence entries, part 140.
5699. gbvrt141.seq - Other vertebrate sequence entries, part 141.
5700. gbvrt142.seq - Other vertebrate sequence entries, part 142.
5701. gbvrt143.seq - Other vertebrate sequence entries, part 143.
5702. gbvrt144.seq - Other vertebrate sequence entries, part 144.
5703. gbvrt145.seq - Other vertebrate sequence entries, part 145.
5704. gbvrt146.seq - Other vertebrate sequence entries, part 146.
5705. gbvrt147.seq - Other vertebrate sequence entries, part 147.
5706. gbvrt148.seq - Other vertebrate sequence entries, part 148.
5707. gbvrt149.seq - Other vertebrate sequence entries, part 149.
5708. gbvrt15.seq - Other vertebrate sequence entries, part 15.
5709. gbvrt150.seq - Other vertebrate sequence entries, part 150.
5710. gbvrt151.seq - Other vertebrate sequence entries, part 151.
5711. gbvrt152.seq - Other vertebrate sequence entries, part 152.
5712. gbvrt153.seq - Other vertebrate sequence entries, part 153.
5713. gbvrt154.seq - Other vertebrate sequence entries, part 154.
5714. gbvrt155.seq - Other vertebrate sequence entries, part 155.
5715. gbvrt156.seq - Other vertebrate sequence entries, part 156.
5716. gbvrt157.seq - Other vertebrate sequence entries, part 157.
5717. gbvrt158.seq - Other vertebrate sequence entries, part 158.
5718. gbvrt159.seq - Other vertebrate sequence entries, part 159.
5719. gbvrt16.seq - Other vertebrate sequence entries, part 16.
5720. gbvrt160.seq - Other vertebrate sequence entries, part 160.
5721. gbvrt161.seq - Other vertebrate sequence entries, part 161.
5722. gbvrt162.seq - Other vertebrate sequence entries, part 162.
5723. gbvrt163.seq - Other vertebrate sequence entries, part 163.
5724. gbvrt164.seq - Other vertebrate sequence entries, part 164.
5725. gbvrt165.seq - Other vertebrate sequence entries, part 165.
5726. gbvrt166.seq - Other vertebrate sequence entries, part 166.
5727. gbvrt167.seq - Other vertebrate sequence entries, part 167.
5728. gbvrt168.seq - Other vertebrate sequence entries, part 168.
5729. gbvrt169.seq - Other vertebrate sequence entries, part 169.
5730. gbvrt17.seq - Other vertebrate sequence entries, part 17.
5731. gbvrt170.seq - Other vertebrate sequence entries, part 170.
5732. gbvrt171.seq - Other vertebrate sequence entries, part 171.
5733. gbvrt172.seq - Other vertebrate sequence entries, part 172.
5734. gbvrt173.seq - Other vertebrate sequence entries, part 173.
5735. gbvrt174.seq - Other vertebrate sequence entries, part 174.
5736. gbvrt175.seq - Other vertebrate sequence entries, part 175.
5737. gbvrt176.seq - Other vertebrate sequence entries, part 176.
5738. gbvrt177.seq - Other vertebrate sequence entries, part 177.
5739. gbvrt178.seq - Other vertebrate sequence entries, part 178.
5740. gbvrt179.seq - Other vertebrate sequence entries, part 179.
5741. gbvrt18.seq - Other vertebrate sequence entries, part 18.
5742. gbvrt180.seq - Other vertebrate sequence entries, part 180.
5743. gbvrt181.seq - Other vertebrate sequence entries, part 181.
5744. gbvrt182.seq - Other vertebrate sequence entries, part 182.
5745. gbvrt183.seq - Other vertebrate sequence entries, part 183.
5746. gbvrt184.seq - Other vertebrate sequence entries, part 184.
5747. gbvrt185.seq - Other vertebrate sequence entries, part 185.
5748. gbvrt186.seq - Other vertebrate sequence entries, part 186.
5749. gbvrt187.seq - Other vertebrate sequence entries, part 187.
5750. gbvrt188.seq - Other vertebrate sequence entries, part 188.
5751. gbvrt189.seq - Other vertebrate sequence entries, part 189.
5752. gbvrt19.seq - Other vertebrate sequence entries, part 19.
5753. gbvrt190.seq - Other vertebrate sequence entries, part 190.
5754. gbvrt191.seq - Other vertebrate sequence entries, part 191.
5755. gbvrt192.seq - Other vertebrate sequence entries, part 192.
5756. gbvrt193.seq - Other vertebrate sequence entries, part 193.
5757. gbvrt194.seq - Other vertebrate sequence entries, part 194.
5758. gbvrt195.seq - Other vertebrate sequence entries, part 195.
5759. gbvrt196.seq - Other vertebrate sequence entries, part 196.
5760. gbvrt197.seq - Other vertebrate sequence entries, part 197.
5761. gbvrt198.seq - Other vertebrate sequence entries, part 198.
5762. gbvrt199.seq - Other vertebrate sequence entries, part 199.
5763. gbvrt2.seq - Other vertebrate sequence entries, part 2.
5764. gbvrt20.seq - Other vertebrate sequence entries, part 20.
5765. gbvrt200.seq - Other vertebrate sequence entries, part 200.
5766. gbvrt201.seq - Other vertebrate sequence entries, part 201.
5767. gbvrt202.seq - Other vertebrate sequence entries, part 202.
5768. gbvrt203.seq - Other vertebrate sequence entries, part 203.
5769. gbvrt204.seq - Other vertebrate sequence entries, part 204.
5770. gbvrt205.seq - Other vertebrate sequence entries, part 205.
5771. gbvrt206.seq - Other vertebrate sequence entries, part 206.
5772. gbvrt207.seq - Other vertebrate sequence entries, part 207.
5773. gbvrt208.seq - Other vertebrate sequence entries, part 208.
5774. gbvrt209.seq - Other vertebrate sequence entries, part 209.
5775. gbvrt21.seq - Other vertebrate sequence entries, part 21.
5776. gbvrt210.seq - Other vertebrate sequence entries, part 210.
5777. gbvrt211.seq - Other vertebrate sequence entries, part 211.
5778. gbvrt212.seq - Other vertebrate sequence entries, part 212.
5779. gbvrt213.seq - Other vertebrate sequence entries, part 213.
5780. gbvrt214.seq - Other vertebrate sequence entries, part 214.
5781. gbvrt215.seq - Other vertebrate sequence entries, part 215.
5782. gbvrt216.seq - Other vertebrate sequence entries, part 216.
5783. gbvrt217.seq - Other vertebrate sequence entries, part 217.
5784. gbvrt218.seq - Other vertebrate sequence entries, part 218.
5785. gbvrt219.seq - Other vertebrate sequence entries, part 219.
5786. gbvrt22.seq - Other vertebrate sequence entries, part 22.
5787. gbvrt220.seq - Other vertebrate sequence entries, part 220.
5788. gbvrt221.seq - Other vertebrate sequence entries, part 221.
5789. gbvrt222.seq - Other vertebrate sequence entries, part 222.
5790. gbvrt223.seq - Other vertebrate sequence entries, part 223.
5791. gbvrt224.seq - Other vertebrate sequence entries, part 224.
5792. gbvrt225.seq - Other vertebrate sequence entries, part 225.
5793. gbvrt226.seq - Other vertebrate sequence entries, part 226.
5794. gbvrt227.seq - Other vertebrate sequence entries, part 227.
5795. gbvrt228.seq - Other vertebrate sequence entries, part 228.
5796. gbvrt229.seq - Other vertebrate sequence entries, part 229.
5797. gbvrt23.seq - Other vertebrate sequence entries, part 23.
5798. gbvrt230.seq - Other vertebrate sequence entries, part 230.
5799. gbvrt231.seq - Other vertebrate sequence entries, part 231.
5800. gbvrt232.seq - Other vertebrate sequence entries, part 232.
5801. gbvrt233.seq - Other vertebrate sequence entries, part 233.
5802. gbvrt234.seq - Other vertebrate sequence entries, part 234.
5803. gbvrt235.seq - Other vertebrate sequence entries, part 235.
5804. gbvrt236.seq - Other vertebrate sequence entries, part 236.
5805. gbvrt237.seq - Other vertebrate sequence entries, part 237.
5806. gbvrt238.seq - Other vertebrate sequence entries, part 238.
5807. gbvrt239.seq - Other vertebrate sequence entries, part 239.
5808. gbvrt24.seq - Other vertebrate sequence entries, part 24.
5809. gbvrt240.seq - Other vertebrate sequence entries, part 240.
5810. gbvrt241.seq - Other vertebrate sequence entries, part 241.
5811. gbvrt242.seq - Other vertebrate sequence entries, part 242.
5812. gbvrt243.seq - Other vertebrate sequence entries, part 243.
5813. gbvrt244.seq - Other vertebrate sequence entries, part 244.
5814. gbvrt245.seq - Other vertebrate sequence entries, part 245.
5815. gbvrt246.seq - Other vertebrate sequence entries, part 246.
5816. gbvrt247.seq - Other vertebrate sequence entries, part 247.
5817. gbvrt248.seq - Other vertebrate sequence entries, part 248.
5818. gbvrt249.seq - Other vertebrate sequence entries, part 249.
5819. gbvrt25.seq - Other vertebrate sequence entries, part 25.
5820. gbvrt250.seq - Other vertebrate sequence entries, part 250.
5821. gbvrt251.seq - Other vertebrate sequence entries, part 251.
5822. gbvrt252.seq - Other vertebrate sequence entries, part 252.
5823. gbvrt253.seq - Other vertebrate sequence entries, part 253.
5824. gbvrt254.seq - Other vertebrate sequence entries, part 254.
5825. gbvrt255.seq - Other vertebrate sequence entries, part 255.
5826. gbvrt256.seq - Other vertebrate sequence entries, part 256.
5827. gbvrt257.seq - Other vertebrate sequence entries, part 257.
5828. gbvrt258.seq - Other vertebrate sequence entries, part 258.
5829. gbvrt259.seq - Other vertebrate sequence entries, part 259.
5830. gbvrt26.seq - Other vertebrate sequence entries, part 26.
5831. gbvrt260.seq - Other vertebrate sequence entries, part 260.
5832. gbvrt261.seq - Other vertebrate sequence entries, part 261.
5833. gbvrt262.seq - Other vertebrate sequence entries, part 262.
5834. gbvrt263.seq - Other vertebrate sequence entries, part 263.
5835. gbvrt264.seq - Other vertebrate sequence entries, part 264.
5836. gbvrt265.seq - Other vertebrate sequence entries, part 265.
5837. gbvrt266.seq - Other vertebrate sequence entries, part 266.
5838. gbvrt267.seq - Other vertebrate sequence entries, part 267.
5839. gbvrt268.seq - Other vertebrate sequence entries, part 268.
5840. gbvrt269.seq - Other vertebrate sequence entries, part 269.
5841. gbvrt27.seq - Other vertebrate sequence entries, part 27.
5842. gbvrt270.seq - Other vertebrate sequence entries, part 270.
5843. gbvrt271.seq - Other vertebrate sequence entries, part 271.
5844. gbvrt272.seq - Other vertebrate sequence entries, part 272.
5845. gbvrt273.seq - Other vertebrate sequence entries, part 273.
5846. gbvrt274.seq - Other vertebrate sequence entries, part 274.
5847. gbvrt275.seq - Other vertebrate sequence entries, part 275.
5848. gbvrt276.seq - Other vertebrate sequence entries, part 276.
5849. gbvrt277.seq - Other vertebrate sequence entries, part 277.
5850. gbvrt278.seq - Other vertebrate sequence entries, part 278.
5851. gbvrt279.seq - Other vertebrate sequence entries, part 279.
5852. gbvrt28.seq - Other vertebrate sequence entries, part 28.
5853. gbvrt280.seq - Other vertebrate sequence entries, part 280.
5854. gbvrt281.seq - Other vertebrate sequence entries, part 281.
5855. gbvrt282.seq - Other vertebrate sequence entries, part 282.
5856. gbvrt283.seq - Other vertebrate sequence entries, part 283.
5857. gbvrt284.seq - Other vertebrate sequence entries, part 284.
5858. gbvrt285.seq - Other vertebrate sequence entries, part 285.
5859. gbvrt286.seq - Other vertebrate sequence entries, part 286.
5860. gbvrt287.seq - Other vertebrate sequence entries, part 287.
5861. gbvrt288.seq - Other vertebrate sequence entries, part 288.
5862. gbvrt289.seq - Other vertebrate sequence entries, part 289.
5863. gbvrt29.seq - Other vertebrate sequence entries, part 29.
5864. gbvrt290.seq - Other vertebrate sequence entries, part 290.
5865. gbvrt291.seq - Other vertebrate sequence entries, part 291.
5866. gbvrt292.seq - Other vertebrate sequence entries, part 292.
5867. gbvrt293.seq - Other vertebrate sequence entries, part 293.
5868. gbvrt294.seq - Other vertebrate sequence entries, part 294.
5869. gbvrt295.seq - Other vertebrate sequence entries, part 295.
5870. gbvrt296.seq - Other vertebrate sequence entries, part 296.
5871. gbvrt297.seq - Other vertebrate sequence entries, part 297.
5872. gbvrt298.seq - Other vertebrate sequence entries, part 298.
5873. gbvrt299.seq - Other vertebrate sequence entries, part 299.
5874. gbvrt3.seq - Other vertebrate sequence entries, part 3.
5875. gbvrt30.seq - Other vertebrate sequence entries, part 30.
5876. gbvrt300.seq - Other vertebrate sequence entries, part 300.
5877. gbvrt301.seq - Other vertebrate sequence entries, part 301.
5878. gbvrt302.seq - Other vertebrate sequence entries, part 302.
5879. gbvrt303.seq - Other vertebrate sequence entries, part 303.
5880. gbvrt304.seq - Other vertebrate sequence entries, part 304.
5881. gbvrt305.seq - Other vertebrate sequence entries, part 305.
5882. gbvrt306.seq - Other vertebrate sequence entries, part 306.
5883. gbvrt307.seq - Other vertebrate sequence entries, part 307.
5884. gbvrt308.seq - Other vertebrate sequence entries, part 308.
5885. gbvrt309.seq - Other vertebrate sequence entries, part 309.
5886. gbvrt31.seq - Other vertebrate sequence entries, part 31.
5887. gbvrt310.seq - Other vertebrate sequence entries, part 310.
5888. gbvrt311.seq - Other vertebrate sequence entries, part 311.
5889. gbvrt312.seq - Other vertebrate sequence entries, part 312.
5890. gbvrt313.seq - Other vertebrate sequence entries, part 313.
5891. gbvrt314.seq - Other vertebrate sequence entries, part 314.
5892. gbvrt315.seq - Other vertebrate sequence entries, part 315.
5893. gbvrt316.seq - Other vertebrate sequence entries, part 316.
5894. gbvrt317.seq - Other vertebrate sequence entries, part 317.
5895. gbvrt318.seq - Other vertebrate sequence entries, part 318.
5896. gbvrt319.seq - Other vertebrate sequence entries, part 319.
5897. gbvrt32.seq - Other vertebrate sequence entries, part 32.
5898. gbvrt320.seq - Other vertebrate sequence entries, part 320.
5899. gbvrt321.seq - Other vertebrate sequence entries, part 321.
5900. gbvrt322.seq - Other vertebrate sequence entries, part 322.
5901. gbvrt323.seq - Other vertebrate sequence entries, part 323.
5902. gbvrt324.seq - Other vertebrate sequence entries, part 324.
5903. gbvrt325.seq - Other vertebrate sequence entries, part 325.
5904. gbvrt326.seq - Other vertebrate sequence entries, part 326.
5905. gbvrt327.seq - Other vertebrate sequence entries, part 327.
5906. gbvrt328.seq - Other vertebrate sequence entries, part 328.
5907. gbvrt329.seq - Other vertebrate sequence entries, part 329.
5908. gbvrt33.seq - Other vertebrate sequence entries, part 33.
5909. gbvrt330.seq - Other vertebrate sequence entries, part 330.
5910. gbvrt331.seq - Other vertebrate sequence entries, part 331.
5911. gbvrt332.seq - Other vertebrate sequence entries, part 332.
5912. gbvrt333.seq - Other vertebrate sequence entries, part 333.
5913. gbvrt334.seq - Other vertebrate sequence entries, part 334.
5914. gbvrt335.seq - Other vertebrate sequence entries, part 335.
5915. gbvrt336.seq - Other vertebrate sequence entries, part 336.
5916. gbvrt337.seq - Other vertebrate sequence entries, part 337.
5917. gbvrt338.seq - Other vertebrate sequence entries, part 338.
5918. gbvrt339.seq - Other vertebrate sequence entries, part 339.
5919. gbvrt34.seq - Other vertebrate sequence entries, part 34.
5920. gbvrt340.seq - Other vertebrate sequence entries, part 340.
5921. gbvrt341.seq - Other vertebrate sequence entries, part 341.
5922. gbvrt342.seq - Other vertebrate sequence entries, part 342.
5923. gbvrt343.seq - Other vertebrate sequence entries, part 343.
5924. gbvrt344.seq - Other vertebrate sequence entries, part 344.
5925. gbvrt345.seq - Other vertebrate sequence entries, part 345.
5926. gbvrt346.seq - Other vertebrate sequence entries, part 346.
5927. gbvrt347.seq - Other vertebrate sequence entries, part 347.
5928. gbvrt348.seq - Other vertebrate sequence entries, part 348.
5929. gbvrt349.seq - Other vertebrate sequence entries, part 349.
5930. gbvrt35.seq - Other vertebrate sequence entries, part 35.
5931. gbvrt350.seq - Other vertebrate sequence entries, part 350.
5932. gbvrt351.seq - Other vertebrate sequence entries, part 351.
5933. gbvrt352.seq - Other vertebrate sequence entries, part 352.
5934. gbvrt353.seq - Other vertebrate sequence entries, part 353.
5935. gbvrt354.seq - Other vertebrate sequence entries, part 354.
5936. gbvrt355.seq - Other vertebrate sequence entries, part 355.
5937. gbvrt356.seq - Other vertebrate sequence entries, part 356.
5938. gbvrt357.seq - Other vertebrate sequence entries, part 357.
5939. gbvrt358.seq - Other vertebrate sequence entries, part 358.
5940. gbvrt359.seq - Other vertebrate sequence entries, part 359.
5941. gbvrt36.seq - Other vertebrate sequence entries, part 36.
5942. gbvrt360.seq - Other vertebrate sequence entries, part 360.
5943. gbvrt361.seq - Other vertebrate sequence entries, part 361.
5944. gbvrt362.seq - Other vertebrate sequence entries, part 362.
5945. gbvrt363.seq - Other vertebrate sequence entries, part 363.
5946. gbvrt364.seq - Other vertebrate sequence entries, part 364.
5947. gbvrt365.seq - Other vertebrate sequence entries, part 365.
5948. gbvrt366.seq - Other vertebrate sequence entries, part 366.
5949. gbvrt367.seq - Other vertebrate sequence entries, part 367.
5950. gbvrt368.seq - Other vertebrate sequence entries, part 368.
5951. gbvrt369.seq - Other vertebrate sequence entries, part 369.
5952. gbvrt37.seq - Other vertebrate sequence entries, part 37.
5953. gbvrt370.seq - Other vertebrate sequence entries, part 370.
5954. gbvrt371.seq - Other vertebrate sequence entries, part 371.
5955. gbvrt372.seq - Other vertebrate sequence entries, part 372.
5956. gbvrt373.seq - Other vertebrate sequence entries, part 373.
5957. gbvrt374.seq - Other vertebrate sequence entries, part 374.
5958. gbvrt375.seq - Other vertebrate sequence entries, part 375.
5959. gbvrt376.seq - Other vertebrate sequence entries, part 376.
5960. gbvrt377.seq - Other vertebrate sequence entries, part 377.
5961. gbvrt378.seq - Other vertebrate sequence entries, part 378.
5962. gbvrt379.seq - Other vertebrate sequence entries, part 379.
5963. gbvrt38.seq - Other vertebrate sequence entries, part 38.
5964. gbvrt380.seq - Other vertebrate sequence entries, part 380.
5965. gbvrt381.seq - Other vertebrate sequence entries, part 381.
5966. gbvrt382.seq - Other vertebrate sequence entries, part 382.
5967. gbvrt383.seq - Other vertebrate sequence entries, part 383.
5968. gbvrt384.seq - Other vertebrate sequence entries, part 384.
5969. gbvrt385.seq - Other vertebrate sequence entries, part 385.
5970. gbvrt386.seq - Other vertebrate sequence entries, part 386.
5971. gbvrt387.seq - Other vertebrate sequence entries, part 387.
5972. gbvrt388.seq - Other vertebrate sequence entries, part 388.
5973. gbvrt389.seq - Other vertebrate sequence entries, part 389.
5974. gbvrt39.seq - Other vertebrate sequence entries, part 39.
5975. gbvrt390.seq - Other vertebrate sequence entries, part 390.
5976. gbvrt391.seq - Other vertebrate sequence entries, part 391.
5977. gbvrt392.seq - Other vertebrate sequence entries, part 392.
5978. gbvrt393.seq - Other vertebrate sequence entries, part 393.
5979. gbvrt394.seq - Other vertebrate sequence entries, part 394.
5980. gbvrt395.seq - Other vertebrate sequence entries, part 395.
5981. gbvrt396.seq - Other vertebrate sequence entries, part 396.
5982. gbvrt397.seq - Other vertebrate sequence entries, part 397.
5983. gbvrt398.seq - Other vertebrate sequence entries, part 398.
5984. gbvrt399.seq - Other vertebrate sequence entries, part 399.
5985. gbvrt4.seq - Other vertebrate sequence entries, part 4.
5986. gbvrt40.seq - Other vertebrate sequence entries, part 40.
5987. gbvrt400.seq - Other vertebrate sequence entries, part 400.
5988. gbvrt401.seq - Other vertebrate sequence entries, part 401.
5989. gbvrt402.seq - Other vertebrate sequence entries, part 402.
5990. gbvrt403.seq - Other vertebrate sequence entries, part 403.
5991. gbvrt404.seq - Other vertebrate sequence entries, part 404.
5992. gbvrt405.seq - Other vertebrate sequence entries, part 405.
5993. gbvrt406.seq - Other vertebrate sequence entries, part 406.
5994. gbvrt407.seq - Other vertebrate sequence entries, part 407.
5995. gbvrt408.seq - Other vertebrate sequence entries, part 408.
5996. gbvrt409.seq - Other vertebrate sequence entries, part 409.
5997. gbvrt41.seq - Other vertebrate sequence entries, part 41.
5998. gbvrt410.seq - Other vertebrate sequence entries, part 410.
5999. gbvrt411.seq - Other vertebrate sequence entries, part 411.
6000. gbvrt412.seq - Other vertebrate sequence entries, part 412.
6001. gbvrt413.seq - Other vertebrate sequence entries, part 413.
6002. gbvrt414.seq - Other vertebrate sequence entries, part 414.
6003. gbvrt415.seq - Other vertebrate sequence entries, part 415.
6004. gbvrt416.seq - Other vertebrate sequence entries, part 416.
6005. gbvrt417.seq - Other vertebrate sequence entries, part 417.
6006. gbvrt418.seq - Other vertebrate sequence entries, part 418.
6007. gbvrt419.seq - Other vertebrate sequence entries, part 419.
6008. gbvrt42.seq - Other vertebrate sequence entries, part 42.
6009. gbvrt420.seq - Other vertebrate sequence entries, part 420.
6010. gbvrt421.seq - Other vertebrate sequence entries, part 421.
6011. gbvrt422.seq - Other vertebrate sequence entries, part 422.
6012. gbvrt423.seq - Other vertebrate sequence entries, part 423.
6013. gbvrt424.seq - Other vertebrate sequence entries, part 424.
6014. gbvrt425.seq - Other vertebrate sequence entries, part 425.
6015. gbvrt426.seq - Other vertebrate sequence entries, part 426.
6016. gbvrt427.seq - Other vertebrate sequence entries, part 427.
6017. gbvrt428.seq - Other vertebrate sequence entries, part 428.
6018. gbvrt429.seq - Other vertebrate sequence entries, part 429.
6019. gbvrt43.seq - Other vertebrate sequence entries, part 43.
6020. gbvrt430.seq - Other vertebrate sequence entries, part 430.
6021. gbvrt431.seq - Other vertebrate sequence entries, part 431.
6022. gbvrt432.seq - Other vertebrate sequence entries, part 432.
6023. gbvrt433.seq - Other vertebrate sequence entries, part 433.
6024. gbvrt434.seq - Other vertebrate sequence entries, part 434.
6025. gbvrt435.seq - Other vertebrate sequence entries, part 435.
6026. gbvrt436.seq - Other vertebrate sequence entries, part 436.
6027. gbvrt437.seq - Other vertebrate sequence entries, part 437.
6028. gbvrt438.seq - Other vertebrate sequence entries, part 438.
6029. gbvrt439.seq - Other vertebrate sequence entries, part 439.
6030. gbvrt44.seq - Other vertebrate sequence entries, part 44.
6031. gbvrt440.seq - Other vertebrate sequence entries, part 440.
6032. gbvrt441.seq - Other vertebrate sequence entries, part 441.
6033. gbvrt442.seq - Other vertebrate sequence entries, part 442.
6034. gbvrt443.seq - Other vertebrate sequence entries, part 443.
6035. gbvrt444.seq - Other vertebrate sequence entries, part 444.
6036. gbvrt445.seq - Other vertebrate sequence entries, part 445.
6037. gbvrt446.seq - Other vertebrate sequence entries, part 446.
6038. gbvrt447.seq - Other vertebrate sequence entries, part 447.
6039. gbvrt448.seq - Other vertebrate sequence entries, part 448.
6040. gbvrt449.seq - Other vertebrate sequence entries, part 449.
6041. gbvrt45.seq - Other vertebrate sequence entries, part 45.
6042. gbvrt450.seq - Other vertebrate sequence entries, part 450.
6043. gbvrt451.seq - Other vertebrate sequence entries, part 451.
6044. gbvrt452.seq - Other vertebrate sequence entries, part 452.
6045. gbvrt453.seq - Other vertebrate sequence entries, part 453.
6046. gbvrt454.seq - Other vertebrate sequence entries, part 454.
6047. gbvrt455.seq - Other vertebrate sequence entries, part 455.
6048. gbvrt456.seq - Other vertebrate sequence entries, part 456.
6049. gbvrt457.seq - Other vertebrate sequence entries, part 457.
6050. gbvrt458.seq - Other vertebrate sequence entries, part 458.
6051. gbvrt46.seq - Other vertebrate sequence entries, part 46.
6052. gbvrt47.seq - Other vertebrate sequence entries, part 47.
6053. gbvrt48.seq - Other vertebrate sequence entries, part 48.
6054. gbvrt49.seq - Other vertebrate sequence entries, part 49.
6055. gbvrt5.seq - Other vertebrate sequence entries, part 5.
6056. gbvrt50.seq - Other vertebrate sequence entries, part 50.
6057. gbvrt51.seq - Other vertebrate sequence entries, part 51.
6058. gbvrt52.seq - Other vertebrate sequence entries, part 52.
6059. gbvrt53.seq - Other vertebrate sequence entries, part 53.
6060. gbvrt54.seq - Other vertebrate sequence entries, part 54.
6061. gbvrt55.seq - Other vertebrate sequence entries, part 55.
6062. gbvrt56.seq - Other vertebrate sequence entries, part 56.
6063. gbvrt57.seq - Other vertebrate sequence entries, part 57.
6064. gbvrt58.seq - Other vertebrate sequence entries, part 58.
6065. gbvrt59.seq - Other vertebrate sequence entries, part 59.
6066. gbvrt6.seq - Other vertebrate sequence entries, part 6.
6067. gbvrt60.seq - Other vertebrate sequence entries, part 60.
6068. gbvrt61.seq - Other vertebrate sequence entries, part 61.
6069. gbvrt62.seq - Other vertebrate sequence entries, part 62.
6070. gbvrt63.seq - Other vertebrate sequence entries, part 63.
6071. gbvrt64.seq - Other vertebrate sequence entries, part 64.
6072. gbvrt65.seq - Other vertebrate sequence entries, part 65.
6073. gbvrt66.seq - Other vertebrate sequence entries, part 66.
6074. gbvrt67.seq - Other vertebrate sequence entries, part 67.
6075. gbvrt68.seq - Other vertebrate sequence entries, part 68.
6076. gbvrt69.seq - Other vertebrate sequence entries, part 69.
6077. gbvrt7.seq - Other vertebrate sequence entries, part 7.
6078. gbvrt70.seq - Other vertebrate sequence entries, part 70.
6079. gbvrt71.seq - Other vertebrate sequence entries, part 71.
6080. gbvrt72.seq - Other vertebrate sequence entries, part 72.
6081. gbvrt73.seq - Other vertebrate sequence entries, part 73.
6082. gbvrt74.seq - Other vertebrate sequence entries, part 74.
6083. gbvrt75.seq - Other vertebrate sequence entries, part 75.
6084. gbvrt76.seq - Other vertebrate sequence entries, part 76.
6085. gbvrt77.seq - Other vertebrate sequence entries, part 77.
6086. gbvrt78.seq - Other vertebrate sequence entries, part 78.
6087. gbvrt79.seq - Other vertebrate sequence entries, part 79.
6088. gbvrt8.seq - Other vertebrate sequence entries, part 8.
6089. gbvrt80.seq - Other vertebrate sequence entries, part 80.
6090. gbvrt81.seq - Other vertebrate sequence entries, part 81.
6091. gbvrt82.seq - Other vertebrate sequence entries, part 82.
6092. gbvrt83.seq - Other vertebrate sequence entries, part 83.
6093. gbvrt84.seq - Other vertebrate sequence entries, part 84.
6094. gbvrt85.seq - Other vertebrate sequence entries, part 85.
6095. gbvrt86.seq - Other vertebrate sequence entries, part 86.
6096. gbvrt87.seq - Other vertebrate sequence entries, part 87.
6097. gbvrt88.seq - Other vertebrate sequence entries, part 88.
6098. gbvrt89.seq - Other vertebrate sequence entries, part 89.
6099. gbvrt9.seq - Other vertebrate sequence entries, part 9.
6100. gbvrt90.seq - Other vertebrate sequence entries, part 90.
6101. gbvrt91.seq - Other vertebrate sequence entries, part 91.
6102. gbvrt92.seq - Other vertebrate sequence entries, part 92.
6103. gbvrt93.seq - Other vertebrate sequence entries, part 93.
6104. gbvrt94.seq - Other vertebrate sequence entries, part 94.
6105. gbvrt95.seq - Other vertebrate sequence entries, part 95.
6106. gbvrt96.seq - Other vertebrate sequence entries, part 96.
6107. gbvrt97.seq - Other vertebrate sequence entries, part 97.
6108. gbvrt98.seq - Other vertebrate sequence entries, part 98.
6109. gbvrt99.seq - Other vertebrate sequence entries, part 99.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 268.0 flatfiles require roughly 8262 GB,
including the sequence files and the *.txt files.
The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1499984560 gbbct1.seq
1495472321 gbbct10.seq
1492186316 gbbct100.seq
1490598464 gbbct101.seq
1499230123 gbbct102.seq
1495980242 gbbct103.seq
1498125499 gbbct104.seq
1498766772 gbbct105.seq
1494801607 gbbct106.seq
1495509393 gbbct107.seq
1493439191 gbbct108.seq
1491178936 gbbct109.seq
1496137252 gbbct11.seq
1498471989 gbbct110.seq
1492170429 gbbct111.seq
1499006289 gbbct112.seq
1494884567 gbbct113.seq
1496705323 gbbct114.seq
1499652215 gbbct115.seq
1499796345 gbbct116.seq
1492875694 gbbct117.seq
1496041701 gbbct118.seq
1496321654 gbbct119.seq
1494311859 gbbct12.seq
1496867155 gbbct120.seq
1496193363 gbbct121.seq
1495271258 gbbct122.seq
1499988871 gbbct123.seq
1497168568 gbbct124.seq
1497187964 gbbct125.seq
1498479920 gbbct126.seq
1495650314 gbbct127.seq
1493667493 gbbct128.seq
1491530260 gbbct129.seq
1499875922 gbbct13.seq
1499532882 gbbct130.seq
1491767288 gbbct131.seq
1497041827 gbbct132.seq
1498881845 gbbct133.seq
1494629917 gbbct134.seq
1498280634 gbbct135.seq
1489319276 gbbct136.seq
1499807011 gbbct137.seq
1489934625 gbbct138.seq
1499763883 gbbct139.seq
1494501816 gbbct14.seq
1488373829 gbbct140.seq
1497095235 gbbct141.seq
1497177841 gbbct142.seq
1499719530 gbbct143.seq
1491505863 gbbct144.seq
1498894576 gbbct145.seq
1491140964 gbbct146.seq
1488077710 gbbct147.seq
1491801826 gbbct148.seq
1494358857 gbbct149.seq
1496554052 gbbct15.seq
1498056236 gbbct150.seq
1496384245 gbbct151.seq
1491421611 gbbct152.seq
1485696877 gbbct153.seq
1498915441 gbbct154.seq
1496987929 gbbct155.seq
1492937969 gbbct156.seq
1498119333 gbbct157.seq
1492440957 gbbct158.seq
1496970040 gbbct159.seq
1496090658 gbbct16.seq
1495234779 gbbct160.seq
1494311640 gbbct161.seq
1489829240 gbbct162.seq
1491651445 gbbct163.seq
1495892965 gbbct164.seq
1492502074 gbbct165.seq
1497812235 gbbct166.seq
1498231297 gbbct167.seq
1499175285 gbbct168.seq
1494991806 gbbct169.seq
1496780997 gbbct17.seq
1489572710 gbbct170.seq
1495187904 gbbct171.seq
1495174873 gbbct172.seq
1497214729 gbbct173.seq
1493291136 gbbct174.seq
1490870866 gbbct175.seq
1495154238 gbbct176.seq
1488398553 gbbct177.seq
1495253531 gbbct178.seq
1499187410 gbbct179.seq
1490048949 gbbct18.seq
1486538105 gbbct180.seq
1494523727 gbbct181.seq
1499548044 gbbct182.seq
1492350786 gbbct183.seq
1496937587 gbbct184.seq
1499925578 gbbct185.seq
1498555192 gbbct186.seq
1498796616 gbbct187.seq
1494418582 gbbct188.seq
1496445738 gbbct189.seq
1498534483 gbbct19.seq
1497981441 gbbct190.seq
1496983635 gbbct191.seq
1497807611 gbbct192.seq
1495292576 gbbct193.seq
1493353798 gbbct194.seq
1496970186 gbbct195.seq
1490944643 gbbct196.seq
1489008932 gbbct197.seq
1498029839 gbbct198.seq
1498917239 gbbct199.seq
1497363900 gbbct2.seq
1499675168 gbbct20.seq
1498180642 gbbct200.seq
1496301426 gbbct201.seq
1498512003 gbbct202.seq
1492889076 gbbct203.seq
1498735144 gbbct204.seq
1499121103 gbbct205.seq
1495872571 gbbct206.seq
1491828062 gbbct207.seq
1491884328 gbbct208.seq
1499672207 gbbct209.seq
1495045247 gbbct21.seq
1495916491 gbbct210.seq
1493613516 gbbct211.seq
1488458170 gbbct212.seq
1499295875 gbbct213.seq
1493394553 gbbct214.seq
1498467286 gbbct215.seq
1486883452 gbbct216.seq
1499618097 gbbct217.seq
1496431230 gbbct218.seq
1489971502 gbbct219.seq
1499335107 gbbct22.seq
1499720622 gbbct220.seq
1494963543 gbbct221.seq
1486681249 gbbct222.seq
1492423444 gbbct223.seq
1487831829 gbbct224.seq
1499217684 gbbct225.seq
1487670087 gbbct226.seq
1497568921 gbbct227.seq
1490133787 gbbct228.seq
1497191667 gbbct229.seq
1497800100 gbbct23.seq
1487036978 gbbct230.seq
1495827509 gbbct231.seq
1499535144 gbbct232.seq
1497108697 gbbct233.seq
1491554580 gbbct234.seq
1497755491 gbbct235.seq
1491527137 gbbct236.seq
1492863620 gbbct237.seq
1484603251 gbbct238.seq
1495918609 gbbct239.seq
1495724597 gbbct24.seq
1498546050 gbbct240.seq
1494389181 gbbct241.seq
1497782049 gbbct242.seq
1495178799 gbbct243.seq
1499895316 gbbct244.seq
1490911752 gbbct245.seq
1499616958 gbbct246.seq
1494322825 gbbct247.seq
1488838675 gbbct248.seq
1497726902 gbbct249.seq
1497127627 gbbct25.seq
1496424603 gbbct250.seq
1494183128 gbbct251.seq
1492428524 gbbct252.seq
1498409739 gbbct253.seq
1499073874 gbbct254.seq
1496604717 gbbct255.seq
1499991995 gbbct256.seq
1499359041 gbbct257.seq
1493541208 gbbct258.seq
1497624336 gbbct259.seq
1490345444 gbbct26.seq
1492737338 gbbct260.seq
1498081189 gbbct261.seq
1498367507 gbbct262.seq
1492248990 gbbct263.seq
1485806061 gbbct264.seq
1490958812 gbbct265.seq
1486180912 gbbct266.seq
1495582526 gbbct267.seq
1498026202 gbbct268.seq
1495337281 gbbct269.seq
1499083540 gbbct27.seq
1493560110 gbbct270.seq
1494242854 gbbct271.seq
1489883351 gbbct272.seq
1491412024 gbbct273.seq
1482710760 gbbct274.seq
1486430677 gbbct275.seq
1494814562 gbbct276.seq
1499978785 gbbct277.seq
1491103082 gbbct278.seq
1496444499 gbbct279.seq
1497193307 gbbct28.seq
1496651842 gbbct280.seq
1499939271 gbbct281.seq
1492306345 gbbct282.seq
1496726397 gbbct283.seq
1490049608 gbbct284.seq
1486646483 gbbct285.seq
1495464992 gbbct286.seq
1496984490 gbbct287.seq
1498596492 gbbct288.seq
1493170180 gbbct289.seq
1493774482 gbbct29.seq
1493691339 gbbct290.seq
1497599559 gbbct291.seq
1486457203 gbbct292.seq
1494996389 gbbct293.seq
1496249792 gbbct294.seq
1497569950 gbbct295.seq
1489268946 gbbct296.seq
1494739680 gbbct297.seq
1482510780 gbbct298.seq
1495161376 gbbct299.seq
1494620558 gbbct3.seq
1498949262 gbbct30.seq
1498648359 gbbct300.seq
1491748149 gbbct301.seq
1495648754 gbbct302.seq
1494085482 gbbct303.seq
1494734420 gbbct304.seq
1491522275 gbbct305.seq
1496255795 gbbct306.seq
1496773085 gbbct307.seq
1489975617 gbbct308.seq
1491508450 gbbct309.seq
1499054698 gbbct31.seq
1497268970 gbbct310.seq
1499368234 gbbct311.seq
1496265699 gbbct312.seq
1497195209 gbbct313.seq
1493035125 gbbct314.seq
1487197314 gbbct315.seq
1490736070 gbbct316.seq
1497386027 gbbct317.seq
1492153301 gbbct318.seq
1497806655 gbbct319.seq
1496646516 gbbct32.seq
1493383149 gbbct320.seq
1495607390 gbbct321.seq
1498610055 gbbct322.seq
1494412332 gbbct323.seq
1496667279 gbbct324.seq
1493170377 gbbct325.seq
1498796377 gbbct326.seq
1496343216 gbbct327.seq
1492626861 gbbct328.seq
1493539111 gbbct329.seq
1496285390 gbbct33.seq
1490737365 gbbct330.seq
1497195981 gbbct331.seq
1499994745 gbbct332.seq
1493778967 gbbct333.seq
1488165917 gbbct334.seq
1491238885 gbbct335.seq
1497857048 gbbct336.seq
1495761823 gbbct337.seq
1487591764 gbbct338.seq
1493496379 gbbct339.seq
1492711864 gbbct34.seq
1488138888 gbbct340.seq
1490088318 gbbct341.seq
1490072913 gbbct342.seq
1495276235 gbbct343.seq
1499427992 gbbct344.seq
1493445836 gbbct345.seq
1499991564 gbbct346.seq
1499881897 gbbct347.seq
1497958608 gbbct348.seq
1494405425 gbbct349.seq
1497474642 gbbct35.seq
1496126430 gbbct350.seq
1496735974 gbbct351.seq
1499285825 gbbct352.seq
1489033380 gbbct353.seq
1494719941 gbbct354.seq
1492838095 gbbct355.seq
1499947873 gbbct356.seq
1474548719 gbbct357.seq
1494749041 gbbct358.seq
1498667695 gbbct359.seq
1497925886 gbbct36.seq
1497838185 gbbct360.seq
1497256508 gbbct361.seq
1497334962 gbbct362.seq
1492148112 gbbct363.seq
1489704722 gbbct364.seq
1490988999 gbbct365.seq
1487944046 gbbct366.seq
1488071117 gbbct367.seq
1499842081 gbbct368.seq
1496427032 gbbct369.seq
1490918268 gbbct37.seq
1497316877 gbbct370.seq
1492051332 gbbct371.seq
1493422588 gbbct372.seq
1495633286 gbbct373.seq
1494534019 gbbct374.seq
1497314610 gbbct375.seq
1495155872 gbbct376.seq
1496856258 gbbct377.seq
1497365929 gbbct378.seq
1493908514 gbbct379.seq
1494110265 gbbct38.seq
1499353578 gbbct380.seq
1491476481 gbbct381.seq
1496970276 gbbct382.seq
1488708375 gbbct383.seq
1496210641 gbbct384.seq
1497844900 gbbct385.seq
1488566253 gbbct386.seq
1494438973 gbbct387.seq
1499765626 gbbct388.seq
1499405498 gbbct389.seq
1496623927 gbbct39.seq
1493482848 gbbct390.seq
1496965073 gbbct391.seq
1496579084 gbbct392.seq
1495519634 gbbct393.seq
1490329250 gbbct394.seq
1495489877 gbbct395.seq
1495680527 gbbct396.seq
1494807873 gbbct397.seq
1498771835 gbbct398.seq
1490792623 gbbct399.seq
1496232874 gbbct4.seq
1499983467 gbbct40.seq
1490600443 gbbct400.seq
1494474704 gbbct401.seq
1498780482 gbbct402.seq
1497604196 gbbct403.seq
1493850210 gbbct404.seq
1481191299 gbbct405.seq
1491460950 gbbct406.seq
1496290165 gbbct407.seq
1495025225 gbbct408.seq
1491001715 gbbct409.seq
1496963268 gbbct41.seq
1499223788 gbbct410.seq
1491011107 gbbct411.seq
1499420798 gbbct412.seq
1493176363 gbbct413.seq
1494020269 gbbct414.seq
1492827721 gbbct415.seq
1493734686 gbbct416.seq
1498518753 gbbct417.seq
1497578371 gbbct418.seq
1495149261 gbbct419.seq
1493215185 gbbct42.seq
1499221250 gbbct420.seq
1497002657 gbbct421.seq
1492623588 gbbct422.seq
1498028251 gbbct423.seq
1491116096 gbbct424.seq
1497605218 gbbct425.seq
1499772695 gbbct426.seq
1497637651 gbbct427.seq
1495187867 gbbct428.seq
1495956476 gbbct429.seq
1493882399 gbbct43.seq
1490230181 gbbct430.seq
1490147668 gbbct431.seq
1492271881 gbbct432.seq
1491039402 gbbct433.seq
1486539262 gbbct434.seq
1499197134 gbbct435.seq
1489628781 gbbct436.seq
1487819912 gbbct437.seq
1497305174 gbbct438.seq
1485613878 gbbct439.seq
1491161731 gbbct44.seq
1496940798 gbbct440.seq
1496277693 gbbct441.seq
1493274045 gbbct442.seq
1500000243 gbbct443.seq
1493734461 gbbct444.seq
1498050311 gbbct445.seq
1488107979 gbbct446.seq
1499999192 gbbct447.seq
1499999400 gbbct448.seq
1499727034 gbbct449.seq
1499629930 gbbct45.seq
1498202122 gbbct450.seq
1492775840 gbbct451.seq
1499642162 gbbct452.seq
1499237759 gbbct453.seq
1497743259 gbbct454.seq
1497171936 gbbct455.seq
1489601640 gbbct456.seq
1499612758 gbbct457.seq
1498645857 gbbct458.seq
1495548648 gbbct459.seq
1495384023 gbbct46.seq
1499346385 gbbct460.seq
1499990257 gbbct461.seq
1499997509 gbbct462.seq
1500000122 gbbct463.seq
1490415955 gbbct464.seq
1491791988 gbbct465.seq
1496733348 gbbct466.seq
1492259744 gbbct467.seq
1499950098 gbbct468.seq
1495034677 gbbct469.seq
1497051459 gbbct47.seq
1499237430 gbbct470.seq
1497730791 gbbct471.seq
1496253315 gbbct472.seq
1497253682 gbbct473.seq
1499686964 gbbct474.seq
1497447509 gbbct475.seq
1499998995 gbbct476.seq
608315742 gbbct477.seq
1497024612 gbbct48.seq
1494882912 gbbct49.seq
1493309366 gbbct5.seq
1490705271 gbbct50.seq
1499157517 gbbct51.seq
1497619684 gbbct52.seq
1491029552 gbbct53.seq
1498690375 gbbct54.seq
1495343955 gbbct55.seq
1498515274 gbbct56.seq
1495271519 gbbct57.seq
1495763994 gbbct58.seq
1498279584 gbbct59.seq
1491762353 gbbct6.seq
1489115269 gbbct60.seq
1495927159 gbbct61.seq
1491384013 gbbct62.seq
1492310336 gbbct63.seq
1491054829 gbbct64.seq
1495271002 gbbct65.seq
1498431890 gbbct66.seq
1492922731 gbbct67.seq
1492468742 gbbct68.seq
1492804393 gbbct69.seq
1499267435 gbbct7.seq
1496794332 gbbct70.seq
1494455493 gbbct71.seq
1488402359 gbbct72.seq
1499893324 gbbct73.seq
1491372508 gbbct74.seq
1499928983 gbbct75.seq
1495739713 gbbct76.seq
1493996214 gbbct77.seq
1497911151 gbbct78.seq
1498476151 gbbct79.seq
1483660719 gbbct8.seq
1497864624 gbbct80.seq
1484523609 gbbct81.seq
1499329339 gbbct82.seq
1488641240 gbbct83.seq
1498608373 gbbct84.seq
1493411904 gbbct85.seq
1498371534 gbbct86.seq
1495447051 gbbct87.seq
1498333003 gbbct88.seq
1494474584 gbbct89.seq
1495264266 gbbct9.seq
1491546189 gbbct90.seq
1493206748 gbbct91.seq
1491505227 gbbct92.seq
1489571072 gbbct93.seq
1498665498 gbbct94.seq
1490148428 gbbct95.seq
1499275729 gbbct96.seq
1494097621 gbbct97.seq
1496257685 gbbct98.seq
1499125955 gbbct99.seq
332765 gbchg.txt
1499998637 gbcon1.seq
1499995552 gbcon10.seq
1499994247 gbcon11.seq
1499997417 gbcon12.seq
1499995758 gbcon13.seq
1499997459 gbcon14.seq
1500000124 gbcon15.seq
1499999839 gbcon16.seq
1499997708 gbcon17.seq
1499999181 gbcon18.seq
1499994870 gbcon19.seq
1496697845 gbcon2.seq
1499996277 gbcon20.seq
1499998649 gbcon21.seq
1500000215 gbcon22.seq
1499930893 gbcon23.seq
1499995540 gbcon24.seq
1499999742 gbcon25.seq
1499950334 gbcon26.seq
1499969648 gbcon27.seq
1499595463 gbcon28.seq
1499965347 gbcon29.seq
1499647437 gbcon3.seq
1499989036 gbcon30.seq
1499997547 gbcon31.seq
1499997879 gbcon32.seq
1499998966 gbcon33.seq
1499989639 gbcon34.seq
1499999669 gbcon35.seq
1499995739 gbcon36.seq
1499986480 gbcon37.seq
1499997152 gbcon38.seq
1499998914 gbcon39.seq
1498890812 gbcon4.seq
1499997679 gbcon40.seq
1499999859 gbcon41.seq
1499999956 gbcon42.seq
1499998389 gbcon43.seq
1499994449 gbcon44.seq
1499965907 gbcon45.seq
1499998199 gbcon46.seq
1499998587 gbcon47.seq
1499875098 gbcon48.seq
1498942200 gbcon49.seq
1495900336 gbcon5.seq
1499995478 gbcon50.seq
1499999961 gbcon51.seq
1499995178 gbcon52.seq
1499998527 gbcon53.seq
1499998109 gbcon54.seq
1499997580 gbcon55.seq
1499998960 gbcon56.seq
1499999117 gbcon57.seq
1499971935 gbcon58.seq
1499998077 gbcon59.seq
1499103157 gbcon6.seq
1499912194 gbcon60.seq
1499966698 gbcon61.seq
1499996958 gbcon62.seq
1499844367 gbcon63.seq
1499978466 gbcon64.seq
1499996350 gbcon65.seq
1499916104 gbcon66.seq
1499996257 gbcon67.seq
1072879055 gbcon68.seq
1499997687 gbcon7.seq
1499999936 gbcon8.seq
1497877233 gbcon9.seq
17237 gbdel.txt
1499994731 gbenv1.seq
1499998290 gbenv10.seq
1499998773 gbenv11.seq
1499998546 gbenv12.seq
1499999581 gbenv13.seq
1499999812 gbenv14.seq
1499998528 gbenv15.seq
1499997836 gbenv16.seq
1499998766 gbenv17.seq
1499998637 gbenv18.seq
1499999207 gbenv19.seq
1498808070 gbenv2.seq
1500000225 gbenv20.seq
1499998967 gbenv21.seq
1499976475 gbenv22.seq
1499980955 gbenv23.seq
1498530411 gbenv24.seq
1497338155 gbenv25.seq
1496307368 gbenv26.seq
1492212845 gbenv27.seq
1498130747 gbenv28.seq
1492854673 gbenv29.seq
1498236518 gbenv3.seq
1496981354 gbenv30.seq
1497642532 gbenv31.seq
1494704586 gbenv32.seq
1498628945 gbenv33.seq
1498355821 gbenv34.seq
1495926930 gbenv35.seq
1494320818 gbenv36.seq
1497483025 gbenv37.seq
1499996558 gbenv38.seq
168893794 gbenv39.seq
1498555886 gbenv4.seq
1490162377 gbenv5.seq
1499999749 gbenv6.seq
1499997855 gbenv7.seq
1499999468 gbenv8.seq
1499998846 gbenv9.seq
1500000031 gbest1.seq
1499997324 gbest10.seq
1499997815 gbest100.seq
1499999009 gbest101.seq
1499999617 gbest102.seq
1499999501 gbest103.seq
1499999530 gbest104.seq
1499996311 gbest105.seq
1499997389 gbest106.seq
1500000178 gbest107.seq
1499996527 gbest108.seq
1499999301 gbest109.seq
1499999215 gbest11.seq
1499999170 gbest110.seq
1499999715 gbest111.seq
1499995389 gbest112.seq
1499999025 gbest113.seq
1499998616 gbest114.seq
1499998482 gbest115.seq
1499999109 gbest116.seq
1499998348 gbest117.seq
1499998188 gbest118.seq
1499999180 gbest119.seq
1499997259 gbest12.seq
1499998636 gbest120.seq
1499998051 gbest121.seq
1499999155 gbest122.seq
1499998685 gbest123.seq
1499999098 gbest124.seq
1499998474 gbest125.seq
1499997699 gbest126.seq
1499999132 gbest127.seq
1499997718 gbest128.seq
1499997370 gbest129.seq
1499995644 gbest13.seq
1499998053 gbest130.seq
1499998679 gbest131.seq
1499999247 gbest132.seq
1499996956 gbest133.seq
1499997887 gbest134.seq
1499996640 gbest135.seq
1499997786 gbest136.seq
1499997978 gbest137.seq
1499997708 gbest138.seq
1499999080 gbest139.seq
1499999906 gbest14.seq
1499998072 gbest140.seq
1499998061 gbest141.seq
1499999287 gbest142.seq
1500000009 gbest143.seq
1499997542 gbest144.seq
1499997957 gbest145.seq
1499999469 gbest146.seq
1499999321 gbest147.seq
1499998494 gbest148.seq
1499998881 gbest149.seq
1499998121 gbest15.seq
1499996656 gbest150.seq
1499999059 gbest151.seq
1499999765 gbest152.seq
1499998940 gbest153.seq
1499998264 gbest154.seq
1499998724 gbest155.seq
1499998226 gbest156.seq
1499998292 gbest157.seq
1499998713 gbest158.seq
1499998783 gbest159.seq
1500000017 gbest16.seq
1499999496 gbest160.seq
1499999362 gbest161.seq
1499998655 gbest162.seq
1499998053 gbest163.seq
554908505 gbest164.seq
1499999872 gbest17.seq
1499998382 gbest18.seq
1499996880 gbest19.seq
1499998895 gbest2.seq
1499997998 gbest20.seq
1499999570 gbest21.seq
1499997336 gbest22.seq
1499997689 gbest23.seq
1499999016 gbest24.seq
1499996201 gbest25.seq
1499998137 gbest26.seq
1499998809 gbest27.seq
1499999304 gbest28.seq
1499999130 gbest29.seq
1499998888 gbest3.seq
1499998133 gbest30.seq
1499996913 gbest31.seq
1499996706 gbest32.seq
1499998216 gbest33.seq
1499999400 gbest34.seq
1499999445 gbest35.seq
1499995691 gbest36.seq
1499995611 gbest37.seq
1499994776 gbest38.seq
1499998239 gbest39.seq
1499999256 gbest4.seq
1499998026 gbest40.seq
1499997515 gbest41.seq
1499998363 gbest42.seq
1499998766 gbest43.seq
1499998202 gbest44.seq
1499997896 gbest45.seq
1499996645 gbest46.seq
1500000233 gbest47.seq
1499996434 gbest48.seq
1499997067 gbest49.seq
1499999079 gbest5.seq
1499998551 gbest50.seq
1499999520 gbest51.seq
1499999829 gbest52.seq
1499999722 gbest53.seq
1500000056 gbest54.seq
1499996252 gbest55.seq
1499998596 gbest56.seq
1499997181 gbest57.seq
1499998610 gbest58.seq
1499998524 gbest59.seq
1499999451 gbest6.seq
1499999422 gbest60.seq
1499998391 gbest61.seq
1499999926 gbest62.seq
1499997604 gbest63.seq
1499997847 gbest64.seq
1499999994 gbest65.seq
1499998755 gbest66.seq
1499997642 gbest67.seq
1500000086 gbest68.seq
1499998838 gbest69.seq
1499998812 gbest7.seq
1499999250 gbest70.seq
1499998455 gbest71.seq
1499997797 gbest72.seq
1499998095 gbest73.seq
1499998169 gbest74.seq
1499998691 gbest75.seq
1499999618 gbest76.seq
1499999889 gbest77.seq
1499996893 gbest78.seq
1499998678 gbest79.seq
1499997018 gbest8.seq
1499999985 gbest80.seq
1499997778 gbest81.seq
1499999786 gbest82.seq
1499996832 gbest83.seq
1499996440 gbest84.seq
1499997555 gbest85.seq
1499999824 gbest86.seq
1499999300 gbest87.seq
1499999878 gbest88.seq
1499996761 gbest89.seq
1499998250 gbest9.seq
1500000037 gbest90.seq
1500000107 gbest91.seq
1499999190 gbest92.seq
1499998943 gbest93.seq
1499997372 gbest94.seq
1500000152 gbest95.seq
1500000257 gbest96.seq
1499998041 gbest97.seq
1499998891 gbest98.seq
1499998615 gbest99.seq
1499997449 gbgss1.seq
1499999271 gbgss10.seq
1499997369 gbgss11.seq
1499998524 gbgss12.seq
1499999676 gbgss13.seq
1499998110 gbgss14.seq
1499998064 gbgss15.seq
1499999690 gbgss16.seq
1499999196 gbgss17.seq
1499999916 gbgss18.seq
1499999940 gbgss19.seq
1499998491 gbgss2.seq
1499998322 gbgss20.seq
1499997591 gbgss21.seq
1500000155 gbgss22.seq
1499999725 gbgss23.seq
1499997946 gbgss24.seq
1499999982 gbgss25.seq
1499998447 gbgss26.seq
1499999451 gbgss27.seq
1499998434 gbgss28.seq
1499999225 gbgss29.seq
1499998108 gbgss3.seq
1499998603 gbgss30.seq
1499997630 gbgss31.seq
1499998115 gbgss32.seq
1499999460 gbgss33.seq
1499997902 gbgss34.seq
1499999378 gbgss35.seq
1499999466 gbgss36.seq
1499998324 gbgss37.seq
1499997978 gbgss38.seq
1499996801 gbgss39.seq
1499998556 gbgss4.seq
1499997852 gbgss40.seq
1499999332 gbgss41.seq
1499997496 gbgss42.seq
1499998476 gbgss43.seq
1499997741 gbgss44.seq
1499997861 gbgss45.seq
1499997597 gbgss46.seq
1499998962 gbgss47.seq
1499998042 gbgss48.seq
1500000141 gbgss49.seq
1499999953 gbgss5.seq
1500000136 gbgss50.seq
1499998321 gbgss51.seq
1499997851 gbgss52.seq
1499998175 gbgss53.seq
1499998972 gbgss54.seq
1499998243 gbgss55.seq
1500000050 gbgss56.seq
1499998977 gbgss57.seq
1499997566 gbgss58.seq
1499999819 gbgss59.seq
1499999533 gbgss6.seq
1499999779 gbgss60.seq
1499997652 gbgss61.seq
1499999193 gbgss62.seq
1499999892 gbgss63.seq
1499999096 gbgss64.seq
1499998593 gbgss65.seq
1499998892 gbgss66.seq
1499998008 gbgss67.seq
1499998635 gbgss68.seq
1499998693 gbgss69.seq
1499998044 gbgss7.seq
1499998797 gbgss70.seq
1499998289 gbgss71.seq
1499998172 gbgss72.seq
1499996985 gbgss73.seq
1499999027 gbgss74.seq
1499998672 gbgss75.seq
1499999988 gbgss76.seq
1499998760 gbgss77.seq
1499999764 gbgss78.seq
436211298 gbgss79.seq
1499999644 gbgss8.seq
1499998907 gbgss9.seq
1499996974 gbhtc1.seq
1499996390 gbhtc2.seq
487254300 gbhtc3.seq
1499970679 gbhtg1.seq
1499829019 gbhtg10.seq
1499872343 gbhtg11.seq
1499884544 gbhtg12.seq
1499861752 gbhtg13.seq
1499897929 gbhtg14.seq
1499835864 gbhtg15.seq
1499690417 gbhtg16.seq
1499782068 gbhtg17.seq
1499852826 gbhtg18.seq
1499876774 gbhtg19.seq
1499830411 gbhtg2.seq
1499945647 gbhtg20.seq
1499944255 gbhtg21.seq
1499865306 gbhtg22.seq
1499789537 gbhtg23.seq
1499905063 gbhtg24.seq
650087160 gbhtg25.seq
1499902231 gbhtg3.seq
1499865254 gbhtg4.seq
1499916236 gbhtg5.seq
1499781411 gbhtg6.seq
1499713912 gbhtg7.seq
1499983844 gbhtg8.seq
1499942611 gbhtg9.seq
1499999563 gbinv1.seq
1354823472 gbinv10.seq
1487918436 gbinv100.seq
1494300643 gbinv1000.se
1476560685 gbinv1001.se
1493651986 gbinv1002.se
1491625721 gbinv1003.se
1493052714 gbinv1004.se
1285774099 gbinv1005.se
1479044885 gbinv1006.se
1479367692 gbinv1007.se
1484467430 gbinv1008.se
1466108696 gbinv1009.se
1498003367 gbinv101.seq
1472271633 gbinv1010.se
1484402207 gbinv1011.se
1427493532 gbinv1012.se
1447654821 gbinv1013.se
1431344267 gbinv1014.se
1392749644 gbinv1015.se
1432849379 gbinv1016.se
1476125820 gbinv1017.se
1496916312 gbinv1018.se
1492379457 gbinv1019.se
1495227925 gbinv102.seq
1495516647 gbinv1020.se
1432410918 gbinv1021.se
1490957091 gbinv1022.se
1497776115 gbinv1023.se
1474094415 gbinv1024.se
1483485283 gbinv1025.se
1489015647 gbinv1026.se
1486341305 gbinv1027.se
1461701235 gbinv1028.se
1455407703 gbinv1029.se
1498962211 gbinv103.seq
1495927943 gbinv1030.se
1490196881 gbinv1031.se
1430008787 gbinv1032.se
1390832704 gbinv1033.se
1488087580 gbinv1034.se
1478129189 gbinv1035.se
1474974274 gbinv1036.se
1491109411 gbinv1037.se
1460337300 gbinv1038.se
1460866150 gbinv1039.se
1485607287 gbinv104.seq
1451249500 gbinv1040.se
1489800530 gbinv1041.se
1499364584 gbinv1042.se
1150320401 gbinv1043.se
1315284679 gbinv1044.se
1409661426 gbinv1045.se
1494949707 gbinv1046.se
1488814772 gbinv1047.se
1492061068 gbinv1048.se
1485571907 gbinv1049.se
1487531032 gbinv105.seq
1494680481 gbinv1050.se
1495516663 gbinv1051.se
1476904776 gbinv1052.se
1491484026 gbinv1053.se
1483135461 gbinv1054.se
1483754950 gbinv1055.se
1489668944 gbinv1056.se
327546674 gbinv1057.se
1643334397 gbinv1058.se
1640559275 gbinv1059.se
1489229116 gbinv106.seq
1497007454 gbinv1060.se
1472669410 gbinv1061.se
1257114488 gbinv1062.se
1158932125 gbinv1063.se
1091355196 gbinv1064.se
1482889800 gbinv1065.se
1494854446 gbinv1066.se
1495393792 gbinv1067.se
1495596370 gbinv1068.se
1478743656 gbinv1069.se
1465838102 gbinv107.seq
1479964443 gbinv1070.se
1212765581 gbinv1071.se
1264461979 gbinv1072.se
1472053163 gbinv1073.se
1483532093 gbinv1074.se
1485399397 gbinv1075.se
1434901281 gbinv1076.se
1403583746 gbinv1077.se
1490227316 gbinv1078.se
1317975738 gbinv1079.se
1486297182 gbinv108.seq
1496656117 gbinv1080.se
1491609400 gbinv1081.se
1481611223 gbinv1082.se
1464385911 gbinv1083.se
1450685747 gbinv1084.se
1419375364 gbinv1085.se
1414336778 gbinv1086.se
1351486974 gbinv1087.se
1461381661 gbinv1088.se
1265070008 gbinv1089.se
1499998971 gbinv109.seq
1251689262 gbinv1090.se
1370596003 gbinv1091.se
1415630556 gbinv1092.se
1498739889 gbinv1093.se
1481328324 gbinv1094.se
1494373166 gbinv1095.se
1494922448 gbinv1096.se
1492723877 gbinv1097.se
1489131629 gbinv1098.se
1465403766 gbinv1099.se
1498311433 gbinv11.seq
1499997172 gbinv110.seq
1469994715 gbinv1100.se
1450172733 gbinv1101.se
1481669545 gbinv1102.se
1477418601 gbinv1103.se
1491550356 gbinv1104.se
1244041503 gbinv1105.se
1443286248 gbinv1106.se
1403800753 gbinv1107.se
1446359437 gbinv1108.se
1465176532 gbinv1109.se
1499997757 gbinv111.seq
1465120471 gbinv1110.se
1484068083 gbinv1111.se
1439384822 gbinv1112.se
1327308913 gbinv1113.se
1286452134 gbinv1114.se
1496444292 gbinv1115.se
1491843682 gbinv1116.se
1422722267 gbinv1117.se
1472773744 gbinv1118.se
1495085585 gbinv1119.se
1499998286 gbinv112.seq
1292992446 gbinv1120.se
1445899680 gbinv1121.se
1446245772 gbinv1122.se
1340200919 gbinv1123.se
1362912583 gbinv1124.se
1324283236 gbinv1125.se
1457495121 gbinv1126.se
1461967722 gbinv1127.se
1490177222 gbinv1128.se
1477718507 gbinv1129.se
1500000221 gbinv113.seq
1494666571 gbinv1130.se
1479836112 gbinv1131.se
1479382225 gbinv1132.se
1493784304 gbinv1133.se
1482546933 gbinv1134.se
1401015157 gbinv1135.se
1455506781 gbinv1136.se
1465811843 gbinv1137.se
1497898873 gbinv1138.se
1466796462 gbinv1139.se
1499958678 gbinv114.seq
1238915429 gbinv1140.se
1152527672 gbinv1141.se
1269669110 gbinv1142.se
1480951873 gbinv1143.se
1494427169 gbinv1144.se
1497780961 gbinv1145.se
1455091737 gbinv1146.se
1375681802 gbinv1147.se
1406827194 gbinv1148.se
1443494255 gbinv1149.se
1499999240 gbinv115.seq
1357023602 gbinv1150.se
1454759015 gbinv1151.se
1495257525 gbinv1152.se
1476896098 gbinv1153.se
1425201979 gbinv1154.se
1477129819 gbinv1155.se
1404276101 gbinv1156.se
1485747820 gbinv1157.se
1482627542 gbinv1158.se
1319998827 gbinv1159.se
1499931031 gbinv116.seq
1492611676 gbinv1160.se
1340583488 gbinv1161.se
1429539129 gbinv1162.se
1459005293 gbinv1163.se
1465420397 gbinv1164.se
1261045403 gbinv1165.se
1363587930 gbinv1166.se
1462608059 gbinv1167.se
1435210244 gbinv1168.se
1496572989 gbinv1169.se
1499879312 gbinv117.seq
1437974355 gbinv1170.se
1498806211 gbinv1171.se
1480919335 gbinv1172.se
1495475172 gbinv1173.se
1488339071 gbinv1174.se
1471151062 gbinv1175.se
1366060537 gbinv1176.se
1445941149 gbinv1177.se
1492391663 gbinv1178.se
1489288446 gbinv1179.se
1499787928 gbinv118.seq
1487122956 gbinv1180.se
1495981376 gbinv1181.se
1482644286 gbinv1182.se
1487439372 gbinv1183.se
1457108026 gbinv1184.se
1409916986 gbinv1185.se
1447583444 gbinv1186.se
1453140153 gbinv1187.se
1478037356 gbinv1188.se
1493443384 gbinv1189.se
1499999306 gbinv119.seq
1469900859 gbinv1190.se
1445341824 gbinv1191.se
1309622567 gbinv1192.se
1445010783 gbinv1193.se
1439081425 gbinv1194.se
1288740402 gbinv1195.se
1305484709 gbinv1196.se
1440403114 gbinv1197.se
1276248329 gbinv1198.se
1435448615 gbinv1199.se
1478512284 gbinv12.seq
1499934572 gbinv120.seq
1304183309 gbinv1200.se
1464763162 gbinv1201.se
1475537671 gbinv1202.se
1497409029 gbinv1203.se
1490985424 gbinv1204.se
1496445451 gbinv1205.se
1459500940 gbinv1206.se
1456485611 gbinv1207.se
1486776177 gbinv1208.se
1499234261 gbinv1209.se
1499817913 gbinv121.seq
1494939326 gbinv1210.se
1474301350 gbinv1211.se
1485444250 gbinv1212.se
1383548190 gbinv1213.se
1405527493 gbinv1214.se
1449266329 gbinv1215.se
1496243121 gbinv1216.se
1437252914 gbinv1217.se
1490664445 gbinv1218.se
1483600827 gbinv1219.se
1500000097 gbinv122.seq
1482867879 gbinv1220.se
1455464013 gbinv1221.se
1497801835 gbinv1222.se
1447829471 gbinv1223.se
1439626299 gbinv1224.se
1429739603 gbinv1225.se
1420649812 gbinv1226.se
1443957232 gbinv1227.se
1476686726 gbinv1228.se
1483695481 gbinv1229.se
1499999654 gbinv123.seq
1463695568 gbinv1230.se
1434396244 gbinv1231.se
1498866936 gbinv1232.se
1499963736 gbinv1233.se
1494585597 gbinv1234.se
1498989968 gbinv1235.se
1497018291 gbinv1236.se
1492810894 gbinv1237.se
1498873133 gbinv1238.se
1368250529 gbinv1239.se
1499999384 gbinv124.seq
1471868125 gbinv1240.se
1474164934 gbinv1241.se
1374631845 gbinv1242.se
1471592933 gbinv1243.se
1416421392 gbinv1244.se
1464792848 gbinv1245.se
1464253432 gbinv1246.se
1466315603 gbinv1247.se
1421470335 gbinv1248.se
1433859218 gbinv1249.se
1499879452 gbinv125.seq
1484795064 gbinv1250.se
1486983466 gbinv1251.se
1489879814 gbinv1252.se
1471500117 gbinv1253.se
1398003889 gbinv1254.se
1372571779 gbinv1255.se
1250372472 gbinv1256.se
1477522617 gbinv1257.se
1477581317 gbinv1258.se
1477988899 gbinv1259.se
1499997618 gbinv126.seq
1377686721 gbinv1260.se
1306025445 gbinv1261.se
1299054194 gbinv1262.se
1440937635 gbinv1263.se
1433793149 gbinv1264.se
1430563347 gbinv1265.se
981414274 gbinv1266.se
1182906426 gbinv1267.se
1456989096 gbinv1268.se
1491617766 gbinv1269.se
1499995701 gbinv127.seq
1465589772 gbinv1270.se
1417357698 gbinv1271.se
1493100302 gbinv1272.se
1473006142 gbinv1273.se
1477493156 gbinv1274.se
1392060331 gbinv1275.se
1479773598 gbinv1276.se
1484218994 gbinv1277.se
1479390559 gbinv1278.se
1481915503 gbinv1279.se
1499999850 gbinv128.seq
1484735439 gbinv1280.se
1497597627 gbinv1281.se
1446642454 gbinv1282.se
1490728713 gbinv1283.se
1473165638 gbinv1284.se
1496643649 gbinv1285.se
1498851255 gbinv1286.se
1470558370 gbinv1287.se
1379159743 gbinv1288.se
1488243285 gbinv1289.se
1499999799 gbinv129.seq
1477754973 gbinv1290.se
1409718150 gbinv1291.se
1470433532 gbinv1292.se
1485869557 gbinv1293.se
1494060204 gbinv1294.se
1479882237 gbinv1295.se
1472021014 gbinv1296.se
1495417336 gbinv1297.se
1446827953 gbinv1298.se
1481674015 gbinv1299.se
1499886720 gbinv13.seq
1440260762 gbinv130.seq
1497582254 gbinv1300.se
1462925158 gbinv1301.se
1482211566 gbinv1302.se
1337056005 gbinv1303.se
1481579891 gbinv1304.se
1468093065 gbinv1305.se
1489718751 gbinv1306.se
1490429988 gbinv1307.se
1491932351 gbinv1308.se
1481343600 gbinv1309.se
1481446161 gbinv131.seq
1466051598 gbinv1310.se
1475491859 gbinv1311.se
1399558602 gbinv1312.se
1266690954 gbinv1313.se
1473676475 gbinv1314.se
1490239569 gbinv1315.se
1429929598 gbinv1316.se
1485189670 gbinv1317.se
1449458649 gbinv1318.se
1483252041 gbinv1319.se
1355115367 gbinv132.seq
1453754554 gbinv1320.se
1459875750 gbinv1321.se
1465528095 gbinv1322.se
1489652776 gbinv1323.se
1311517459 gbinv1324.se
1473078498 gbinv1325.se
1475579389 gbinv1326.se
1468639847 gbinv1327.se
1420146683 gbinv1328.se
1421868698 gbinv1329.se
1494295272 gbinv133.seq
1435888634 gbinv1330.se
1440806440 gbinv1331.se
1445884384 gbinv1332.se
1462126695 gbinv1333.se
1479670382 gbinv1334.se
1490114612 gbinv1335.se
1494641583 gbinv1336.se
1455238431 gbinv1337.se
1358389050 gbinv1338.se
1496410449 gbinv1339.se
1490465909 gbinv134.seq
1403017758 gbinv1340.se
1432128327 gbinv1341.se
1485070941 gbinv1342.se
1285768817 gbinv1343.se
1488745004 gbinv1344.se
1482173527 gbinv1345.se
1371968579 gbinv1346.se
1480650151 gbinv1347.se
1496524749 gbinv1348.se
1477937704 gbinv1349.se
1493396160 gbinv135.seq
1494378349 gbinv1350.se
1457805324 gbinv1351.se
1491692229 gbinv1352.se
1484027125 gbinv1353.se
1489511368 gbinv1354.se
1481778898 gbinv1355.se
1492208733 gbinv1356.se
1346524465 gbinv1357.se
1489697685 gbinv1358.se
1483576216 gbinv1359.se
1474813193 gbinv136.seq
1472921505 gbinv1360.se
1480163011 gbinv1361.se
1495201163 gbinv1362.se
1485739283 gbinv1363.se
1497302916 gbinv1364.se
1482872791 gbinv1365.se
1492310078 gbinv1366.se
1481650828 gbinv1367.se
1439199002 gbinv1368.se
1488394732 gbinv1369.se
1362747974 gbinv137.seq
1488881215 gbinv1370.se
1494044118 gbinv1371.se
1329420444 gbinv1372.se
1493460833 gbinv1373.se
1493661586 gbinv1374.se
1491004731 gbinv1375.se
1471342180 gbinv1376.se
1495055490 gbinv1377.se
1490425168 gbinv1378.se
1238422015 gbinv1379.se
1488380318 gbinv138.seq
1290189715 gbinv1380.se
1481942348 gbinv1381.se
1488901594 gbinv1382.se
1494337224 gbinv1383.se
1476371273 gbinv1384.se
1496476502 gbinv1385.se
1473829997 gbinv1386.se
1491295586 gbinv1387.se
1480939988 gbinv1388.se
1481380115 gbinv1389.se
1493323723 gbinv139.seq
1478685129 gbinv1390.se
1448940504 gbinv1391.se
1444470148 gbinv1392.se
1333665460 gbinv1393.se
1461238320 gbinv1394.se
1172883965 gbinv1395.se
1484215319 gbinv1396.se
1477399153 gbinv1397.se
1302405383 gbinv1398.se
1471469622 gbinv1399.se
1467390412 gbinv14.seq
1498364387 gbinv140.seq
1477808139 gbinv1400.se
1484062955 gbinv1401.se
1480250514 gbinv1402.se
1317653026 gbinv1403.se
1478729578 gbinv1404.se
1481769644 gbinv1405.se
1490487036 gbinv1406.se
1357492304 gbinv1407.se
1427280929 gbinv1408.se
1491012436 gbinv1409.se
1485226037 gbinv141.seq
1437667085 gbinv1410.se
1495731356 gbinv1411.se
1449148422 gbinv1412.se
1483414768 gbinv1413.se
1457387496 gbinv1414.se
1402203082 gbinv1415.se
1453862448 gbinv1416.se
1486580258 gbinv1417.se
1495516487 gbinv1418.se
1367813413 gbinv1419.se
1486419874 gbinv142.seq
1451473340 gbinv1420.se
1473713924 gbinv1421.se
1460372593 gbinv1422.se
1473979657 gbinv1423.se
1461592719 gbinv1424.se
1495120471 gbinv1425.se
1484753793 gbinv1426.se
1476175511 gbinv1427.se
1388034832 gbinv1428.se
1437873938 gbinv1429.se
1488565082 gbinv143.seq
1261574314 gbinv1430.se
1321811920 gbinv1431.se
1304050359 gbinv1432.se
1317531196 gbinv1433.se
1455056162 gbinv1434.se
1243642531 gbinv1435.se
1297236224 gbinv1436.se
1363579809 gbinv1437.se
1499395751 gbinv1438.se
1400430992 gbinv1439.se
1406701259 gbinv144.seq
1495527133 gbinv1440.se
1485513914 gbinv1441.se
1422034810 gbinv1442.se
1497781093 gbinv1443.se
1478855443 gbinv1444.se
1386722451 gbinv1445.se
1422712258 gbinv1446.se
1499926508 gbinv1447.se
1377631260 gbinv1448.se
1397612614 gbinv1449.se
1491796589 gbinv145.seq
1372357743 gbinv1450.se
1302807713 gbinv1451.se
1423826814 gbinv1452.se
1496228851 gbinv1453.se
1494034277 gbinv1454.se
1305076688 gbinv1455.se
1468272079 gbinv1456.se
1459428033 gbinv1457.se
1451780438 gbinv1458.se
1430075865 gbinv1459.se
1464476152 gbinv146.seq
1438484785 gbinv1460.se
1488600945 gbinv1461.se
1182144960 gbinv1462.se
1377445186 gbinv1463.se
1459410683 gbinv1464.se
1222509758 gbinv1465.se
1455757197 gbinv1466.se
1489710615 gbinv1467.se
1447097240 gbinv1468.se
1380568979 gbinv1469.se
1494003799 gbinv147.seq
1435627429 gbinv1470.se
1466836604 gbinv1471.se
1461552258 gbinv1472.se
1475333903 gbinv1473.se
1475512072 gbinv1474.se
1172181303 gbinv1475.se
1264272719 gbinv1476.se
1190113585 gbinv1477.se
1411949779 gbinv1478.se
1279903486 gbinv1479.se
1398044186 gbinv148.seq
1211814812 gbinv1480.se
1080009521 gbinv1481.se
1461918969 gbinv1482.se
1491410487 gbinv1483.se
1304381521 gbinv1484.se
1364434089 gbinv1485.se
1456602444 gbinv1486.se
1430853405 gbinv1487.se
1428141256 gbinv1488.se
1402083098 gbinv1489.se
1484591726 gbinv149.seq
1486267856 gbinv1490.se
1465260914 gbinv1491.se
1459072706 gbinv1492.se
1388758323 gbinv1493.se
1341994841 gbinv1494.se
1409005197 gbinv1495.se
1364052809 gbinv1496.se
1490503812 gbinv1497.se
1497806726 gbinv1498.se
1360132990 gbinv1499.se
1488837830 gbinv15.seq
1490496973 gbinv150.seq
1480772249 gbinv1500.se
1457647818 gbinv1501.se
1477467655 gbinv1502.se
1069267697 gbinv1503.se
1180361110 gbinv1504.se
1366462631 gbinv1505.se
1482116710 gbinv1506.se
1479640199 gbinv1507.se
1457079396 gbinv1508.se
1371037901 gbinv1509.se
1350074646 gbinv151.seq
1496323017 gbinv1510.se
1493002919 gbinv1511.se
1499998700 gbinv1512.se
1024683362 gbinv1513.se
1469549148 gbinv152.seq
1489342596 gbinv153.seq
1469565358 gbinv154.seq
1491703639 gbinv155.seq
1497978109 gbinv156.seq
1475443766 gbinv157.seq
1493746945 gbinv158.seq
1486725769 gbinv159.seq
1466213276 gbinv16.seq
1474245370 gbinv160.seq
1490171823 gbinv161.seq
1415940595 gbinv162.seq
1476437097 gbinv163.seq
1492039285 gbinv164.seq
1486989889 gbinv165.seq
1391566748 gbinv166.seq
1497850731 gbinv167.seq
1486856363 gbinv168.seq
1473461745 gbinv169.seq
1456211113 gbinv17.seq
1457783743 gbinv170.seq
1432295701 gbinv171.seq
1476859107 gbinv172.seq
1478810991 gbinv173.seq
1470253222 gbinv174.seq
1449415343 gbinv175.seq
1496880166 gbinv176.seq
1456326631 gbinv177.seq
1430905253 gbinv178.seq
1347201702 gbinv179.seq
1494902185 gbinv18.seq
1495706167 gbinv180.seq
1491112830 gbinv181.seq
1441042971 gbinv182.seq
1497192059 gbinv183.seq
1392117025 gbinv184.seq
1413055833 gbinv185.seq
1478247791 gbinv186.seq
1499359194 gbinv187.seq
1455995087 gbinv188.seq
1433502188 gbinv189.seq
1470007291 gbinv19.seq
1491334103 gbinv190.seq
1499090744 gbinv191.seq
1474205648 gbinv192.seq
1352324854 gbinv193.seq
1452357984 gbinv194.seq
1326135021 gbinv195.seq
1474729500 gbinv196.seq
1479215552 gbinv197.seq
1491741812 gbinv198.seq
1393950408 gbinv199.seq
1487394378 gbinv2.seq
1483462462 gbinv20.seq
1494310694 gbinv200.seq
1494869937 gbinv201.seq
1468825052 gbinv202.seq
1475656232 gbinv203.seq
1491813915 gbinv204.seq
1481776571 gbinv205.seq
1483128844 gbinv206.seq
1347544723 gbinv207.seq
1493605679 gbinv208.seq
1483808360 gbinv209.seq
1496255136 gbinv21.seq
1442433573 gbinv210.seq
1483663747 gbinv211.seq
1495737006 gbinv212.seq
1253874221 gbinv213.seq
1494058793 gbinv214.seq
1373457953 gbinv215.seq
1456333883 gbinv216.seq
1484792520 gbinv217.seq
1251829555 gbinv218.seq
1496348692 gbinv219.seq
1463827178 gbinv22.seq
1357064376 gbinv220.seq
1414953531 gbinv221.seq
1400151225 gbinv222.seq
1466945524 gbinv223.seq
1478383808 gbinv224.seq
1496412220 gbinv225.seq
1467309158 gbinv226.seq
1487856483 gbinv227.seq
1487920343 gbinv228.seq
1489288989 gbinv229.seq
1488992096 gbinv23.seq
1487693141 gbinv230.seq
1288775238 gbinv231.seq
1382524196 gbinv232.seq
1357845048 gbinv233.seq
1486585874 gbinv234.seq
1486937267 gbinv235.seq
1488381993 gbinv236.seq
1476145037 gbinv237.seq
1438012610 gbinv238.seq
1477110064 gbinv239.seq
1468329157 gbinv24.seq
1498672461 gbinv240.seq
1473777568 gbinv241.seq
1462092039 gbinv242.seq
1333371159 gbinv243.seq
1385396260 gbinv244.seq
1369192781 gbinv245.seq
1499860066 gbinv246.seq
1475265022 gbinv247.seq
1425069576 gbinv248.seq
1420464715 gbinv249.seq
1495138247 gbinv25.seq
1495216681 gbinv250.seq
1455206750 gbinv251.seq
1472299211 gbinv252.seq
1493240415 gbinv253.seq
1438071355 gbinv254.seq
1352328131 gbinv255.seq
1481801525 gbinv256.seq
1417458953 gbinv257.seq
1498587547 gbinv258.seq
1474622826 gbinv259.seq
1481591309 gbinv26.seq
1469629928 gbinv260.seq
1389695051 gbinv261.seq
1454626056 gbinv262.seq
1473986731 gbinv263.seq
1492283405 gbinv264.seq
1463168127 gbinv265.seq
1391973732 gbinv266.seq
1456232875 gbinv267.seq
1437755108 gbinv268.seq
1492924934 gbinv269.seq
1489671453 gbinv27.seq
1325973548 gbinv270.seq
1499332945 gbinv271.seq
1445909647 gbinv272.seq
1495821117 gbinv273.seq
1443202585 gbinv274.seq
1480225589 gbinv275.seq
1442908071 gbinv276.seq
1478166345 gbinv277.seq
1489195348 gbinv278.seq
1480031166 gbinv279.seq
1467847288 gbinv28.seq
1499676154 gbinv280.seq
1485192064 gbinv281.seq
1372921321 gbinv282.seq
1416726958 gbinv283.seq
1447728294 gbinv284.seq
1439652819 gbinv285.seq
1442618626 gbinv286.seq
1426894153 gbinv287.seq
1447226340 gbinv288.seq
1487195331 gbinv289.seq
1489500374 gbinv29.seq
1483792235 gbinv290.seq
1490454343 gbinv291.seq
1383487641 gbinv292.seq
1488575579 gbinv293.seq
1495179183 gbinv294.seq
1464715247 gbinv295.seq
1493913805 gbinv296.seq
1489979875 gbinv297.seq
1427512355 gbinv298.seq
1457194355 gbinv299.seq
1496070030 gbinv3.seq
1220921148 gbinv30.seq
1489488747 gbinv300.seq
1495947464 gbinv301.seq
1325794030 gbinv302.seq
1494136720 gbinv303.seq
1477159575 gbinv304.seq
1467829201 gbinv305.seq
1454855814 gbinv306.seq
1493852374 gbinv307.seq
1498242095 gbinv308.seq
1450415736 gbinv309.seq
1278053548 gbinv31.seq
1474891878 gbinv310.seq
1470758742 gbinv311.seq
1495937980 gbinv312.seq
623335680 gbinv313.seq
2729769834 gbinv314.seq
1951209797 gbinv315.seq
1255792905 gbinv316.seq
898357564 gbinv317.seq
1390359247 gbinv318.seq
1466020132 gbinv319.seq
1492952945 gbinv32.seq
1443272573 gbinv320.seq
1475387842 gbinv321.seq
1497205510 gbinv322.seq
1467101040 gbinv323.seq
1496389311 gbinv324.seq
1499117653 gbinv325.seq
1462931194 gbinv326.seq
1487873497 gbinv327.seq
1277578135 gbinv328.seq
1487639321 gbinv329.seq
1461853620 gbinv33.seq
1456188446 gbinv330.seq
1499002056 gbinv331.seq
1480066049 gbinv332.seq
1454211592 gbinv333.seq
1222756177 gbinv334.seq
1477554828 gbinv335.seq
1486108915 gbinv336.seq
1427447559 gbinv337.seq
1483162232 gbinv338.seq
1485243570 gbinv339.seq
1422007802 gbinv34.seq
1410776048 gbinv340.seq
1475127917 gbinv341.seq
1479038418 gbinv342.seq
1425853319 gbinv343.seq
1481373985 gbinv344.seq
1490243709 gbinv345.seq
1483879799 gbinv346.seq
1414434060 gbinv347.seq
1457292205 gbinv348.seq
1477018477 gbinv349.seq
1489355517 gbinv35.seq
1409025156 gbinv350.seq
1474794456 gbinv351.seq
1494012052 gbinv352.seq
1465696815 gbinv353.seq
1494483077 gbinv354.seq
1459440397 gbinv355.seq
1494957101 gbinv356.seq
1491910109 gbinv357.seq
1481624627 gbinv358.seq
1479042031 gbinv359.seq
1456396265 gbinv36.seq
1495864236 gbinv360.seq
1479577884 gbinv361.seq
1494515876 gbinv362.seq
1364399555 gbinv363.seq
1448613839 gbinv364.seq
1492450027 gbinv365.seq
1481797904 gbinv366.seq
1448615417 gbinv367.seq
1497318179 gbinv368.seq
1482942614 gbinv369.seq
1247567689 gbinv37.seq
1491980118 gbinv370.seq
1474614092 gbinv371.seq
1493902745 gbinv372.seq
1278522756 gbinv373.seq
1482901794 gbinv374.seq
1456649541 gbinv375.seq
1434040304 gbinv376.seq
1484220657 gbinv377.seq
1480269708 gbinv378.seq
1477251799 gbinv379.seq
1264663267 gbinv38.seq
1488642106 gbinv380.seq
1464325796 gbinv381.seq
1338568836 gbinv382.seq
1490699998 gbinv383.seq
1419620460 gbinv384.seq
1476857168 gbinv385.seq
1483485112 gbinv386.seq
1491578026 gbinv387.seq
1491112499 gbinv388.seq
1479699030 gbinv389.seq
1331002479 gbinv39.seq
1480538403 gbinv390.seq
1472167723 gbinv391.seq
1486100359 gbinv392.seq
1481117526 gbinv393.seq
1492071757 gbinv394.seq
1499340126 gbinv395.seq
1497229819 gbinv396.seq
1479610041 gbinv397.seq
1483481633 gbinv398.seq
1474121526 gbinv399.seq
1492635630 gbinv4.seq
1258736348 gbinv40.seq
1490369993 gbinv400.seq
1405673874 gbinv401.seq
1458938909 gbinv402.seq
1349464140 gbinv403.seq
1495749208 gbinv404.seq
1476876176 gbinv405.seq
1473968850 gbinv406.seq
1323353583 gbinv407.seq
1491101509 gbinv408.seq
1484946141 gbinv409.seq
1458619342 gbinv41.seq
1470944718 gbinv410.seq
1472332405 gbinv411.seq
1481542660 gbinv412.seq
1492837082 gbinv413.seq
1479414174 gbinv414.seq
1466552136 gbinv415.seq
1431499002 gbinv416.seq
1485071634 gbinv417.seq
1494313977 gbinv418.seq
1493657490 gbinv419.seq
1386885295 gbinv42.seq
1480261094 gbinv420.seq
1483044191 gbinv421.seq
1445615250 gbinv422.seq
1497887640 gbinv423.seq
1471083260 gbinv424.seq
1497577480 gbinv425.seq
1499666284 gbinv426.seq
1460233365 gbinv427.seq
1496183446 gbinv428.seq
1498835879 gbinv429.seq
1431698617 gbinv43.seq
1473136630 gbinv430.seq
1479632452 gbinv431.seq
1208341643 gbinv432.seq
1475939186 gbinv433.seq
1492673455 gbinv434.seq
1461443834 gbinv435.seq
1499017367 gbinv436.seq
1480639218 gbinv437.seq
1489253877 gbinv438.seq
1499684845 gbinv439.seq
1431750372 gbinv44.seq
1498373944 gbinv440.seq
1477680980 gbinv441.seq
1469115028 gbinv442.seq
1486876777 gbinv443.seq
1494514455 gbinv444.seq
1419644627 gbinv445.seq
1498250624 gbinv446.seq
1487133459 gbinv447.seq
1393203164 gbinv448.seq
1408820705 gbinv449.seq
1344444822 gbinv45.seq
1497592776 gbinv450.seq
1478543833 gbinv451.seq
1392852049 gbinv452.seq
1499169382 gbinv453.seq
1466213638 gbinv454.seq
1469972842 gbinv455.seq
1457228715 gbinv456.seq
1497717270 gbinv457.seq
1494989185 gbinv458.seq
1278804881 gbinv459.seq
1444379504 gbinv46.seq
1380109384 gbinv460.seq
1386694032 gbinv461.seq
1420319566 gbinv462.seq
1318232257 gbinv463.seq
1488909769 gbinv464.seq
1481543850 gbinv465.seq
1481572717 gbinv466.seq
1479361265 gbinv467.seq
1401152941 gbinv468.seq
1496970113 gbinv469.seq
1425942927 gbinv47.seq
1478315302 gbinv470.seq
1429811506 gbinv471.seq
1376843258 gbinv472.seq
1465003259 gbinv473.seq
1497423367 gbinv474.seq
1346892194 gbinv475.seq
1454126994 gbinv476.seq
1487412138 gbinv477.seq
1483869014 gbinv478.seq
1473633031 gbinv479.seq
1280180275 gbinv48.seq
1482689248 gbinv480.seq
1452173892 gbinv481.seq
1499910356 gbinv482.seq
1464467532 gbinv483.seq
1415595604 gbinv484.seq
1487964141 gbinv485.seq
1486860991 gbinv486.seq
1321666770 gbinv487.seq
1474036684 gbinv488.seq
1483141065 gbinv489.seq
1313437692 gbinv49.seq
1472156670 gbinv490.seq
1218961745 gbinv491.seq
1462078348 gbinv492.seq
1488787648 gbinv493.seq
1471905916 gbinv494.seq
1391493380 gbinv495.seq
1496026145 gbinv496.seq
1498078804 gbinv497.seq
1389370141 gbinv498.seq
1495673760 gbinv499.seq
1495542399 gbinv5.seq
1326432934 gbinv50.seq
1477319963 gbinv500.seq
1079479462 gbinv501.seq
1109467889 gbinv502.seq
1498163797 gbinv503.seq
1394568218 gbinv504.seq
1447788746 gbinv505.seq
1375089916 gbinv506.seq
1426595891 gbinv507.seq
1493069100 gbinv508.seq
1481662028 gbinv509.seq
1146288120 gbinv51.seq
1495154891 gbinv510.seq
1496864645 gbinv511.seq
1491049087 gbinv512.seq
1364586736 gbinv513.seq
1388640271 gbinv514.seq
1491959054 gbinv515.seq
1407831816 gbinv516.seq
1385703901 gbinv517.seq
1495639181 gbinv518.seq
1417611840 gbinv519.seq
1386619309 gbinv52.seq
1497510098 gbinv520.seq
1473023838 gbinv521.seq
1493924480 gbinv522.seq
1494859516 gbinv523.seq
1472777138 gbinv524.seq
1464310997 gbinv525.seq
1492309599 gbinv526.seq
1498936658 gbinv527.seq
1495345098 gbinv528.seq
1439229297 gbinv529.seq
1370389051 gbinv53.seq
1469443676 gbinv530.seq
1383701631 gbinv531.seq
1439898744 gbinv532.seq
1488046142 gbinv533.seq
1423305597 gbinv534.seq
1488614206 gbinv535.seq
1452982888 gbinv536.seq
1496782732 gbinv537.seq
1490770554 gbinv538.seq
1465373730 gbinv539.seq
1472611741 gbinv54.seq
1393267431 gbinv540.seq
1485164207 gbinv541.seq
1472449267 gbinv542.seq
1404048967 gbinv543.seq
1436677322 gbinv544.seq
1431152112 gbinv545.seq
1281222010 gbinv546.seq
1358028214 gbinv547.seq
1472609949 gbinv548.seq
1487636115 gbinv549.seq
1499999004 gbinv55.seq
1468150129 gbinv550.seq
1234186159 gbinv551.seq
1048092840 gbinv552.seq
1309168704 gbinv553.seq
1436243774 gbinv554.seq
1389671116 gbinv555.seq
1449300137 gbinv556.seq
1492678269 gbinv557.seq
1458594377 gbinv558.seq
1492844340 gbinv559.seq
1495434207 gbinv56.seq
1452199723 gbinv560.seq
1476212405 gbinv561.seq
1486194223 gbinv562.seq
1495141635 gbinv563.seq
1287096563 gbinv564.seq
1374386504 gbinv565.seq
1468997307 gbinv566.seq
1494920149 gbinv567.seq
1495343415 gbinv568.seq
1490343966 gbinv569.seq
1485482857 gbinv57.seq
1489624021 gbinv570.seq
1487080559 gbinv571.seq
1498747450 gbinv572.seq
1395302798 gbinv573.seq
1485284949 gbinv574.seq
1435694157 gbinv575.seq
1470723522 gbinv576.seq
1484916015 gbinv577.seq
1483150132 gbinv578.seq
1331454162 gbinv579.seq
1483889091 gbinv58.seq
1356210496 gbinv580.seq
1416749796 gbinv581.seq
1452284984 gbinv582.seq
1488148955 gbinv583.seq
1495268123 gbinv584.seq
1461920210 gbinv585.seq
1490950525 gbinv586.seq
1372238232 gbinv587.seq
1390606238 gbinv588.seq
1458894443 gbinv589.seq
1491530745 gbinv59.seq
1493654155 gbinv590.seq
1499866432 gbinv591.seq
1462171534 gbinv592.seq
1470312188 gbinv593.seq
1491213345 gbinv594.seq
1200607082 gbinv595.seq
1474599992 gbinv596.seq
1226521611 gbinv597.seq
1438661071 gbinv598.seq
1489193064 gbinv599.seq
1484501116 gbinv6.seq
1458661623 gbinv60.seq
1211826488 gbinv600.seq
1440385609 gbinv601.seq
1477656418 gbinv602.seq
1498234511 gbinv603.seq
1499137795 gbinv604.seq
1474254297 gbinv605.seq
1437961059 gbinv606.seq
1465982476 gbinv607.seq
1476362632 gbinv608.seq
1353205190 gbinv609.seq
1494727871 gbinv61.seq
1461561561 gbinv610.seq
1480265953 gbinv611.seq
1477136556 gbinv612.seq
1413880691 gbinv613.seq
1493749227 gbinv614.seq
1489227625 gbinv615.seq
1127804764 gbinv616.seq
1467406139 gbinv617.seq
1349338312 gbinv618.seq
1466084609 gbinv619.seq
1496809730 gbinv62.seq
1499595036 gbinv620.seq
1493518373 gbinv621.seq
1482408313 gbinv622.seq
1489972607 gbinv623.seq
1457477267 gbinv624.seq
1498514187 gbinv625.seq
1484260363 gbinv626.seq
1313458207 gbinv627.seq
1489473064 gbinv628.seq
1467231829 gbinv629.seq
1475473728 gbinv63.seq
1496514320 gbinv630.seq
1476538751 gbinv631.seq
1466376780 gbinv632.seq
1462399182 gbinv633.seq
1477737198 gbinv634.seq
1424791995 gbinv635.seq
1468769087 gbinv636.seq
1497913605 gbinv637.seq
1271418322 gbinv638.seq
1301564944 gbinv639.seq
1479399130 gbinv64.seq
1471879735 gbinv640.seq
1053677687 gbinv641.seq
1380265120 gbinv642.seq
1396131978 gbinv643.seq
1489555206 gbinv644.seq
1433410953 gbinv645.seq
1351353812 gbinv646.seq
1242394563 gbinv647.seq
1499324418 gbinv648.seq
1473661888 gbinv649.seq
1489184825 gbinv65.seq
1449356018 gbinv650.seq
1475967180 gbinv651.seq
1493682713 gbinv652.seq
1495997887 gbinv653.seq
1469126947 gbinv654.seq
1296705383 gbinv655.seq
1466230627 gbinv656.seq
1343924683 gbinv657.seq
1496203289 gbinv658.seq
1484700308 gbinv659.seq
1491679059 gbinv66.seq
1188685701 gbinv660.seq
1441258603 gbinv661.seq
1462772577 gbinv662.seq
1495266184 gbinv663.seq
1494695214 gbinv664.seq
1391522890 gbinv665.seq
1470077879 gbinv666.seq
1480375068 gbinv667.seq
1291633168 gbinv668.seq
1453394119 gbinv669.seq
1490447616 gbinv67.seq
1468923216 gbinv670.seq
1365489229 gbinv671.seq
1461190007 gbinv672.seq
1490156947 gbinv673.seq
1475494072 gbinv674.seq
1431536073 gbinv675.seq
1447676674 gbinv676.seq
1466556343 gbinv677.seq
1480079660 gbinv678.seq
1468333706 gbinv679.seq
1476783029 gbinv68.seq
1480717287 gbinv680.seq
1482059433 gbinv681.seq
1353644202 gbinv682.seq
1492012562 gbinv683.seq
1485251352 gbinv684.seq
1440797550 gbinv685.seq
1489644341 gbinv686.seq
1129926582 gbinv687.seq
1478985096 gbinv688.seq
1436917067 gbinv689.seq
1494372797 gbinv69.seq
1304573259 gbinv690.seq
1447912985 gbinv691.seq
1477159679 gbinv692.seq
1441002488 gbinv693.seq
1358342669 gbinv694.seq
1495926001 gbinv695.seq
1489540966 gbinv696.seq
1385541461 gbinv697.seq
1490668437 gbinv698.seq
1498773544 gbinv699.seq
1490827725 gbinv7.seq
1494156800 gbinv70.seq
1494280310 gbinv700.seq
1478659130 gbinv701.seq
1490369912 gbinv702.seq
1454124707 gbinv703.seq
1480065591 gbinv704.seq
1477473627 gbinv705.seq
1458431340 gbinv706.seq
1267258270 gbinv707.seq
1499431451 gbinv708.seq
1384116066 gbinv709.seq
1479762367 gbinv71.seq
1474301866 gbinv710.seq
1204760525 gbinv711.seq
1460137155 gbinv712.seq
1476820917 gbinv713.seq
1353805130 gbinv714.seq
1413692605 gbinv715.seq
1470780301 gbinv716.seq
1484656775 gbinv717.seq
1469691984 gbinv718.seq
1495706071 gbinv719.seq
1494270589 gbinv72.seq
1297579350 gbinv720.seq
1375758712 gbinv721.seq
1454532764 gbinv722.seq
1497622251 gbinv723.seq
1370789201 gbinv724.seq
1487438204 gbinv725.seq
1492927296 gbinv726.seq
1492982073 gbinv727.seq
1447577144 gbinv728.seq
1431751206 gbinv729.seq
1488497214 gbinv73.seq
1489605332 gbinv730.seq
1473901976 gbinv731.seq
1460312152 gbinv732.seq
1453756526 gbinv733.seq
1382808281 gbinv734.seq
1482348831 gbinv735.seq
1487170658 gbinv736.seq
1497995277 gbinv737.seq
1496722148 gbinv738.seq
1438999088 gbinv739.seq
1492624232 gbinv74.seq
1462665162 gbinv740.seq
1443055696 gbinv741.seq
1455548950 gbinv742.seq
1489860683 gbinv743.seq
1481049079 gbinv744.seq
1454095026 gbinv745.seq
1474299577 gbinv746.seq
1488944812 gbinv747.seq
1446697960 gbinv748.seq
1467256942 gbinv749.seq
1473485502 gbinv75.seq
1390919553 gbinv750.seq
1495086445 gbinv751.seq
1499400044 gbinv752.seq
1481004239 gbinv753.seq
1314366604 gbinv754.seq
1470510441 gbinv755.seq
1364586421 gbinv756.seq
1456187224 gbinv757.seq
1414834539 gbinv758.seq
1453209938 gbinv759.seq
1499997669 gbinv76.seq
1414840193 gbinv760.seq
1460417878 gbinv761.seq
1443661584 gbinv762.seq
1494226123 gbinv763.seq
1457106961 gbinv764.seq
1498685203 gbinv765.seq
1360386481 gbinv766.seq
1471607598 gbinv767.seq
1410380287 gbinv768.seq
1427192614 gbinv769.seq
1500000153 gbinv77.seq
1420392581 gbinv770.seq
1498914132 gbinv771.seq
1493051038 gbinv772.seq
1472397444 gbinv773.seq
1484793149 gbinv774.seq
1436635018 gbinv775.seq
1439891955 gbinv776.seq
1392191125 gbinv777.seq
1435455007 gbinv778.seq
1478764100 gbinv779.seq
1499998125 gbinv78.seq
1427048565 gbinv780.seq
1264302105 gbinv781.seq
1485822793 gbinv782.seq
1418685752 gbinv783.seq
1482216219 gbinv784.seq
1417478148 gbinv785.seq
1494543420 gbinv786.seq
1417238152 gbinv787.seq
1366812572 gbinv788.seq
1494164508 gbinv789.seq
1499998373 gbinv79.seq
999979249 gbinv790.seq
1368086882 gbinv791.seq
1408574610 gbinv792.seq
1498538060 gbinv793.seq
1397635787 gbinv794.seq
1081620411 gbinv795.seq
1431826102 gbinv796.seq
1401372891 gbinv797.seq
1448756584 gbinv798.seq
1488109642 gbinv799.seq
1377087728 gbinv8.seq
1499999643 gbinv80.seq
1489078785 gbinv800.seq
1460733085 gbinv801.seq
1474715637 gbinv802.seq
1472124950 gbinv803.seq
1423732997 gbinv804.seq
1431479439 gbinv805.seq
1414088464 gbinv806.seq
1427352569 gbinv807.seq
1486212943 gbinv808.seq
1439790711 gbinv809.seq
1499982048 gbinv81.seq
1345947195 gbinv810.seq
1409851510 gbinv811.seq
1497428187 gbinv812.seq
1491627673 gbinv813.seq
1407776038 gbinv814.seq
1486091565 gbinv815.seq
1447417238 gbinv816.seq
1424173513 gbinv817.seq
1471376370 gbinv818.seq
1483914009 gbinv819.seq
1499997850 gbinv82.seq
1476930475 gbinv820.seq
1495375621 gbinv821.seq
1482546760 gbinv822.seq
1477023373 gbinv823.seq
1484489275 gbinv824.seq
1364991275 gbinv825.seq
1327457514 gbinv826.seq
1445905313 gbinv827.seq
1480024427 gbinv828.seq
1492427545 gbinv829.seq
1499999421 gbinv83.seq
1483237802 gbinv830.seq
1334750785 gbinv831.seq
1340130480 gbinv832.seq
1428711159 gbinv833.seq
1292257015 gbinv834.seq
1453904599 gbinv835.seq
1490727749 gbinv836.seq
1479824478 gbinv837.seq
1446168967 gbinv838.seq
1483787681 gbinv839.seq
1499989201 gbinv84.seq
1234619110 gbinv840.seq
1489639731 gbinv841.seq
1478350948 gbinv842.seq
1472613421 gbinv843.seq
1314863017 gbinv844.seq
1492845810 gbinv845.seq
1482657208 gbinv846.seq
1490433581 gbinv847.seq
1491351228 gbinv848.seq
1459189685 gbinv849.seq
1499999152 gbinv85.seq
1438910128 gbinv850.seq
1165149605 gbinv851.seq
1443358202 gbinv852.seq
1231751195 gbinv853.seq
1465887213 gbinv854.seq
1427380300 gbinv855.seq
1498007467 gbinv856.seq
1492780193 gbinv857.seq
1310752098 gbinv858.seq
1491528231 gbinv859.seq
1499535542 gbinv86.seq
1372427027 gbinv860.seq
1429260753 gbinv861.seq
1491982766 gbinv862.seq
1499828325 gbinv863.seq
1489546318 gbinv864.seq
1450002164 gbinv865.seq
1432656175 gbinv866.seq
1492803541 gbinv867.seq
1483685180 gbinv868.seq
1494338837 gbinv869.seq
1489320950 gbinv87.seq
1489389384 gbinv870.seq
1486778238 gbinv871.seq
1434934426 gbinv872.seq
1455774368 gbinv873.seq
1486106378 gbinv874.seq
1499849036 gbinv875.seq
1473633903 gbinv876.seq
1482973725 gbinv877.seq
1484222044 gbinv878.seq
1488305213 gbinv879.seq
1497229967 gbinv88.seq
1341678524 gbinv880.seq
1442932031 gbinv881.seq
1495746307 gbinv882.seq
1498425116 gbinv883.seq
1439194314 gbinv884.seq
1478548450 gbinv885.seq
1494920288 gbinv886.seq
1460584282 gbinv887.seq
1487364619 gbinv888.seq
1426848422 gbinv889.seq
1489332525 gbinv89.seq
1493673312 gbinv890.seq
1482903493 gbinv891.seq
1487205334 gbinv892.seq
1469647013 gbinv893.seq
1486282059 gbinv894.seq
1361591905 gbinv895.seq
1499953075 gbinv896.seq
1489844619 gbinv897.seq
1482428698 gbinv898.seq
1486971917 gbinv899.seq
1486221509 gbinv9.seq
1499217229 gbinv90.seq
1420401547 gbinv900.seq
1388400194 gbinv901.seq
1475131801 gbinv902.seq
1476195293 gbinv903.seq
1480806959 gbinv904.seq
1484726887 gbinv905.seq
1479052463 gbinv906.seq
1493623105 gbinv907.seq
1483436320 gbinv908.seq
1317793217 gbinv909.seq
1499920117 gbinv91.seq
1497561482 gbinv910.seq
1492806237 gbinv911.seq
1483017598 gbinv912.seq
1493804427 gbinv913.seq
1491800440 gbinv914.seq
1489411098 gbinv915.seq
1470597476 gbinv916.seq
1420931470 gbinv917.seq
1497146468 gbinv918.seq
1492185599 gbinv919.seq
1457178803 gbinv92.seq
1499197975 gbinv920.seq
1423445069 gbinv921.seq
1496814435 gbinv922.seq
1452718930 gbinv923.seq
1464730622 gbinv924.seq
1487859576 gbinv925.seq
1435686093 gbinv926.seq
1480835874 gbinv927.seq
1493713362 gbinv928.seq
1476740143 gbinv929.seq
1497991080 gbinv93.seq
1475411397 gbinv930.seq
1494755768 gbinv931.seq
1498447262 gbinv932.seq
1487653876 gbinv933.seq
1485417008 gbinv934.seq
1481040939 gbinv935.seq
1499804629 gbinv936.seq
1414899000 gbinv937.seq
1498356634 gbinv938.seq
1495447880 gbinv939.seq
1471704374 gbinv94.seq
1353661319 gbinv940.seq
1438016527 gbinv941.seq
1482228629 gbinv942.seq
1492486762 gbinv943.seq
1490071113 gbinv944.seq
1486148721 gbinv945.seq
1498609189 gbinv946.seq
1490859889 gbinv947.seq
1476040720 gbinv948.seq
1480492610 gbinv949.seq
1490373598 gbinv95.seq
1486313249 gbinv950.seq
1429847966 gbinv951.seq
1430779309 gbinv952.seq
1480312572 gbinv953.seq
1476654539 gbinv954.seq
1493523749 gbinv955.seq
1476569538 gbinv956.seq
1430729968 gbinv957.seq
1482674920 gbinv958.seq
1421263767 gbinv959.seq
1490766577 gbinv96.seq
1339463809 gbinv960.seq
1363357074 gbinv961.seq
1463417934 gbinv962.seq
1491845297 gbinv963.seq
1419809269 gbinv964.seq
1482163240 gbinv965.seq
1474610732 gbinv966.seq
1474463788 gbinv967.seq
1452881760 gbinv968.seq
1269322721 gbinv969.seq
1499567349 gbinv97.seq
1462273049 gbinv970.seq
1469308456 gbinv971.seq
1425481445 gbinv972.seq
1480826973 gbinv973.seq
1497284904 gbinv974.seq
1424397419 gbinv975.seq
1497513398 gbinv976.seq
1479959543 gbinv977.seq
1496934523 gbinv978.seq
1499563246 gbinv979.seq
1490250535 gbinv98.seq
1496744081 gbinv980.seq
1480884933 gbinv981.seq
1494122580 gbinv982.seq
1494328309 gbinv983.seq
1487193179 gbinv984.seq
1499583666 gbinv985.seq
1494335743 gbinv986.seq
1497042803 gbinv987.seq
1493887502 gbinv988.seq
1477684658 gbinv989.seq
1456781840 gbinv99.seq
1385908921 gbinv990.seq
1480297534 gbinv991.seq
1440549581 gbinv992.seq
1359602882 gbinv993.seq
1426066924 gbinv994.seq
1483939417 gbinv995.seq
1415029250 gbinv996.seq
1479409676 gbinv997.seq
1397700660 gbinv998.seq
1492129476 gbinv999.seq
1299923872 gbmam1.seq
1433374449 gbmam10.seq
1462961854 gbmam100.seq
1493460490 gbmam101.seq
1242695251 gbmam102.seq
1452781978 gbmam103.seq
1454575888 gbmam104.seq
1388384055 gbmam105.seq
1442404367 gbmam106.seq
1322250073 gbmam107.seq
1485659023 gbmam108.seq
1334022069 gbmam109.seq
1452368889 gbmam11.seq
1472621969 gbmam110.seq
1212395334 gbmam111.seq
1414632343 gbmam112.seq
1446683889 gbmam113.seq
1432986514 gbmam114.seq
1430519953 gbmam115.seq
1354379872 gbmam116.seq
1493840711 gbmam117.seq
1409540017 gbmam118.seq
1486397049 gbmam119.seq
1440036034 gbmam12.seq
1487622173 gbmam120.seq
1459044453 gbmam121.seq
1471819995 gbmam122.seq
1472660471 gbmam123.seq
1271592251 gbmam124.seq
1323695653 gbmam125.seq
1416834040 gbmam126.seq
1341709714 gbmam127.seq
1437951730 gbmam128.seq
1324905556 gbmam129.seq
1497426774 gbmam13.seq
1340636193 gbmam130.seq
1152187175 gbmam131.seq
1296520546 gbmam132.seq
1411514202 gbmam133.seq
1385494744 gbmam134.seq
1480062815 gbmam135.seq
1357593611 gbmam136.seq
1430130592 gbmam137.seq
1471191394 gbmam138.seq
1405280611 gbmam139.seq
1487057346 gbmam14.seq
1320019150 gbmam140.seq
1379376566 gbmam141.seq
1392387812 gbmam142.seq
1498621108 gbmam143.seq
1424747897 gbmam144.seq
1443349897 gbmam145.seq
1397223064 gbmam146.seq
1292658067 gbmam147.seq
1349694421 gbmam148.seq
1461018701 gbmam149.seq
1433300115 gbmam15.seq
1261683771 gbmam150.seq
1371229989 gbmam151.seq
1404307984 gbmam152.seq
1435643956 gbmam153.seq
1433756151 gbmam154.seq
1421228681 gbmam155.seq
1300863918 gbmam156.seq
1414392316 gbmam157.seq
1346105575 gbmam158.seq
1468473611 gbmam159.seq
1485894617 gbmam16.seq
1435497483 gbmam160.seq
1485785097 gbmam161.seq
1499422142 gbmam162.seq
1450069987 gbmam163.seq
1383921642 gbmam164.seq
1417782624 gbmam165.seq
1421042576 gbmam166.seq
1460770200 gbmam167.seq
1271824090 gbmam168.seq
1357027343 gbmam169.seq
1345861608 gbmam17.seq
1343004536 gbmam170.seq
1414736039 gbmam171.seq
1459063118 gbmam172.seq
1328371649 gbmam173.seq
1406278146 gbmam174.seq
1417664415 gbmam175.seq
1433911740 gbmam176.seq
1360496002 gbmam177.seq
1403385272 gbmam178.seq
1456440946 gbmam179.seq
1404073848 gbmam18.seq
1468921836 gbmam180.seq
1394926630 gbmam181.seq
1422503741 gbmam182.seq
1283559404 gbmam183.seq
1445065618 gbmam184.seq
1498885294 gbmam185.seq
1424349341 gbmam186.seq
1401192174 gbmam187.seq
1269288650 gbmam188.seq
1482030681 gbmam189.seq
1315922420 gbmam19.seq
1471833386 gbmam190.seq
1358976275 gbmam191.seq
1454941336 gbmam192.seq
1415823552 gbmam193.seq
1473188207 gbmam194.seq
1444938066 gbmam195.seq
1437567361 gbmam196.seq
1414328635 gbmam197.seq
1454489615 gbmam198.seq
1466725975 gbmam199.seq
1490951841 gbmam2.seq
1367843978 gbmam20.seq
1435611686 gbmam200.seq
1494922836 gbmam201.seq
485764974 gbmam202.seq
1468252034 gbmam21.seq
1393139762 gbmam22.seq
1466817553 gbmam23.seq
1488080656 gbmam24.seq
1483917563 gbmam25.seq
1434132825 gbmam26.seq
1485351268 gbmam27.seq
1453128998 gbmam28.seq
1494333882 gbmam29.seq
1141246828 gbmam3.seq
1464519465 gbmam30.seq
1441977794 gbmam31.seq
1446827567 gbmam32.seq
1455111173 gbmam33.seq
1385308836 gbmam34.seq
1424749144 gbmam35.seq
1410339361 gbmam36.seq
1378454484 gbmam37.seq
1434286183 gbmam38.seq
1499998087 gbmam39.seq
1342505130 gbmam4.seq
1487421281 gbmam40.seq
1480436127 gbmam41.seq
1408110418 gbmam42.seq
907465328 gbmam43.seq
839494897 gbmam44.seq
1363269325 gbmam45.seq
1343119710 gbmam46.seq
1465682461 gbmam47.seq
1327495418 gbmam48.seq
1455155074 gbmam49.seq
1484831122 gbmam5.seq
1403782937 gbmam50.seq
1389175376 gbmam51.seq
1460772173 gbmam52.seq
1499643620 gbmam53.seq
1494407093 gbmam54.seq
1416414740 gbmam55.seq
1383327549 gbmam56.seq
1473290653 gbmam57.seq
1411021419 gbmam58.seq
1443634265 gbmam59.seq
1429536704 gbmam6.seq
1399808988 gbmam60.seq
1372697093 gbmam61.seq
1445899120 gbmam62.seq
1487459605 gbmam63.seq
1446030419 gbmam64.seq
1491900321 gbmam65.seq
1447662228 gbmam66.seq
1288272320 gbmam67.seq
1489541175 gbmam68.seq
1367385872 gbmam69.seq
1485960787 gbmam7.seq
1433690311 gbmam70.seq
1367200168 gbmam71.seq
1407233551 gbmam72.seq
1437343447 gbmam73.seq
1344751550 gbmam74.seq
1487484232 gbmam75.seq
1418284918 gbmam76.seq
1491622135 gbmam77.seq
1303199123 gbmam78.seq
1441482016 gbmam79.seq
1435168677 gbmam8.seq
1345159341 gbmam80.seq
1472528753 gbmam81.seq
1427875805 gbmam82.seq
1399062857 gbmam83.seq
1414660891 gbmam84.seq
1415873621 gbmam85.seq
1458863948 gbmam86.seq
1342253658 gbmam87.seq
1498868645 gbmam88.seq
1463009820 gbmam89.seq
1460040942 gbmam9.seq
1456467538 gbmam90.seq
1379189978 gbmam91.seq
1447676383 gbmam92.seq
1296500576 gbmam93.seq
1354636780 gbmam94.seq
1352755686 gbmam95.seq
1388614346 gbmam96.seq
1274912466 gbmam97.seq
1431579826 gbmam98.seq
1389201546 gbmam99.seq
5281332 gbnew.txt
1499998830 gbpat1.seq
1499998675 gbpat10.seq
1499999462 gbpat11.seq
1498899462 gbpat12.seq
1499998955 gbpat13.seq
1499999215 gbpat14.seq
1499998935 gbpat15.seq
1499999661 gbpat16.seq
1498721687 gbpat17.seq
1500000233 gbpat18.seq
1499999677 gbpat19.seq
1500000063 gbpat2.seq
1500000162 gbpat20.seq
1499999525 gbpat21.seq
1500000206 gbpat22.seq
1499999759 gbpat23.seq
1499997433 gbpat24.seq
1499999672 gbpat25.seq
1499999998 gbpat26.seq
1499997911 gbpat27.seq
1499999879 gbpat28.seq
1499999235 gbpat29.seq
1499999761 gbpat3.seq
1499999229 gbpat30.seq
1499789457 gbpat31.seq
1499934287 gbpat32.seq
1499998786 gbpat33.seq
1499998844 gbpat34.seq
1500000143 gbpat35.seq
1500000074 gbpat36.seq
1499999552 gbpat37.seq
1499999711 gbpat38.seq
1499999338 gbpat39.seq
1499999408 gbpat4.seq
1499238159 gbpat40.seq
1499960315 gbpat41.seq
1499996628 gbpat42.seq
1499967487 gbpat43.seq
1500000149 gbpat44.seq
1499998710 gbpat45.seq
1499998618 gbpat46.seq
1499988895 gbpat47.seq
1499996860 gbpat48.seq
1499998250 gbpat49.seq
1499999669 gbpat5.seq
1499998610 gbpat50.seq
1499998498 gbpat51.seq
1499999514 gbpat52.seq
1499998999 gbpat53.seq
1500000247 gbpat54.seq
1499999083 gbpat55.seq
1499995965 gbpat56.seq
1499999300 gbpat57.seq
1499999911 gbpat58.seq
1499665324 gbpat59.seq
1499999091 gbpat6.seq
1499064907 gbpat60.seq
1499999869 gbpat61.seq
1499999538 gbpat62.seq
1499586636 gbpat63.seq
1499764801 gbpat64.seq
1497542611 gbpat65.seq
1499999114 gbpat66.seq
1499999977 gbpat67.seq
1500000183 gbpat68.seq
1499999984 gbpat69.seq
1500000000 gbpat7.seq
1499999453 gbpat70.seq
1494700454 gbpat71.seq
1498399148 gbpat72.seq
1500000241 gbpat73.seq
1499999833 gbpat74.seq
1499810613 gbpat75.seq
1499998996 gbpat76.seq
1499998909 gbpat77.seq
1500000211 gbpat78.seq
1500000190 gbpat79.seq
1499999085 gbpat8.seq
1499995955 gbpat80.seq
1499996660 gbpat81.seq
1499999425 gbpat82.seq
1499999494 gbpat83.seq
174424429 gbpat84.seq
1499999732 gbpat9.seq
1499971493 gbphg1.seq
1499976711 gbphg2.seq
1136550336 gbphg3.seq
1499884169 gbpln1.seq
1490892671 gbpln10.seq
1462548554 gbpln100.seq
765490378 gbpln1000.se
737409431 gbpln1001.se
1467554405 gbpln1002.se
838067529 gbpln1003.se
794050155 gbpln1004.se
769006557 gbpln1005.se
1456537015 gbpln1006.se
1456423619 gbpln1007.se
831709070 gbpln1008.se
788018842 gbpln1009.se
1476152223 gbpln101.seq
776335169 gbpln1010.se
1447227790 gbpln1011.se
1462058950 gbpln1012.se
831948388 gbpln1013.se
792155198 gbpln1014.se
764395262 gbpln1015.se
1469026353 gbpln1016.se
1457035185 gbpln1017.se
832913531 gbpln1018.se
783381753 gbpln1019.se
1431083477 gbpln102.seq
777226068 gbpln1020.se
1449010173 gbpln1021.se
1460033797 gbpln1022.se
856583956 gbpln1023.se
800941652 gbpln1024.se
764839742 gbpln1025.se
1463437687 gbpln1026.se
1457211428 gbpln1027.se
838548263 gbpln1028.se
802434969 gbpln1029.se
1443315566 gbpln103.seq
775426580 gbpln1030.se
1468251988 gbpln1031.se
1456996280 gbpln1032.se
836584181 gbpln1033.se
794556424 gbpln1034.se
763379903 gbpln1035.se
1472540376 gbpln1036.se
1467456049 gbpln1037.se
841588738 gbpln1038.se
793586134 gbpln1039.se
1458146029 gbpln104.seq
774193867 gbpln1040.se
1483592341 gbpln1041.se
1464730711 gbpln1042.se
832767208 gbpln1043.se
787519848 gbpln1044.se
773580779 gbpln1045.se
1453968538 gbpln1046.se
1458876982 gbpln1047.se
836647346 gbpln1048.se
804025439 gbpln1049.se
1450295359 gbpln105.seq
780287538 gbpln1050.se
1456910352 gbpln1051.se
1461116472 gbpln1052.se
847868246 gbpln1053.se
799503372 gbpln1054.se
769858206 gbpln1055.se
1451384311 gbpln1056.se
1448178189 gbpln1057.se
841182041 gbpln1058.se
790643458 gbpln1059.se
1437751080 gbpln106.seq
771991396 gbpln1060.se
1449905951 gbpln1061.se
799948094 gbpln1062.se
836052023 gbpln1063.se
791807903 gbpln1064.se
771195581 gbpln1065.se
1452626437 gbpln1066.se
1452862185 gbpln1067.se
666670554 gbpln1068.se
841954477 gbpln1069.se
1429906345 gbpln107.seq
801058908 gbpln1070.se
777293273 gbpln1071.se
1485779606 gbpln1072.se
1452913123 gbpln1073.se
836617455 gbpln1074.se
790837080 gbpln1075.se
777459211 gbpln1076.se
1453527110 gbpln1077.se
1454781570 gbpln1078.se
839842771 gbpln1079.se
1432395801 gbpln108.seq
793797446 gbpln1080.se
776363695 gbpln1081.se
1456772382 gbpln1082.se
1466569984 gbpln1083.se
845148876 gbpln1084.se
804833075 gbpln1085.se
778470840 gbpln1086.se
1481006671 gbpln1087.se
1474068833 gbpln1088.se
794180240 gbpln1089.se
1461915613 gbpln109.seq
774312133 gbpln1090.se
1457303715 gbpln1091.se
835115958 gbpln1092.se
1457626965 gbpln1093.se
836718376 gbpln1094.se
801816184 gbpln1095.se
780710757 gbpln1096.se
1487855626 gbpln1097.se
1468374098 gbpln1098.se
835020955 gbpln1099.se
1408071661 gbpln11.seq
1499418405 gbpln110.seq
794498288 gbpln1100.se
775035874 gbpln1101.se
1474921682 gbpln1102.se
1459702205 gbpln1103.se
836763144 gbpln1104.se
794319485 gbpln1105.se
771563218 gbpln1106.se
1442336042 gbpln1107.se
1461924553 gbpln1108.se
835744193 gbpln1109.se
799028761 gbpln111.seq
793808494 gbpln1110.se
775366859 gbpln1111.se
1452650570 gbpln1112.se
1461461120 gbpln1113.se
839340148 gbpln1114.se
793588555 gbpln1115.se
778845059 gbpln1116.se
1471514124 gbpln1117.se
1460672453 gbpln1118.se
847689175 gbpln1119.se
818536598 gbpln112.seq
797030463 gbpln1120.se
776617524 gbpln1121.se
1450233858 gbpln1122.se
1469651463 gbpln1123.se
834034797 gbpln1124.se
795540701 gbpln1125.se
776376885 gbpln1126.se
1448905128 gbpln1127.se
1457656304 gbpln1128.se
833009352 gbpln1129.se
744339771 gbpln113.seq
797524540 gbpln1130.se
773297930 gbpln1131.se
1451244889 gbpln1132.se
1454193216 gbpln1133.se
830169429 gbpln1134.se
793310457 gbpln1135.se
773560290 gbpln1136.se
1446231891 gbpln1137.se
1450937303 gbpln1138.se
835938341 gbpln1139.se
840483636 gbpln114.seq
795056321 gbpln1140.se
770765157 gbpln1141.se
1475561524 gbpln1142.se
1466579245 gbpln1143.se
829099164 gbpln1144.se
790989379 gbpln1145.se
773398673 gbpln1146.se
1462046272 gbpln1147.se
1449910042 gbpln1148.se
837413052 gbpln1149.se
1482268558 gbpln115.seq
790648527 gbpln1150.se
772176401 gbpln1151.se
1460620041 gbpln1152.se
1455765886 gbpln1153.se
833059054 gbpln1154.se
794545184 gbpln1155.se
774083177 gbpln1156.se
1448946753 gbpln1157.se
1458559584 gbpln1158.se
835451342 gbpln1159.se
1445216054 gbpln116.seq
794577233 gbpln1160.se
775251446 gbpln1161.se
1454531761 gbpln1162.se
1463618989 gbpln1163.se
836809812 gbpln1164.se
806584862 gbpln1165.se
776084155 gbpln1166.se
1485075661 gbpln1167.se
1448852265 gbpln1168.se
836125457 gbpln1169.se
1499019904 gbpln117.seq
794049612 gbpln1170.se
769729355 gbpln1171.se
1469601615 gbpln1172.se
1458361301 gbpln1173.se
840008504 gbpln1174.se
794029694 gbpln1175.se
769623341 gbpln1176.se
1477482614 gbpln1177.se
1456549528 gbpln1178.se
836931236 gbpln1179.se
1471007441 gbpln118.seq
792455888 gbpln1180.se
768695354 gbpln1181.se
1450909194 gbpln1182.se
1454926637 gbpln1183.se
835570197 gbpln1184.se
798619346 gbpln1185.se
776375847 gbpln1186.se
1468212148 gbpln1187.se
1463519623 gbpln1188.se
832456199 gbpln1189.se
1497460973 gbpln119.seq
793920035 gbpln1190.se
773324985 gbpln1191.se
1443647684 gbpln1192.se
1458966967 gbpln1193.se
834886228 gbpln1194.se
792465315 gbpln1195.se
766375549 gbpln1196.se
1449349195 gbpln1197.se
1457671779 gbpln1198.se
836173230 gbpln1199.se
1475360853 gbpln12.seq
1497729906 gbpln120.seq
792990723 gbpln1200.se
774691916 gbpln1201.se
1452432506 gbpln1202.se
797342703 gbpln1203.se
1496638015 gbpln1204.se
804070482 gbpln1205.se
777569920 gbpln1206.se
1461158646 gbpln1207.se
1466754128 gbpln1208.se
830451601 gbpln1209.se
1489362717 gbpln121.seq
798616435 gbpln1210.se
774880678 gbpln1211.se
1455218535 gbpln1212.se
1460523331 gbpln1213.se
837230145 gbpln1214.se
796560308 gbpln1215.se
777015504 gbpln1216.se
1455593679 gbpln1217.se
1455711383 gbpln1218.se
838785071 gbpln1219.se
1499092145 gbpln122.seq
791233293 gbpln1220.se
770014685 gbpln1221.se
1450013191 gbpln1222.se
1455309450 gbpln1223.se
835677720 gbpln1224.se
793372574 gbpln1225.se
769401747 gbpln1226.se
1456544663 gbpln1227.se
1465313453 gbpln1228.se
839230685 gbpln1229.se
1473551999 gbpln123.seq
803963907 gbpln1230.se
778586682 gbpln1231.se
1463130395 gbpln1232.se
1457728697 gbpln1233.se
832496071 gbpln1234.se
797513192 gbpln1235.se
776551156 gbpln1236.se
1449845840 gbpln1237.se
1460493739 gbpln1238.se
839860091 gbpln1239.se
1497683966 gbpln124.seq
789840368 gbpln1240.se
776969912 gbpln1241.se
1450486337 gbpln1242.se
1492412414 gbpln1243.se
1486347390 gbpln1244.se
1445734827 gbpln1245.se
1251330037 gbpln1246.se
1123381446 gbpln1247.se
1111693114 gbpln1248.se
1309334197 gbpln1249.se
1339792010 gbpln125.seq
1445887647 gbpln1250.se
1075129462 gbpln1251.se
830295693 gbpln1252.se
794035728 gbpln1253.se
766241777 gbpln1254.se
1451959155 gbpln1255.se
1460262157 gbpln1256.se
800420442 gbpln1257.se
807100878 gbpln1258.se
813165275 gbpln1259.se
946931884 gbpln126.seq
1489858794 gbpln1260.se
1463645427 gbpln1261.se
836403024 gbpln1262.se
797704105 gbpln1263.se
771673145 gbpln1264.se
1489073756 gbpln1265.se
1463000631 gbpln1266.se
835021187 gbpln1267.se
794511065 gbpln1268.se
765022160 gbpln1269.se
1121159029 gbpln127.seq
1450430115 gbpln1270.se
1446394723 gbpln1271.se
837987830 gbpln1272.se
795104781 gbpln1273.se
772053911 gbpln1274.se
1454341387 gbpln1275.se
1471789737 gbpln1276.se
850379386 gbpln1277.se
1235921295 gbpln1278.se
820639220 gbpln1279.se
1164001315 gbpln128.seq
1480990953 gbpln1280.se
791663935 gbpln1281.se
942730875 gbpln1282.se
1413074394 gbpln1283.se
1271934713 gbpln1284.se
1485567802 gbpln1285.se
1184860474 gbpln1286.se
1227017136 gbpln1287.se
774219381 gbpln1288.se
1442415305 gbpln1289.se
1483600477 gbpln129.seq
1485783848 gbpln1290.se
1496789915 gbpln1291.se
1459198915 gbpln1292.se
990926845 gbpln1293.se
840478319 gbpln1294.se
804862544 gbpln1295.se
775136193 gbpln1296.se
1456887584 gbpln1297.se
1470716689 gbpln1298.se
836948259 gbpln1299.se
1383978349 gbpln13.seq
1314173387 gbpln130.seq
794972859 gbpln1300.se
775455598 gbpln1301.se
1463119445 gbpln1302.se
1451301195 gbpln1303.se
852997313 gbpln1304.se
798187575 gbpln1305.se
776406263 gbpln1306.se
1458385249 gbpln1307.se
1463826120 gbpln1308.se
833048862 gbpln1309.se
946518369 gbpln131.seq
794071582 gbpln1310.se
772684697 gbpln1311.se
1454827832 gbpln1312.se
1451661085 gbpln1313.se
839152730 gbpln1314.se
798464996 gbpln1315.se
775710033 gbpln1316.se
1463986968 gbpln1317.se
1455516963 gbpln1318.se
827472017 gbpln1319.se
1120694900 gbpln132.seq
799696373 gbpln1320.se
771541363 gbpln1321.se
1456098533 gbpln1322.se
1450468258 gbpln1323.se
830011447 gbpln1324.se
803324869 gbpln1325.se
778613518 gbpln1326.se
1485535574 gbpln1327.se
1460285834 gbpln1328.se
834396522 gbpln1329.se
1163541839 gbpln133.seq
793156442 gbpln1330.se
771664945 gbpln1331.se
1460976066 gbpln1332.se
1472747650 gbpln1333.se
831402033 gbpln1334.se
788227480 gbpln1335.se
773608315 gbpln1336.se
1459251214 gbpln1337.se
1457115869 gbpln1338.se
833114761 gbpln1339.se
1476385247 gbpln134.seq
791988363 gbpln1340.se
773778680 gbpln1341.se
1439338108 gbpln1342.se
1459678216 gbpln1343.se
832582978 gbpln1344.se
790630518 gbpln1345.se
774554078 gbpln1346.se
1459431387 gbpln1347.se
1462622889 gbpln1348.se
841885928 gbpln1349.se
1464223788 gbpln135.seq
814740283 gbpln1350.se
781686950 gbpln1351.se
1470777020 gbpln1352.se
1474113031 gbpln1353.se
836345572 gbpln1354.se
803943397 gbpln1355.se
776352617 gbpln1356.se
1461742228 gbpln1357.se
1468260082 gbpln1358.se
833628952 gbpln1359.se
1467551110 gbpln136.seq
800337028 gbpln1360.se
775679569 gbpln1361.se
1485372410 gbpln1362.se
1470684487 gbpln1363.se
837791026 gbpln1364.se
805450455 gbpln1365.se
782697461 gbpln1366.se
1462403294 gbpln1367.se
1471545155 gbpln1368.se
844251896 gbpln1369.se
1495870642 gbpln137.seq
800661389 gbpln1370.se
770104661 gbpln1371.se
1486820730 gbpln1372.se
1437673274 gbpln1373.se
1478905630 gbpln1374.se
1484038098 gbpln1375.se
1459847462 gbpln1376.se
1419010411 gbpln1377.se
1449294852 gbpln1378.se
1432942330 gbpln1379.se
1491171045 gbpln138.seq
1483752514 gbpln1380.se
1440643664 gbpln1381.se
1404423649 gbpln1382.se
1444711390 gbpln1383.se
1488511554 gbpln1384.se
1472104928 gbpln1385.se
1252858539 gbpln1386.se
1227118965 gbpln1387.se
1253367586 gbpln1388.se
1312280922 gbpln1389.se
1440606987 gbpln139.seq
1221593375 gbpln1390.se
1480321489 gbpln1391.se
1413447705 gbpln1392.se
1469526349 gbpln1393.se
1268059371 gbpln1394.se
2734223096 gbpln1395.se
2727931901 gbpln1396.se
2720692598 gbpln1397.se
2732441076 gbpln1398.se
2733260927 gbpln1399.se
1174886908 gbpln14.seq
1456135485 gbpln140.seq
157556535 gbpln1400.se
2694271430 gbpln1401.se
2735442486 gbpln1402.se
2720859722 gbpln1403.se
2732011308 gbpln1404.se
2383529845 gbpln1405.se
2723191931 gbpln1406.se
2689474086 gbpln1407.se
2737751830 gbpln1408.se
2700210160 gbpln1409.se
1463536670 gbpln141.seq
2006289519 gbpln1410.se
2636141786 gbpln1411.se
2722875815 gbpln1412.se
2725415454 gbpln1413.se
2730393002 gbpln1414.se
1948886785 gbpln1415.se
2738131093 gbpln1416.se
2727379378 gbpln1417.se
2679871098 gbpln1418.se
2737685310 gbpln1419.se
1456619726 gbpln142.seq
786720890 gbpln1420.se
2727907345 gbpln1421.se
2657432129 gbpln1422.se
2735229991 gbpln1423.se
2728645371 gbpln1424.se
218791011 gbpln1425.se
2719617838 gbpln1426.se
2721885171 gbpln1427.se
2721092581 gbpln1428.se
2679558604 gbpln1429.se
1460093363 gbpln143.seq
181580803 gbpln1430.se
2722179116 gbpln1431.se
2736369220 gbpln1432.se
2726783046 gbpln1433.se
2440060122 gbpln1434.se
2736724965 gbpln1435.se
2696541624 gbpln1436.se
2737924301 gbpln1437.se
1979539878 gbpln1438.se
2731302183 gbpln1439.se
1463892288 gbpln144.seq
2702984894 gbpln1440.se
2732485324 gbpln1441.se
1906858977 gbpln1442.se
1333776538 gbpln1443.se
1481529082 gbpln1444.se
1126988286 gbpln1445.se
1310090641 gbpln1446.se
1319048578 gbpln1447.se
1215502439 gbpln1448.se
1273213184 gbpln1449.se
1473368775 gbpln145.seq
1439841247 gbpln1450.se
1291263007 gbpln1451.se
1286241557 gbpln1452.se
1294607816 gbpln1453.se
1298830856 gbpln1454.se
1179380341 gbpln1455.se
1227809389 gbpln1456.se
1347974809 gbpln1457.se
1227045645 gbpln1458.se
1241387178 gbpln1459.se
1470624568 gbpln146.seq
1321199139 gbpln1460.se
1307076096 gbpln1461.se
1194598426 gbpln1462.se
1267961203 gbpln1463.se
1465598311 gbpln1464.se
1272760531 gbpln1465.se
1248554044 gbpln1466.se
1285502181 gbpln1467.se
1353649948 gbpln1468.se
1201259963 gbpln1469.se
1451324968 gbpln147.seq
1114385426 gbpln1470.se
1428292861 gbpln1471.se
1254591123 gbpln1472.se
1109371533 gbpln1473.se
1256013571 gbpln1474.se
1193254570 gbpln1475.se
1147797532 gbpln1476.se
1185963587 gbpln1477.se
1176623547 gbpln1478.se
1184486862 gbpln1479.se
1452075765 gbpln148.seq
1178497787 gbpln1480.se
1255058840 gbpln1481.se
1121066110 gbpln1482.se
1150746117 gbpln1483.se
1179251584 gbpln1484.se
1319824235 gbpln1485.se
1194499724 gbpln1486.se
1150884296 gbpln1487.se
1260272463 gbpln1488.se
1277796253 gbpln1489.se
1431744218 gbpln149.seq
1077009674 gbpln1490.se
1159931138 gbpln1491.se
1298671968 gbpln1492.se
1092881836 gbpln1493.se
1120436749 gbpln1494.se
1214127482 gbpln1495.se
1117793566 gbpln1496.se
1019835843 gbpln1497.se
1155398206 gbpln1498.se
1368620545 gbpln1499.se
1399719926 gbpln15.seq
1464855803 gbpln150.seq
1144165985 gbpln1500.se
1072391985 gbpln1501.se
1263097017 gbpln1502.se
1297997059 gbpln1503.se
1325335044 gbpln1504.se
1216230084 gbpln1505.se
1263623363 gbpln1506.se
1174025244 gbpln1507.se
1229634718 gbpln1508.se
1363681878 gbpln1509.se
1475627026 gbpln151.seq
1218381112 gbpln1510.se
1400966271 gbpln1511.se
1382372150 gbpln1512.se
1176735774 gbpln1513.se
1224889930 gbpln1514.se
1310436934 gbpln1515.se
1233749942 gbpln1516.se
1059964644 gbpln1517.se
1254488223 gbpln1518.se
1310744622 gbpln1519.se
1434702396 gbpln152.seq
1163904965 gbpln1520.se
1264654503 gbpln1521.se
1296551517 gbpln1522.se
1158563945 gbpln1523.se
1059918971 gbpln1524.se
1259052983 gbpln1525.se
1206631634 gbpln1526.se
1106849019 gbpln1527.se
1193454949 gbpln1528.se
1254210685 gbpln1529.se
1490653648 gbpln153.seq
1151910983 gbpln1530.se
1118028517 gbpln1531.se
1136283639 gbpln1532.se
1270471759 gbpln1533.se
1106145822 gbpln1534.se
1237358153 gbpln1535.se
1388485833 gbpln1536.se
1221364282 gbpln1537.se
1101728075 gbpln1538.se
1191208317 gbpln1539.se
1471063453 gbpln154.seq
1212231259 gbpln1540.se
1132007157 gbpln1541.se
1441955987 gbpln1542.se
1470274017 gbpln1543.se
1459739391 gbpln1544.se
1471760010 gbpln1545.se
1440847993 gbpln1546.se
1455978021 gbpln1547.se
1445045468 gbpln1548.se
1487079619 gbpln1549.se
1490153893 gbpln155.seq
1481625137 gbpln1550.se
1447279971 gbpln1551.se
1048521841 gbpln1552.se
1038155649 gbpln1553.se
833369914 gbpln1554.se
931292853 gbpln1555.se
811379776 gbpln1556.se
1077992421 gbpln1557.se
812614241 gbpln1558.se
1052276437 gbpln1559.se
1469933169 gbpln156.seq
1035793500 gbpln1560.se
832863065 gbpln1561.se
922247149 gbpln1562.se
807661511 gbpln1563.se
1066166792 gbpln1564.se
997697986 gbpln1565.se
1273669998 gbpln1566.se
1102521608 gbpln1567.se
1209618371 gbpln1568.se
1111089963 gbpln1569.se
1423936272 gbpln157.seq
1160173863 gbpln1570.se
1205643923 gbpln1571.se
1237074429 gbpln1572.se
1242683281 gbpln1573.se
1080809951 gbpln1574.se
1226448377 gbpln1575.se
1349517074 gbpln1576.se
1175767295 gbpln1577.se
1216393612 gbpln1578.se
1294608106 gbpln1579.se
1482673178 gbpln158.seq
1298831146 gbpln1580.se
1179380631 gbpln1581.se
1227809679 gbpln1582.se
1347975099 gbpln1583.se
1227045935 gbpln1584.se
1241387663 gbpln1585.se
1256013573 gbpln1586.se
1193254572 gbpln1587.se
1147797534 gbpln1588.se
1185963589 gbpln1589.se
1475085952 gbpln159.seq
1176623549 gbpln1590.se
1184486864 gbpln1591.se
1178497789 gbpln1592.se
1255058842 gbpln1593.se
1121066112 gbpln1594.se
1150746119 gbpln1595.se
1179251586 gbpln1596.se
1319824237 gbpln1597.se
1194499726 gbpln1598.se
1150884349 gbpln1599.se
1419955350 gbpln16.seq
1498902160 gbpln160.seq
1183507690 gbpln1600.se
1165156001 gbpln1601.se
1145365871 gbpln1602.se
1114264316 gbpln1603.se
1291707339 gbpln1604.se
1200907808 gbpln1605.se
1185642828 gbpln1606.se
1268692726 gbpln1607.se
1272919740 gbpln1608.se
1103058293 gbpln1609.se
1496478483 gbpln161.seq
1122948169 gbpln1610.se
1380211964 gbpln1611.se
1129155752 gbpln1612.se
1160577179 gbpln1613.se
1260272465 gbpln1614.se
1277796255 gbpln1615.se
1077009676 gbpln1616.se
1159931140 gbpln1617.se
1298671970 gbpln1618.se
1092881838 gbpln1619.se
1476166269 gbpln162.seq
1120436751 gbpln1620.se
1214127484 gbpln1621.se
1117793568 gbpln1622.se
1019835845 gbpln1623.se
1155398208 gbpln1624.se
1368620547 gbpln1625.se
1144165987 gbpln1626.se
1072392038 gbpln1627.se
1310090643 gbpln1628.se
1319048580 gbpln1629.se
1425655905 gbpln163.seq
1215502441 gbpln1630.se
1273213186 gbpln1631.se
1439841249 gbpln1632.se
1291263009 gbpln1633.se
1286241610 gbpln1634.se
1263097019 gbpln1635.se
1297997061 gbpln1636.se
1325335047 gbpln1637.se
1216230086 gbpln1638.se
1263623365 gbpln1639.se
1490279088 gbpln164.seq
1174025246 gbpln1640.se
1229634720 gbpln1641.se
1363681880 gbpln1642.se
1218381114 gbpln1643.se
1400966274 gbpln1644.se
1382372152 gbpln1645.se
1176735776 gbpln1646.se
1259998472 gbpln1647.se
1429872810 gbpln1648.se
1290195552 gbpln1649.se
1490284844 gbpln165.seq
1118855412 gbpln1650.se
1286015571 gbpln1651.se
1309057752 gbpln1652.se
1189205456 gbpln1653.se
1088738989 gbpln1654.se
1310436046 gbpln1655.se
1233749054 gbpln1656.se
1059963756 gbpln1657.se
1254487335 gbpln1658.se
1310743734 gbpln1659.se
1487862865 gbpln166.seq
1233633287 gbpln1660.se
1257623330 gbpln1661.se
1136790411 gbpln1662.se
1024083293 gbpln1663.se
1208012116 gbpln1664.se
1341166334 gbpln1665.se
1178296123 gbpln1666.se
1133776595 gbpln1667.se
1321198791 gbpln1668.se
1307075748 gbpln1669.se
1295984790 gbpln167.seq
1194598078 gbpln1670.se
1267960855 gbpln1671.se
1465597963 gbpln1672.se
1272760183 gbpln1673.se
1248553572 gbpln1674.se
997697304 gbpln1675.se
1273669316 gbpln1676.se
1102520926 gbpln1677.se
1209617689 gbpln1678.se
1111089281 gbpln1679.se
1251274347 gbpln168.seq
1160173181 gbpln1680.se
1205643241 gbpln1681.se
1237073747 gbpln1682.se
1242682599 gbpln1683.se
1080809269 gbpln1684.se
1226447695 gbpln1685.se
1349516392 gbpln1686.se
1175766613 gbpln1687.se
1216392639 gbpln1688.se
1306535163 gbpln1689.se
1453657951 gbpln169.seq
1471600767 gbpln1690.se
1474480099 gbpln1691.se
1442648460 gbpln1692.se
1445144746 gbpln1693.se
1470808103 gbpln1694.se
1400146166 gbpln1695.se
1451194528 gbpln1696.se
1491931525 gbpln1697.se
1485075954 gbpln1698.se
1464218638 gbpln1699.se
1415252675 gbpln17.seq
1481017758 gbpln170.seq
1464354463 gbpln1700.se
1434708321 gbpln1701.se
1446304634 gbpln1702.se
1481913454 gbpln1703.se
225362530 gbpln1704.se
2549738660 gbpln1705.se
1967027328 gbpln1706.se
1908341558 gbpln1707.se
1899626925 gbpln1708.se
1507440270 gbpln1709.se
1498606076 gbpln171.seq
1195338085 gbpln1710.se
1471685994 gbpln1711.se
1482480023 gbpln1712.se
1457506176 gbpln1713.se
1489313455 gbpln1714.se
1496792810 gbpln1715.se
997934006 gbpln1716.se
832020729 gbpln1717.se
803030138 gbpln1718.se
771628223 gbpln1719.se
1442798465 gbpln172.seq
1448711979 gbpln1720.se
1240387718 gbpln1721.se
1254120972 gbpln1722.se
1355940856 gbpln1723.se
1218508495 gbpln1724.se
1405315859 gbpln1725.se
971627123 gbpln1726.se
850272715 gbpln1727.se
849609082 gbpln1728.se
850190924 gbpln1729.se
1457724171 gbpln173.seq
976829654 gbpln1730.se
814643125 gbpln1731.se
879514342 gbpln1732.se
812317704 gbpln1733.se
1488237027 gbpln1734.se
944480603 gbpln1735.se
1488070952 gbpln1736.se
1495294095 gbpln1737.se
1496264712 gbpln1738.se
1489792519 gbpln1739.se
1479937021 gbpln174.seq
1231600086 gbpln1740.se
1265330191 gbpln1741.se
1488619274 gbpln1742.se
1499872978 gbpln1743.se
1330362587 gbpln1744.se
1240461713 gbpln1745.se
1332036329 gbpln1746.se
1277787876 gbpln1747.se
1478171319 gbpln1748.se
1308033872 gbpln1749.se
1491344801 gbpln175.seq
1388656433 gbpln1750.se
1443471168 gbpln1751.se
1413408953 gbpln1752.se
548537029 gbpln1753.se
1225077527 gbpln1754.se
720006506 gbpln1755.se
919172207 gbpln1756.se
874099574 gbpln1757.se
897784209 gbpln1758.se
876816866 gbpln1759.se
1495551806 gbpln176.seq
928190381 gbpln1760.se
951802003 gbpln1761.se
824940722 gbpln1762.se
1489306195 gbpln1763.se
1440059389 gbpln1764.se
1482969130 gbpln1765.se
1486345764 gbpln1766.se
1467103425 gbpln1767.se
1478834238 gbpln1768.se
1444208472 gbpln1769.se
1492595295 gbpln177.seq
1483418769 gbpln1770.se
1450848094 gbpln1771.se
1437771909 gbpln1772.se
1444812712 gbpln1773.se
1488993344 gbpln1774.se
1446871084 gbpln1775.se
1494839831 gbpln1776.se
1496741541 gbpln1777.se
1374411960 gbpln1778.se
1182248477 gbpln1779.se
1475790089 gbpln178.seq
1497598741 gbpln1780.se
1491491565 gbpln1781.se
1461709979 gbpln1782.se
1449889995 gbpln1783.se
1495849942 gbpln1784.se
1484634302 gbpln1785.se
1412074936 gbpln1786.se
1405761405 gbpln1787.se
1402453546 gbpln1788.se
1455644102 gbpln1789.se
1477821850 gbpln179.seq
1455814532 gbpln1790.se
1446114329 gbpln1791.se
1446417320 gbpln1792.se
917155014 gbpln1793.se
1344094781 gbpln1794.se
1494221919 gbpln1795.se
1499592828 gbpln1796.se
1412833253 gbpln1797.se
1483609453 gbpln1798.se
1452520406 gbpln1799.se
1377958226 gbpln18.seq
1462100058 gbpln180.seq
1397047033 gbpln1800.se
1363158169 gbpln1801.se
1095290873 gbpln1802.se
1407629769 gbpln1803.se
1485609248 gbpln1804.se
1473280517 gbpln1805.se
1395029086 gbpln1806.se
1294170668 gbpln1807.se
1429782007 gbpln1808.se
1449842921 gbpln1809.se
1497201221 gbpln181.seq
1191589738 gbpln1810.se
1497010592 gbpln1811.se
1315701164 gbpln1812.se
1281309867 gbpln1813.se
1477284423 gbpln1814.se
1484711099 gbpln1815.se
1472609216 gbpln1816.se
1441438426 gbpln1817.se
1296128165 gbpln1818.se
1242756199 gbpln1819.se
1497415290 gbpln182.seq
1236451464 gbpln1820.se
1161997502 gbpln1821.se
1077270105 gbpln1822.se
1063033165 gbpln1823.se
1035836409 gbpln1824.se
1035095724 gbpln1825.se
1031633368 gbpln1826.se
978748070 gbpln1827.se
979040186 gbpln1828.se
970030251 gbpln1829.se
1230413401 gbpln183.seq
965223873 gbpln1830.se
968357696 gbpln1831.se
1280850654 gbpln1832.se
1277873606 gbpln1833.se
1033073499 gbpln1834.se
1255917596 gbpln1835.se
1033902901 gbpln1836.se
1338307356 gbpln1837.se
1253985607 gbpln1838.se
1211059423 gbpln1839.se
847363373 gbpln184.seq
1165332095 gbpln1840.se
1473761940 gbpln1841.se
1478507707 gbpln1842.se
1406604626 gbpln1843.se
1457255177 gbpln1844.se
1477972029 gbpln1845.se
1442645818 gbpln1846.se
1489748372 gbpln1847.se
1462901162 gbpln1848.se
937840681 gbpln1849.se
1005397162 gbpln185.seq
1247630817 gbpln1850.se
1357636835 gbpln1851.se
831132627 gbpln1852.se
1497401637 gbpln1853.se
1490481944 gbpln1854.se
1420494202 gbpln1855.se
1392744913 gbpln1856.se
1498251308 gbpln1857.se
1248523234 gbpln1858.se
1455420277 gbpln1859.se
963947957 gbpln186.seq
1417475415 gbpln1860.se
1382790154 gbpln1861.se
1392095099 gbpln1862.se
1438579339 gbpln1863.se
1435206085 gbpln1864.se
1438544862 gbpln1865.se
1473935824 gbpln1866.se
1447579851 gbpln1867.se
1397452636 gbpln1868.se
1202495428 gbpln1869.se
1459632274 gbpln187.seq
1159422590 gbpln1870.se
1142132932 gbpln1871.se
1041331622 gbpln1872.se
957152555 gbpln1873.se
1081839501 gbpln1874.se
1445552919 gbpln1875.se
1319425564 gbpln1876.se
1268533720 gbpln1877.se
1109648066 gbpln1878.se
1486506812 gbpln1879.se
748612447 gbpln188.seq
1497707315 gbpln1880.se
1422234672 gbpln1881.se
1489590944 gbpln1882.se
1478227947 gbpln1883.se
1402602326 gbpln1884.se
1491762551 gbpln1885.se
1484377526 gbpln1886.se
1397644911 gbpln1887.se
1489605217 gbpln1888.se
1479854682 gbpln1889.se
952879508 gbpln189.seq
1498477297 gbpln1890.se
1461131200 gbpln1891.se
1042087100 gbpln1892.se
1112183793 gbpln1893.se
1489968340 gbpln1894.se
1244436981 gbpln1895.se
1433366576 gbpln1896.se
1476620950 gbpln1897.se
1383029421 gbpln1898.se
1407240135 gbpln1899.se
1388122211 gbpln19.seq
925770946 gbpln190.seq
823995636 gbpln1900.se
779758590 gbpln1901.se
767138463 gbpln1902.se
1459415295 gbpln1903.se
1318422290 gbpln1904.se
809577106 gbpln1905.se
767635813 gbpln1906.se
1472481285 gbpln1907.se
1489014285 gbpln1908.se
1470984315 gbpln1909.se
679052844 gbpln191.seq
783356383 gbpln1910.se
768556688 gbpln1911.se
1437743364 gbpln1912.se
1455697771 gbpln1913.se
827116263 gbpln1914.se
785947999 gbpln1915.se
765845200 gbpln1916.se
1449229608 gbpln1917.se
1406361789 gbpln1918.se
789953322 gbpln1919.se
891360722 gbpln192.seq
1476310111 gbpln1920.se
1381424733 gbpln1921.se
1399187032 gbpln1922.se
828245843 gbpln1923.se
784946746 gbpln1924.se
762930721 gbpln1925.se
1442020097 gbpln1926.se
1446746274 gbpln1927.se
839668894 gbpln1928.se
780847594 gbpln1929.se
983898394 gbpln193.seq
766352668 gbpln1930.se
1433384069 gbpln1931.se
1448399892 gbpln1932.se
830761006 gbpln1933.se
781576153 gbpln1934.se
770532847 gbpln1935.se
1451368039 gbpln1936.se
1468486682 gbpln1937.se
1422478456 gbpln1938.se
1209600917 gbpln1939.se
816632398 gbpln194.seq
1305650736 gbpln1940.se
1499569179 gbpln1941.se
1479553714 gbpln1942.se
1310990192 gbpln1943.se
936978374 gbpln1944.se
920269142 gbpln1945.se
883112886 gbpln1946.se
832543127 gbpln1947.se
1498872025 gbpln1948.se
1476584173 gbpln1949.se
1120135514 gbpln195.seq
952859598 gbpln1950.se
787766863 gbpln1951.se
1428004358 gbpln1952.se
755531660 gbpln1953.se
1480074698 gbpln1954.se
1469627882 gbpln1955.se
1183963878 gbpln1956.se
1240333955 gbpln1957.se
1318953961 gbpln1958.se
1188607975 gbpln1959.se
972750007 gbpln196.seq
1366617485 gbpln1960.se
1335944846 gbpln1961.se
1266250426 gbpln1962.se
1452816684 gbpln1963.se
780043620 gbpln1964.se
905108798 gbpln1965.se
1382990824 gbpln1966.se
1232901940 gbpln1967.se
1440152635 gbpln1968.se
1168368744 gbpln1969.se
850229495 gbpln197.seq
1199437811 gbpln1970.se
750909446 gbpln1971.se
1409079072 gbpln1972.se
1372624455 gbpln1973.se
1289743162 gbpln1974.se
1460859481 gbpln1975.se
790727412 gbpln1976.se
902368242 gbpln1977.se
1345969987 gbpln1978.se
1298664145 gbpln1979.se
1055433981 gbpln198.seq
1381757576 gbpln1980.se
1236284820 gbpln1981.se
1427744498 gbpln1982.se
1106678329 gbpln1983.se
1292768534 gbpln1984.se
1473273688 gbpln1985.se
777804097 gbpln1986.se
904371456 gbpln1987.se
1394071307 gbpln1988.se
1233875425 gbpln1989.se
1010019267 gbpln199.seq
1459903348 gbpln1990.se
1180872382 gbpln1991.se
1206122804 gbpln1992.se
758798011 gbpln1993.se
1411522005 gbpln1994.se
1387876799 gbpln1995.se
1325613672 gbpln1996.se
832979486 gbpln1997.se
1483686993 gbpln1998.se
936520792 gbpln1999.se
1499993987 gbpln2.seq
1414821162 gbpln20.seq
649020885 gbpln200.seq
1398721044 gbpln2000.se
1273967299 gbpln2001.se
746940155 gbpln2002.se
1330510817 gbpln2003.se
1419515383 gbpln2004.se
1259822345 gbpln2005.se
1467008939 gbpln2006.se
1370313745 gbpln2007.se
1327486844 gbpln2008.se
1458044851 gbpln2009.se
926976463 gbpln201.seq
810877694 gbpln2010.se
918646930 gbpln2011.se
1433442513 gbpln2012.se
1271719609 gbpln2013.se
748994949 gbpln2014.se
1343144369 gbpln2015.se
1436205630 gbpln2016.se
1276327002 gbpln2017.se
1463165486 gbpln2018.se
1340619484 gbpln2019.se
1429445579 gbpln202.seq
1261443952 gbpln2020.se
1462630472 gbpln2021.se
786145431 gbpln2022.se
922709878 gbpln2023.se
1372350074 gbpln2024.se
1249995941 gbpln2025.se
1491764513 gbpln2026.se
1180173637 gbpln2027.se
1225302171 gbpln2028.se
762118187 gbpln2029.se
1395283641 gbpln203.seq
1461974323 gbpln2030.se
1457330284 gbpln2031.se
1492021986 gbpln2032.se
1476789520 gbpln2033.se
972953710 gbpln2034.se
868135626 gbpln2035.se
882846708 gbpln2036.se
797751492 gbpln2037.se
806424564 gbpln2038.se
733757147 gbpln2039.se
1354945307 gbpln204.seq
1451063550 gbpln2040.se
1188400824 gbpln2041.se
1492228313 gbpln2042.se
1494140034 gbpln2043.se
1489011953 gbpln2044.se
950702783 gbpln2045.se
883495278 gbpln2046.se
907591334 gbpln2047.se
810354788 gbpln2048.se
805672920 gbpln2049.se
1483269401 gbpln205.seq
742834347 gbpln2050.se
1485923593 gbpln2051.se
1499986349 gbpln2052.se
1478169462 gbpln2053.se
1488030531 gbpln2054.se
1492737370 gbpln2055.se
1463244561 gbpln2056.se
1456614467 gbpln2057.se
1459607956 gbpln2058.se
1445674110 gbpln2059.se
1328920351 gbpln206.seq
1461086753 gbpln2060.se
1481995846 gbpln2061.se
1460748247 gbpln2062.se
1430517997 gbpln2063.se
1413089596 gbpln2064.se
1270480418 gbpln2065.se
1141914292 gbpln2066.se
927866661 gbpln2067.se
1431042664 gbpln2068.se
1379009636 gbpln2069.se
1375810615 gbpln207.seq
1326487930 gbpln2070.se
1292059993 gbpln2071.se
1226033834 gbpln2072.se
1062596938 gbpln2073.se
887282416 gbpln2074.se
880396180 gbpln2075.se
1458441501 gbpln2076.se
1229011354 gbpln2077.se
1493749893 gbpln2078.se
1498429867 gbpln2079.se
1417059620 gbpln208.seq
1485955822 gbpln2080.se
1432654628 gbpln2081.se
1460754289 gbpln2082.se
1443249722 gbpln2083.se
1431829288 gbpln2084.se
1019856776 gbpln2085.se
926829963 gbpln2086.se
631978811 gbpln2087.se
1007025956 gbpln2088.se
1015784082 gbpln2089.se
1445203849 gbpln209.seq
849865988 gbpln2090.se
961335938 gbpln2091.se
1101841304 gbpln2092.se
807661531 gbpln2093.se
965168115 gbpln2094.se
876245218 gbpln2095.se
676215233 gbpln2096.se
908511369 gbpln2097.se
934941423 gbpln2098.se
737378330 gbpln2099.se
1469241166 gbpln21.seq
1390731093 gbpln210.seq
789038594 gbpln2100.se
944965471 gbpln2101.se
639676369 gbpln2102.se
956064578 gbpln2103.se
971671783 gbpln2104.se
1495611181 gbpln2105.se
1438689934 gbpln2106.se
1447349888 gbpln2107.se
1072443076 gbpln2108.se
1392610943 gbpln2109.se
1497962930 gbpln211.seq
1218955498 gbpln2110.se
1497279192 gbpln2111.se
1489661782 gbpln2112.se
1412101378 gbpln2113.se
1379792366 gbpln2114.se
1319894800 gbpln2115.se
1261901829 gbpln2116.se
1471965176 gbpln2117.se
1438337816 gbpln2118.se
1255789880 gbpln2119.se
1455152128 gbpln212.seq
1279146690 gbpln2120.se
1495918934 gbpln2121.se
1455909107 gbpln2122.se
1470157321 gbpln2123.se
1483914736 gbpln2124.se
1472108491 gbpln2125.se
1492057123 gbpln2126.se
1493038560 gbpln2127.se
1475560127 gbpln2128.se
1496070253 gbpln2129.se
1478219408 gbpln213.seq
1485813444 gbpln2130.se
1014631571 gbpln2131.se
831368122 gbpln2132.se
825264608 gbpln2133.se
815981525 gbpln2134.se
1428426548 gbpln2135.se
1277942528 gbpln2136.se
845848353 gbpln2137.se
819614711 gbpln2138.se
799993345 gbpln2139.se
1478945442 gbpln214.seq
1406794313 gbpln2140.se
1268786782 gbpln2141.se
1211772007 gbpln2142.se
1156911804 gbpln2143.se
1037250057 gbpln2144.se
1422953573 gbpln2145.se
1489668499 gbpln2146.se
1400546300 gbpln2147.se
1401350158 gbpln2148.se
1471861686 gbpln2149.se
1427180896 gbpln215.seq
1221871381 gbpln2150.se
1087859700 gbpln2151.se
1047597569 gbpln2152.se
1361330010 gbpln2153.se
1493332904 gbpln2154.se
886119523 gbpln2155.se
1344116512 gbpln2156.se
1191896435 gbpln2157.se
1123667252 gbpln2158.se
1389152081 gbpln2159.se
1478000426 gbpln216.seq
1302137889 gbpln2160.se
1496151287 gbpln2161.se
1455419370 gbpln2162.se
1462104345 gbpln2163.se
1397410704 gbpln2164.se
1435076446 gbpln2165.se
1450949136 gbpln2166.se
1441524092 gbpln2167.se
1397949882 gbpln2168.se
1428504381 gbpln2169.se
1477901313 gbpln217.seq
1443291228 gbpln2170.se
1432178510 gbpln2171.se
1485345653 gbpln2172.se
1386378899 gbpln2173.se
1394543158 gbpln2174.se
1493043632 gbpln2175.se
1475818833 gbpln2176.se
1467441310 gbpln2177.se
1473297085 gbpln2178.se
1390399030 gbpln2179.se
1343267570 gbpln218.seq
1426468984 gbpln2180.se
1494163492 gbpln2181.se
1495618934 gbpln2182.se
1468186151 gbpln2183.se
1141713117 gbpln2184.se
1338382354 gbpln2185.se
1228737712 gbpln2186.se
1489416816 gbpln2187.se
1438553273 gbpln2188.se
1445088726 gbpln2189.se
1439810163 gbpln219.seq
1439364293 gbpln2190.se
1107668741 gbpln2191.se
798759393 gbpln2192.se
787037423 gbpln2193.se
1484847618 gbpln2194.se
1361568320 gbpln2195.se
788748892 gbpln2196.se
785913492 gbpln2197.se
1490791926 gbpln2198.se
1417470317 gbpln2199.se
1330335968 gbpln22.seq
1494870406 gbpln220.seq
1424915317 gbpln2200.se
1368450119 gbpln2201.se
1304767104 gbpln2202.se
1105675676 gbpln2203.se
1334015175 gbpln2204.se
1319533680 gbpln2205.se
1446251017 gbpln2206.se
1390441760 gbpln2207.se
1245416680 gbpln2208.se
1450537446 gbpln2209.se
1485734598 gbpln221.seq
1476324982 gbpln2210.se
1436673260 gbpln2211.se
1326822143 gbpln2212.se
1382769597 gbpln2213.se
1496188571 gbpln2214.se
1294179784 gbpln2215.se
1470659234 gbpln2216.se
1389250438 gbpln2217.se
1447564040 gbpln2218.se
1224094716 gbpln2219.se
1483463801 gbpln222.seq
1410658795 gbpln2220.se
1460483097 gbpln2221.se
1447221680 gbpln2222.se
1286292170 gbpln2223.se
1418010155 gbpln2224.se
1424347006 gbpln2225.se
1345338187 gbpln2226.se
1057634659 gbpln2227.se
1462844728 gbpln2228.se
1434239209 gbpln2229.se
1479493417 gbpln223.seq
1466374362 gbpln2230.se
1458651400 gbpln2231.se
1486335364 gbpln2232.se
1418348687 gbpln2233.se
1414803952 gbpln2234.se
1173105642 gbpln2235.se
1328188372 gbpln2236.se
1485628212 gbpln2237.se
1254061309 gbpln2238.se
1411326213 gbpln2239.se
1491836451 gbpln224.seq
1491400819 gbpln2240.se
1462409885 gbpln2241.se
1467087613 gbpln2242.se
1445353268 gbpln2243.se
1473912107 gbpln2244.se
1458563711 gbpln2245.se
1253695064 gbpln2246.se
1275517046 gbpln2247.se
1202470949 gbpln2248.se
1258697653 gbpln2249.se
1488173377 gbpln225.seq
1438353575 gbpln2250.se
1439229830 gbpln2251.se
1362229617 gbpln2252.se
1397925246 gbpln2253.se
1497936136 gbpln2254.se
1499407062 gbpln2255.se
1492845960 gbpln2256.se
1471880560 gbpln2257.se
820380791 gbpln2258.se
753305075 gbpln2259.se
1499600975 gbpln226.seq
882902876 gbpln2260.se
636457809 gbpln2261.se
1021367343 gbpln2262.se
1027431723 gbpln2263.se
849351232 gbpln2264.se
961283480 gbpln2265.se
1076169475 gbpln2266.se
800489813 gbpln2267.se
971463919 gbpln2268.se
875748759 gbpln2269.se
1498216442 gbpln227.seq
664230418 gbpln2270.se
917057769 gbpln2271.se
939034723 gbpln2272.se
731830817 gbpln2273.se
791564584 gbpln2274.se
922438504 gbpln2275.se
634692215 gbpln2276.se
943117654 gbpln2277.se
938115435 gbpln2278.se
1490933062 gbpln2279.se
1484778197 gbpln228.seq
1496879177 gbpln2280.se
1481719918 gbpln2281.se
1478308122 gbpln2282.se
1433928615 gbpln2283.se
1496559827 gbpln2284.se
1441603757 gbpln2285.se
1491065433 gbpln2286.se
1166275976 gbpln2287.se
749697561 gbpln2288.se
850310012 gbpln2289.se
1488285643 gbpln229.seq
1010662674 gbpln2290.se
1026938768 gbpln2291.se
958973509 gbpln2292.se
1062642803 gbpln2293.se
963228652 gbpln2294.se
879497817 gbpln2295.se
904165266 gbpln2296.se
936802063 gbpln2297.se
782862308 gbpln2298.se
918993119 gbpln2299.se
1178137445 gbpln23.seq
1495969303 gbpln230.seq
942196274 gbpln2300.se
1497057530 gbpln2301.se
1497062374 gbpln2302.se
1460393158 gbpln2303.se
1468481396 gbpln2304.se
1311042214 gbpln2305.se
1476147253 gbpln2306.se
1208902808 gbpln2307.se
1334504576 gbpln2308.se
1490376533 gbpln2309.se
1484090396 gbpln231.seq
1468825633 gbpln2310.se
1309144543 gbpln2311.se
1273866780 gbpln2312.se
1133927322 gbpln2313.se
1363023461 gbpln2314.se
1414046992 gbpln2315.se
1383771500 gbpln2316.se
1441526520 gbpln2317.se
1322826001 gbpln2318.se
1325185433 gbpln2319.se
1481255103 gbpln232.seq
1353443237 gbpln2320.se
1400463114 gbpln2321.se
1374700450 gbpln2322.se
1442403678 gbpln2323.se
1465281659 gbpln2324.se
1478705883 gbpln2325.se
1481694191 gbpln2326.se
1487581145 gbpln2327.se
1495576051 gbpln2328.se
1474692462 gbpln2329.se
1498486766 gbpln233.seq
1401229672 gbpln2330.se
1488209575 gbpln2331.se
1482226972 gbpln2332.se
1480600863 gbpln2333.se
1300684726 gbpln2334.se
1411146303 gbpln2335.se
1442986576 gbpln2336.se
1483075460 gbpln2337.se
1490051616 gbpln2338.se
1360386002 gbpln2339.se
1462491476 gbpln234.seq
1464284621 gbpln2340.se
1455561297 gbpln2341.se
1432286854 gbpln2342.se
1267767651 gbpln2343.se
1395992031 gbpln2344.se
1457505413 gbpln2345.se
1355050033 gbpln2346.se
1423590352 gbpln2347.se
1485979715 gbpln2348.se
1496495757 gbpln2349.se
1499999890 gbpln235.seq
1441323914 gbpln2350.se
1394325122 gbpln2351.se
1468695728 gbpln2352.se
1434163551 gbpln2353.se
1491973684 gbpln2354.se
1487526921 gbpln2355.se
1492689224 gbpln2356.se
1499057449 gbpln2357.se
1397524107 gbpln2358.se
1301327467 gbpln2359.se
1499940214 gbpln236.seq
1386449118 gbpln2360.se
1448666541 gbpln2361.se
1455826633 gbpln2362.se
1473309481 gbpln2363.se
1469136031 gbpln2364.se
1335434241 gbpln2365.se
1358122429 gbpln2366.se
1499479638 gbpln2367.se
1479666961 gbpln2368.se
1490607549 gbpln2369.se
1499999658 gbpln237.seq
1493165254 gbpln2370.se
1424660709 gbpln2371.se
1459585044 gbpln2372.se
860039182 gbpln2373.se
833176228 gbpln2374.se
794500032 gbpln2375.se
768887202 gbpln2376.se
1443786059 gbpln2377.se
1486419092 gbpln2378.se
1493061512 gbpln2379.se
1016851846 gbpln238.seq
1479543550 gbpln2380.se
1491805941 gbpln2381.se
1496791605 gbpln2382.se
1245719793 gbpln2383.se
1382242820 gbpln2384.se
1442829818 gbpln2385.se
1289077492 gbpln2386.se
1199662418 gbpln2387.se
1074345715 gbpln2388.se
1486501220 gbpln2389.se
1442961741 gbpln239.seq
1277182309 gbpln2390.se
982379426 gbpln2391.se
1281330439 gbpln2392.se
1431440883 gbpln2393.se
1233028426 gbpln2394.se
1170984874 gbpln2395.se
1195347717 gbpln2396.se
1431439666 gbpln2397.se
1427264167 gbpln2398.se
1212915022 gbpln2399.se
1189405382 gbpln24.seq
1432829714 gbpln240.seq
1251008926 gbpln2400.se
1395190644 gbpln2401.se
1401498367 gbpln2402.se
1491838236 gbpln2403.se
1472517374 gbpln2404.se
1495655618 gbpln2405.se
1429922885 gbpln2406.se
1479269848 gbpln2407.se
1318150615 gbpln2408.se
1380386983 gbpln2409.se
1493844389 gbpln241.seq
1415325209 gbpln2410.se
1403501699 gbpln2411.se
1434323508 gbpln2412.se
1421338539 gbpln2413.se
1473262528 gbpln2414.se
1453411150 gbpln2415.se
1416432973 gbpln2416.se
1488724657 gbpln2417.se
1479045674 gbpln2418.se
1459674941 gbpln2419.se
838266744 gbpln242.seq
1460004518 gbpln2420.se
1318168909 gbpln2421.se
1083273345 gbpln2422.se
1038940311 gbpln2423.se
1020234377 gbpln2424.se
977529630 gbpln2425.se
965294916 gbpln2426.se
951488026 gbpln2427.se
950474753 gbpln2428.se
942734911 gbpln2429.se
786074578 gbpln243.seq
929806639 gbpln2430.se
921846459 gbpln2431.se
894765574 gbpln2432.se
883443104 gbpln2433.se
832342901 gbpln2434.se
826268823 gbpln2435.se
815836967 gbpln2436.se
793611001 gbpln2437.se
1496662034 gbpln2438.se
1328373183 gbpln2439.se
1469406697 gbpln244.seq
1495942541 gbpln2440.se
1462430583 gbpln2441.se
1462057761 gbpln2442.se
1421205591 gbpln2443.se
1456510636 gbpln2444.se
1355306362 gbpln2445.se
1251637603 gbpln2446.se
1262338753 gbpln2447.se
1238130086 gbpln2448.se
1462387174 gbpln2449.se
1351709444 gbpln245.seq
1432196463 gbpln2450.se
1453078106 gbpln2451.se
1498475535 gbpln2452.se
1499997778 gbpln2453.se
1499875103 gbpln2454.se
1499989789 gbpln2455.se
704559594 gbpln2456.se
1499970926 gbpln246.seq
1499995157 gbpln247.seq
1500000179 gbpln248.seq
1500000220 gbpln249.seq
1381436972 gbpln25.seq
1500000081 gbpln250.seq
1499999726 gbpln251.seq
1499860948 gbpln252.seq
1482041638 gbpln253.seq
1493871010 gbpln254.seq
1495670343 gbpln255.seq
1483829291 gbpln256.seq
860028189 gbpln257.seq
800605872 gbpln258.seq
794469115 gbpln259.seq
1408504664 gbpln26.seq
1492903391 gbpln260.seq
1017558444 gbpln261.seq
924325157 gbpln262.seq
1201978654 gbpln263.seq
1227268207 gbpln264.seq
1152253241 gbpln265.seq
1115248374 gbpln266.seq
1125506105 gbpln267.seq
1145303472 gbpln268.seq
1497252335 gbpln269.seq
1427497014 gbpln27.seq
987259098 gbpln270.seq
689933987 gbpln271.seq
887561680 gbpln272.seq
834970472 gbpln273.seq
826391913 gbpln274.seq
792513917 gbpln275.seq
743209872 gbpln276.seq
1498927764 gbpln277.seq
860028189 gbpln278.seq
800605872 gbpln279.seq
1492834035 gbpln28.seq
794469115 gbpln280.seq
1492903391 gbpln281.seq
997390426 gbpln282.seq
663098252 gbpln283.seq
855592604 gbpln284.seq
807031053 gbpln285.seq
793905039 gbpln286.seq
1491456147 gbpln287.seq
1466632070 gbpln288.seq
840180304 gbpln289.seq
1466958039 gbpln29.seq
796430245 gbpln290.seq
779180715 gbpln291.seq
1486604510 gbpln292.seq
1445385427 gbpln293.seq
831209396 gbpln294.seq
783682955 gbpln295.seq
775938782 gbpln296.seq
1442399440 gbpln297.seq
1471877377 gbpln298.seq
872662143 gbpln299.seq
1499992757 gbpln3.seq
1292001848 gbpln30.seq
815663229 gbpln300.seq
813528167 gbpln301.seq
780491844 gbpln302.seq
734904793 gbpln303.seq
1451981137 gbpln304.seq
824184474 gbpln305.seq
768070182 gbpln306.seq
1491145948 gbpln307.seq
1472604409 gbpln308.seq
1481497172 gbpln309.seq
1498875905 gbpln31.seq
783385752 gbpln310.seq
770520351 gbpln311.seq
1452863252 gbpln312.seq
1486785182 gbpln313.seq
906907390 gbpln314.seq
844110716 gbpln315.seq
841780855 gbpln316.seq
805270043 gbpln317.seq
764396863 gbpln318.seq
841492595 gbpln319.seq
1499997253 gbpln32.seq
714482811 gbpln320.seq
916127997 gbpln321.seq
858459407 gbpln322.seq
848936990 gbpln323.seq
813129213 gbpln324.seq
765593150 gbpln325.seq
862731158 gbpln326.seq
665885634 gbpln327.seq
854365265 gbpln328.seq
802776346 gbpln329.seq
1499391557 gbpln33.seq
793295912 gbpln330.seq
1480158894 gbpln331.seq
1429544600 gbpln332.seq
814320946 gbpln333.seq
759349720 gbpln334.seq
1487159826 gbpln335.seq
1463992028 gbpln336.seq
684180819 gbpln337.seq
873292213 gbpln338.seq
827422505 gbpln339.seq
1498064590 gbpln34.seq
815925825 gbpln340.seq
779009585 gbpln341.seq
739747654 gbpln342.seq
1498046242 gbpln343.seq
849628701 gbpln344.seq
803882830 gbpln345.seq
794420470 gbpln346.seq
1474790996 gbpln347.seq
1469965572 gbpln348.seq
854770002 gbpln349.seq
1487755604 gbpln35.seq
805931576 gbpln350.seq
798923954 gbpln351.seq
1489544894 gbpln352.seq
1467528130 gbpln353.seq
854339916 gbpln354.seq
803900400 gbpln355.seq
791449620 gbpln356.seq
1476207543 gbpln357.seq
1475343864 gbpln358.seq
870939392 gbpln359.seq
1497866691 gbpln36.seq
809408813 gbpln360.seq
801514137 gbpln361.seq
1492438448 gbpln362.seq
1476330312 gbpln363.seq
846934671 gbpln364.seq
794708793 gbpln365.seq
789781753 gbpln366.seq
1475691254 gbpln367.seq
1489470879 gbpln368.seq
888406351 gbpln369.seq
1498155503 gbpln37.seq
835271741 gbpln370.seq
823533989 gbpln371.seq
787819193 gbpln372.seq
748786657 gbpln373.seq
1483648847 gbpln374.seq
1197559843 gbpln375.seq
898446949 gbpln376.seq
628489896 gbpln377.seq
1024113089 gbpln378.seq
1032878661 gbpln379.seq
1475079851 gbpln38.seq
858694781 gbpln380.seq
960391204 gbpln381.seq
1090094606 gbpln382.seq
781959143 gbpln383.seq
946995961 gbpln384.seq
857542781 gbpln385.seq
656405285 gbpln386.seq
907889097 gbpln387.seq
896386890 gbpln388.seq
726432335 gbpln389.seq
1498738671 gbpln39.seq
798296822 gbpln390.seq
918393750 gbpln391.seq
584961784 gbpln392.seq
948865971 gbpln393.seq
954536271 gbpln394.seq
819735731 gbpln395.seq
756588093 gbpln396.seq
876067119 gbpln397.seq
625446321 gbpln398.seq
977801494 gbpln399.seq
1485525193 gbpln4.seq
1407330247 gbpln40.seq
854357980 gbpln400.seq
807732556 gbpln401.seq
947696453 gbpln402.seq
1067629605 gbpln403.seq
822222048 gbpln404.seq
950272996 gbpln405.seq
1488985571 gbpln406.seq
894745096 gbpln407.seq
893352134 gbpln408.seq
1498806035 gbpln409.seq
1365081691 gbpln41.seq
1491810166 gbpln410.seq
933986451 gbpln411.seq
939527664 gbpln412.seq
810117922 gbpln413.seq
765938558 gbpln414.seq
886537018 gbpln415.seq
623519964 gbpln416.seq
996940649 gbpln417.seq
1030190034 gbpln418.seq
832828033 gbpln419.seq
1488776146 gbpln42.seq
956342979 gbpln420.seq
1134286144 gbpln421.seq
790513299 gbpln422.seq
944161893 gbpln423.seq
860035788 gbpln424.seq
647268685 gbpln425.seq
902239623 gbpln426.seq
1345936752 gbpln427.seq
787834228 gbpln428.seq
910724363 gbpln429.seq
1437420408 gbpln43.seq
606016896 gbpln430.seq
961485234 gbpln431.seq
1242775191 gbpln432.seq
1453328788 gbpln433.seq
818591771 gbpln434.seq
766580884 gbpln435.seq
1476620557 gbpln436.seq
1460693671 gbpln437.seq
750738544 gbpln438.seq
1496665003 gbpln439.seq
1496841299 gbpln44.seq
995069022 gbpln440.seq
1012956234 gbpln441.seq
827074347 gbpln442.seq
940621783 gbpln443.seq
1079418810 gbpln444.seq
776922106 gbpln445.seq
938380968 gbpln446.seq
1492330319 gbpln447.seq
891714442 gbpln448.seq
878638403 gbpln449.seq
1499301714 gbpln45.seq
721632671 gbpln450.seq
779156122 gbpln451.seq
895553446 gbpln452.seq
604678568 gbpln453.seq
931006295 gbpln454.seq
933660027 gbpln455.seq
810459540 gbpln456.seq
761872100 gbpln457.seq
878702815 gbpln458.seq
627081460 gbpln459.seq
1451128313 gbpln46.seq
994320235 gbpln460.seq
999434327 gbpln461.seq
823789349 gbpln462.seq
945629782 gbpln463.seq
1062113821 gbpln464.seq
792298939 gbpln465.seq
941851700 gbpln466.seq
850142413 gbpln467.seq
656955691 gbpln468.seq
904094753 gbpln469.seq
1430899048 gbpln47.seq
900193903 gbpln470.seq
1470079206 gbpln471.seq
1497721340 gbpln472.seq
937117048 gbpln473.seq
936021119 gbpln474.seq
812696702 gbpln475.seq
746628212 gbpln476.seq
897168807 gbpln477.seq
626698501 gbpln478.seq
1007072101 gbpln479.seq
1410592051 gbpln48.seq
1000831797 gbpln480.seq
841918855 gbpln481.seq
963426816 gbpln482.seq
1093654114 gbpln483.seq
791118382 gbpln484.seq
959940756 gbpln485.seq
853263842 gbpln486.seq
648051398 gbpln487.seq
901282075 gbpln488.seq
923491092 gbpln489.seq
1216818349 gbpln49.seq
732477869 gbpln490.seq
789987733 gbpln491.seq
926022053 gbpln492.seq
610840579 gbpln493.seq
949759032 gbpln494.seq
955444559 gbpln495.seq
818480442 gbpln496.seq
752251380 gbpln497.seq
897893149 gbpln498.seq
631111272 gbpln499.seq
1441569211 gbpln5.seq
1406513490 gbpln50.seq
1022032953 gbpln500.seq
1006306956 gbpln501.seq
837035085 gbpln502.seq
966140819 gbpln503.seq
1090560006 gbpln504.seq
800164754 gbpln505.seq
959884028 gbpln506.seq
886916735 gbpln507.seq
641540050 gbpln508.seq
910168783 gbpln509.seq
1381482888 gbpln51.seq
908785549 gbpln510.seq
729527181 gbpln511.seq
797552105 gbpln512.seq
910975470 gbpln513.seq
616026199 gbpln514.seq
945685366 gbpln515.seq
953145956 gbpln516.seq
820081609 gbpln517.seq
763165947 gbpln518.seq
1489098826 gbpln519.seq
1446757676 gbpln52.seq
1009123187 gbpln520.seq
1016689515 gbpln521.seq
832912303 gbpln522.seq
952656374 gbpln523.seq
1065835283 gbpln524.seq
776075044 gbpln525.seq
935940025 gbpln526.seq
1488231655 gbpln527.seq
1487557825 gbpln528.seq
720169483 gbpln529.seq
1499991276 gbpln53.seq
780564861 gbpln530.seq
1499144496 gbpln531.seq
934713391 gbpln532.seq
1233388213 gbpln533.seq
807542511 gbpln534.seq
757881986 gbpln535.seq
889760627 gbpln536.seq
635890046 gbpln537.seq
1007873898 gbpln538.seq
1015524558 gbpln539.seq
1472586014 gbpln54.seq
836625022 gbpln540.seq
959076059 gbpln541.seq
1077416379 gbpln542.seq
789416089 gbpln543.seq
958430056 gbpln544.seq
877922843 gbpln545.seq
648665455 gbpln546.seq
907513209 gbpln547.seq
904978028 gbpln548.seq
727024880 gbpln549.seq
1398723248 gbpln55.seq
789120540 gbpln550.seq
898507915 gbpln551.seq
617229811 gbpln552.seq
942711764 gbpln553.seq
964780021 gbpln554.seq
818917331 gbpln555.seq
755294557 gbpln556.seq
882064051 gbpln557.seq
627203691 gbpln558.seq
993595919 gbpln559.seq
1412134403 gbpln56.seq
1021497440 gbpln560.seq
827286497 gbpln561.seq
962451301 gbpln562.seq
1082256067 gbpln563.seq
781463827 gbpln564.seq
919665368 gbpln565.seq
1497522046 gbpln566.seq
905574854 gbpln567.seq
906714977 gbpln568.seq
718743537 gbpln569.seq
1494813194 gbpln57.seq
787529633 gbpln570.seq
910251919 gbpln571.seq
608518276 gbpln572.seq
934541265 gbpln573.seq
954054955 gbpln574.seq
806443717 gbpln575.seq
1009766480 gbpln576.seq
1318260463 gbpln577.seq
1253136609 gbpln578.seq
1066198175 gbpln579.seq
1499741358 gbpln58.seq
1119572655 gbpln580.seq
1040217505 gbpln581.seq
1310077288 gbpln582.seq
955690374 gbpln583.seq
1230684440 gbpln584.seq
1179787958 gbpln585.seq
1125383520 gbpln586.seq
1051194518 gbpln587.seq
965656648 gbpln588.seq
1363518112 gbpln589.seq
1469312219 gbpln59.seq
1497325995 gbpln590.seq
787261705 gbpln591.seq
773098599 gbpln592.seq
1456694585 gbpln593.seq
1200145527 gbpln594.seq
1449107426 gbpln595.seq
1445293784 gbpln596.seq
1219201533 gbpln597.seq
1281941476 gbpln598.seq
1485920790 gbpln599.seq
1472320582 gbpln6.seq
1492223639 gbpln60.seq
1322811007 gbpln600.seq
756143249 gbpln601.seq
878426054 gbpln602.seq
631056251 gbpln603.seq
993852367 gbpln604.seq
1020132695 gbpln605.seq
830166807 gbpln606.seq
955723315 gbpln607.seq
1057964328 gbpln608.seq
784007552 gbpln609.seq
1490851663 gbpln61.seq
947940191 gbpln610.seq
857511193 gbpln611.seq
649137171 gbpln612.seq
903393879 gbpln613.seq
908180396 gbpln614.seq
721135945 gbpln615.seq
786739709 gbpln616.seq
918070756 gbpln617.seq
603192844 gbpln618.seq
938102555 gbpln619.seq
1499883058 gbpln62.seq
955978436 gbpln620.seq
1498127071 gbpln621.seq
1395899053 gbpln622.seq
768159651 gbpln623.seq
891261263 gbpln624.seq
1017239134 gbpln625.seq
1036737053 gbpln626.seq
980587319 gbpln627.seq
1096962209 gbpln628.seq
964715275 gbpln629.seq
1494639186 gbpln63.seq
883795567 gbpln630.seq
879409471 gbpln631.seq
922242639 gbpln632.seq
805484043 gbpln633.seq
912391541 gbpln634.seq
954577618 gbpln635.seq
1499999245 gbpln636.seq
1499999197 gbpln637.seq
1499999117 gbpln638.seq
1499991916 gbpln639.seq
1499294065 gbpln64.seq
1499829099 gbpln640.seq
1499925421 gbpln641.seq
1499998705 gbpln642.seq
1499854191 gbpln643.seq
1499998166 gbpln644.seq
1499868910 gbpln645.seq
1499860306 gbpln646.seq
1499730775 gbpln647.seq
1499940767 gbpln648.seq
1498662483 gbpln649.seq
1476554086 gbpln65.seq
1237339351 gbpln650.seq
865045961 gbpln651.seq
815791689 gbpln652.seq
802718902 gbpln653.seq
1497835829 gbpln654.seq
1489200818 gbpln655.seq
873797632 gbpln656.seq
820367220 gbpln657.seq
806296382 gbpln658.seq
775209384 gbpln659.seq
1484014824 gbpln66.seq
744231520 gbpln660.seq
817156402 gbpln661.seq
771380170 gbpln662.seq
913253142 gbpln663.seq
634934982 gbpln664.seq
1019175188 gbpln665.seq
1023638564 gbpln666.seq
822225605 gbpln667.seq
961290952 gbpln668.seq
1090804562 gbpln669.seq
1460344817 gbpln67.seq
813694518 gbpln670.seq
962545328 gbpln671.seq
873725319 gbpln672.seq
673190932 gbpln673.seq
905064826 gbpln674.seq
908590682 gbpln675.seq
742712720 gbpln676.seq
793279946 gbpln677.seq
934932909 gbpln678.seq
640700840 gbpln679.seq
1414624563 gbpln68.seq
961568346 gbpln680.seq
952066709 gbpln681.seq
1470907411 gbpln682.seq
1315696090 gbpln683.seq
1451561486 gbpln684.seq
1409767917 gbpln685.seq
1192999645 gbpln686.seq
1105379400 gbpln687.seq
1196658436 gbpln688.seq
1136119548 gbpln689.seq
1426038992 gbpln69.seq
1296877006 gbpln690.seq
1251013715 gbpln691.seq
1321801983 gbpln692.seq
1445650123 gbpln693.seq
761389338 gbpln694.seq
810823695 gbpln695.seq
945017875 gbpln696.seq
820289825 gbpln697.seq
819330824 gbpln698.seq
1386616317 gbpln699.seq
1486765693 gbpln7.seq
1434527576 gbpln70.seq
1365708889 gbpln700.seq
1283325611 gbpln701.seq
1090613324 gbpln702.seq
1284507799 gbpln703.seq
1122567296 gbpln704.seq
1192074506 gbpln705.seq
1181896740 gbpln706.seq
1430814492 gbpln707.seq
858786663 gbpln708.seq
1482575758 gbpln709.seq
1477836807 gbpln71.seq
1256005171 gbpln710.seq
1249214474 gbpln711.seq
1164522681 gbpln712.seq
1002097666 gbpln713.seq
1300955592 gbpln714.seq
1317957634 gbpln715.seq
1148040939 gbpln716.seq
1403417765 gbpln717.seq
1375754075 gbpln718.seq
1327873437 gbpln719.seq
1479480118 gbpln72.seq
1281078332 gbpln720.seq
1383451324 gbpln721.seq
1300107704 gbpln722.seq
1290738490 gbpln723.seq
1459920096 gbpln724.seq
1006352199 gbpln725.seq
962815279 gbpln726.seq
975138624 gbpln727.seq
906550423 gbpln728.seq
790269619 gbpln729.seq
1319684527 gbpln73.seq
956926034 gbpln730.seq
908369814 gbpln731.seq
1035806383 gbpln732.seq
1095241384 gbpln733.seq
889046375 gbpln734.seq
920177986 gbpln735.seq
934896187 gbpln736.seq
972756494 gbpln737.seq
1478454737 gbpln738.seq
1479400215 gbpln739.seq
1291834351 gbpln74.seq
1382640922 gbpln740.seq
1372701817 gbpln741.seq
1490030230 gbpln742.seq
1296249908 gbpln743.seq
1454591689 gbpln744.seq
1470492475 gbpln745.seq
1449617629 gbpln746.seq
1223515912 gbpln747.seq
1372955396 gbpln748.seq
1437909873 gbpln749.seq
1497065990 gbpln75.seq
1307026425 gbpln750.seq
1462620087 gbpln751.seq
1466603356 gbpln752.seq
1073063047 gbpln753.seq
890586335 gbpln754.seq
628166165 gbpln755.seq
1008494769 gbpln756.seq
987228439 gbpln757.seq
843057145 gbpln758.seq
959088226 gbpln759.seq
1495889390 gbpln76.seq
1080118899 gbpln760.seq
790032688 gbpln761.seq
943744807 gbpln762.seq
858758922 gbpln763.seq
664109823 gbpln764.seq
920678547 gbpln765.seq
888501596 gbpln766.seq
739915903 gbpln767.seq
788736235 gbpln768.seq
944601114 gbpln769.seq
1287363361 gbpln77.seq
621465898 gbpln770.seq
948555730 gbpln771.seq
954911742 gbpln772.seq
854893108 gbpln773.seq
752395251 gbpln774.seq
890282441 gbpln775.seq
626588937 gbpln776.seq
1004358313 gbpln777.seq
1028945402 gbpln778.seq
838465030 gbpln779.seq
1314132044 gbpln78.seq
950517847 gbpln780.seq
1082441570 gbpln781.seq
789583361 gbpln782.seq
950035125 gbpln783.seq
853507173 gbpln784.seq
659807142 gbpln785.seq
902654821 gbpln786.seq
890952839 gbpln787.seq
721824594 gbpln788.seq
785634142 gbpln789.seq
1494222303 gbpln79.seq
909002040 gbpln790.seq
625532225 gbpln791.seq
945667284 gbpln792.seq
953425672 gbpln793.seq
871481118 gbpln794.seq
1254084023 gbpln795.seq
1125916060 gbpln796.seq
1182821230 gbpln797.seq
1211366567 gbpln798.seq
746226477 gbpln799.seq
1422472053 gbpln8.seq
1439085729 gbpln80.seq
808684469 gbpln800.seq
907082918 gbpln801.seq
776688264 gbpln802.seq
1492098096 gbpln803.seq
1287386861 gbpln804.seq
1186027473 gbpln805.seq
1009876518 gbpln806.seq
1484585650 gbpln807.seq
1144766377 gbpln808.seq
752395251 gbpln809.seq
1429889919 gbpln81.seq
890282441 gbpln810.seq
626588937 gbpln811.seq
1004358313 gbpln812.seq
1028945402 gbpln813.seq
838465030 gbpln814.seq
950517847 gbpln815.seq
1082441570 gbpln816.seq
789583361 gbpln817.seq
950035125 gbpln818.seq
853507173 gbpln819.seq
1405317085 gbpln82.seq
659807142 gbpln820.seq
902654821 gbpln821.seq
890952839 gbpln822.seq
721824594 gbpln823.seq
785634142 gbpln824.seq
909002040 gbpln825.seq
625532225 gbpln826.seq
945667284 gbpln827.seq
953425672 gbpln828.seq
1496390981 gbpln829.seq
1341413688 gbpln83.seq
660302477 gbpln830.seq
841140962 gbpln831.seq
1479991498 gbpln832.seq
1471774772 gbpln833.seq
1471086893 gbpln834.seq
1484902160 gbpln835.seq
1468998773 gbpln836.seq
1490807609 gbpln837.seq
1479849438 gbpln838.seq
1498136456 gbpln839.seq
1264034698 gbpln84.seq
1470643875 gbpln840.seq
1445523370 gbpln841.seq
1467112606 gbpln842.seq
1473756857 gbpln843.seq
1466744422 gbpln844.seq
1445506294 gbpln845.seq
1405467369 gbpln846.seq
1440178564 gbpln847.seq
1419442824 gbpln848.seq
1178669529 gbpln849.seq
1236764828 gbpln85.seq
1133887256 gbpln850.seq
1282582447 gbpln851.seq
1160190605 gbpln852.seq
1282512360 gbpln853.seq
1043162667 gbpln854.seq
1452812128 gbpln855.seq
1208509936 gbpln856.seq
1213224737 gbpln857.seq
1281435424 gbpln858.seq
1228042622 gbpln859.seq
1491215499 gbpln86.seq
1234498850 gbpln860.seq
1039601570 gbpln861.seq
1415405341 gbpln862.seq
1373333043 gbpln863.seq
1281584440 gbpln864.seq
1259875101 gbpln865.seq
1314232327 gbpln866.seq
817451269 gbpln867.seq
716975954 gbpln868.seq
888116044 gbpln869.seq
1459648960 gbpln87.seq
1464078034 gbpln870.seq
1378600950 gbpln871.seq
1230029992 gbpln872.seq
1331088471 gbpln873.seq
1200830607 gbpln874.seq
1307198823 gbpln875.seq
1133282366 gbpln876.seq
1212126107 gbpln877.seq
1131270577 gbpln878.seq
749094537 gbpln879.seq
1262658372 gbpln88.seq
814254329 gbpln880.seq
912544337 gbpln881.seq
784096665 gbpln882.seq
1481092451 gbpln883.seq
1299467738 gbpln884.seq
1170366333 gbpln885.seq
1022731835 gbpln886.seq
1308956706 gbpln887.seq
1124459634 gbpln888.seq
1266075131 gbpln889.seq
1488086519 gbpln89.seq
1076006545 gbpln890.seq
1319697273 gbpln891.seq
806193452 gbpln892.seq
904824619 gbpln893.seq
776420566 gbpln894.seq
1492527279 gbpln895.seq
1275668669 gbpln896.seq
1097153240 gbpln897.seq
984429897 gbpln898.seq
1016771778 gbpln899.seq
1201022408 gbpln9.seq
1407723759 gbpln90.seq
1128314147 gbpln900.seq
1245113516 gbpln901.seq
1159055196 gbpln902.seq
895546793 gbpln903.seq
732992509 gbpln904.seq
798139251 gbpln905.seq
921791411 gbpln906.seq
777495740 gbpln907.seq
1494182531 gbpln908.seq
1279159076 gbpln909.seq
1494162414 gbpln91.seq
1162567100 gbpln910.seq
1000863545 gbpln911.seq
1307492273 gbpln912.seq
1133043144 gbpln913.seq
1248802672 gbpln914.seq
1173666621 gbpln915.seq
1346583215 gbpln916.seq
807446381 gbpln917.seq
917394369 gbpln918.seq
777668408 gbpln919.seq
1499473543 gbpln92.seq
1483200298 gbpln920.seq
1468292026 gbpln921.seq
1368729133 gbpln922.seq
1441459338 gbpln923.seq
1481188073 gbpln924.seq
1441199233 gbpln925.seq
1400519594 gbpln926.seq
1484052945 gbpln927.seq
1375272527 gbpln928.seq
898515699 gbpln929.seq
1487837254 gbpln93.seq
632798067 gbpln930.seq
1008257788 gbpln931.seq
1024893842 gbpln932.seq
849343522 gbpln933.seq
961475221 gbpln934.seq
1105698152 gbpln935.seq
806976195 gbpln936.seq
970150207 gbpln937.seq
872155147 gbpln938.seq
676154305 gbpln939.seq
1486652589 gbpln94.seq
905516657 gbpln940.seq
922918714 gbpln941.seq
742368796 gbpln942.seq
788401309 gbpln943.seq
929538814 gbpln944.seq
641895880 gbpln945.seq
961976329 gbpln946.seq
973033562 gbpln947.seq
834845430 gbpln948.seq
1096228945 gbpln949.seq
1497919667 gbpln95.seq
1065747701 gbpln950.seq
978382753 gbpln951.seq
970377845 gbpln952.seq
932157797 gbpln953.seq
878151180 gbpln954.seq
874085481 gbpln955.seq
829265282 gbpln956.seq
863296712 gbpln957.seq
823515696 gbpln958.seq
815413878 gbpln959.seq
1405100855 gbpln96.seq
1384284611 gbpln960.seq
1351462558 gbpln961.seq
1230738646 gbpln962.seq
541733671 gbpln963.seq
2012725364 gbpln964.seq
2313576156 gbpln965.seq
2199353950 gbpln966.seq
2096617948 gbpln967.seq
2106642320 gbpln968.seq
1745413839 gbpln969.seq
1493640099 gbpln97.seq
1943630373 gbpln970.seq
1096169796 gbpln971.seq
836152673 gbpln972.seq
790234194 gbpln973.seq
768134126 gbpln974.seq
1464177021 gbpln975.seq
1454383718 gbpln976.seq
839765734 gbpln977.seq
794136795 gbpln978.seq
777214951 gbpln979.seq
1449684761 gbpln98.seq
1459963687 gbpln980.seq
1453910479 gbpln981.seq
831555004 gbpln982.seq
787385081 gbpln983.seq
774061568 gbpln984.seq
1444041489 gbpln985.seq
1462025010 gbpln986.seq
837904862 gbpln987.seq
793009108 gbpln988.seq
770582515 gbpln989.seq
1498450083 gbpln99.seq
1458992600 gbpln990.seq
1472670481 gbpln991.seq
837974598 gbpln992.seq
802983165 gbpln993.seq
776399714 gbpln994.seq
1452076153 gbpln995.seq
1467682458 gbpln996.seq
841987686 gbpln997.seq
800255273 gbpln998.seq
776782162 gbpln999.seq
1499991558 gbpri1.seq
1394043154 gbpri10.seq
1308233895 gbpri11.seq
1352591724 gbpri12.seq
1495555692 gbpri13.seq
1402237462 gbpri14.seq
1487902997 gbpri15.seq
1347857626 gbpri16.seq
1491380503 gbpri17.seq
1397668511 gbpri18.seq
1369669675 gbpri19.seq
1499865965 gbpri2.seq
1439722150 gbpri20.seq
1499998210 gbpri21.seq
1499989183 gbpri22.seq
1443703311 gbpri23.seq
1493653611 gbpri24.seq
1489331054 gbpri25.seq
1493262066 gbpri26.seq
1498291138 gbpri27.seq
270302703 gbpri28.seq
1499835984 gbpri3.seq
1499966483 gbpri4.seq
1499766916 gbpri5.seq
1372350935 gbpri6.seq
1440746568 gbpri7.seq
1473652046 gbpri8.seq
1441991843 gbpri9.seq
908335 gbrel.txt
1499877474 gbrod1.seq
1477931319 gbrod10.seq
1443709248 gbrod100.seq
1487930170 gbrod101.seq
1352000298 gbrod102.seq
1497255342 gbrod103.seq
1215970140 gbrod104.seq
1323685727 gbrod105.seq
1425029177 gbrod106.seq
1436426304 gbrod107.seq
1498137432 gbrod108.seq
1384334707 gbrod109.seq
1365976721 gbrod11.seq
1497989819 gbrod110.seq
1369807944 gbrod111.seq
1375688364 gbrod112.seq
1183132641 gbrod113.seq
1212798272 gbrod114.seq
1481642425 gbrod115.seq
1470331296 gbrod12.seq
1417227931 gbrod13.seq
1471007422 gbrod14.seq
1438813865 gbrod15.seq
1490541127 gbrod16.seq
1384684960 gbrod17.seq
1420672254 gbrod18.seq
1475952043 gbrod19.seq
1499967437 gbrod2.seq
1397046843 gbrod20.seq
1351547492 gbrod21.seq
1434496523 gbrod22.seq
1387638765 gbrod23.seq
1486251329 gbrod24.seq
1347390436 gbrod25.seq
1452122190 gbrod26.seq
1353193118 gbrod27.seq
1370231234 gbrod28.seq
1370743208 gbrod29.seq
1499850426 gbrod3.seq
1453193685 gbrod30.seq
1484525776 gbrod31.seq
1406105502 gbrod32.seq
1474692538 gbrod33.seq
1404292919 gbrod34.seq
1358612176 gbrod35.seq
1325901204 gbrod36.seq
1445832321 gbrod37.seq
1301809704 gbrod38.seq
1459759409 gbrod39.seq
1499996021 gbrod4.seq
1371820929 gbrod40.seq
1379541974 gbrod41.seq
1447951148 gbrod42.seq
1358076947 gbrod43.seq
1393051649 gbrod44.seq
1377941029 gbrod45.seq
1484184886 gbrod46.seq
1439114050 gbrod47.seq
1409951130 gbrod48.seq
1472027087 gbrod49.seq
1240770321 gbrod5.seq
1372610888 gbrod50.seq
1482622482 gbrod51.seq
1393105943 gbrod52.seq
1451159866 gbrod53.seq
1434520361 gbrod54.seq
1444092726 gbrod55.seq
1361891899 gbrod56.seq
1453486986 gbrod57.seq
1458676727 gbrod58.seq
1379094101 gbrod59.seq
1403075066 gbrod6.seq
1475060334 gbrod60.seq
1359296239 gbrod61.seq
1465899229 gbrod62.seq
1295906456 gbrod63.seq
1477278364 gbrod64.seq
1378018089 gbrod65.seq
1390451722 gbrod66.seq
1462626302 gbrod67.seq
1299128117 gbrod68.seq
1371052535 gbrod69.seq
1462509765 gbrod7.seq
1444445568 gbrod70.seq
1478048412 gbrod71.seq
1480151384 gbrod72.seq
1426832728 gbrod73.seq
1455522110 gbrod74.seq
1332398568 gbrod75.seq
1471786581 gbrod76.seq
1376661169 gbrod77.seq
1454859611 gbrod78.seq
1295571253 gbrod79.seq
1380850319 gbrod8.seq
1399344953 gbrod80.seq
1315896821 gbrod81.seq
1411009597 gbrod82.seq
1453282390 gbrod83.seq
1391252549 gbrod84.seq
1498811032 gbrod85.seq
1444865055 gbrod86.seq
1488474687 gbrod87.seq
1331476829 gbrod88.seq
1465473324 gbrod89.seq
1395344650 gbrod9.seq
1416734769 gbrod90.seq
1486479413 gbrod91.seq
1462152570 gbrod92.seq
1423079792 gbrod93.seq
1368356742 gbrod94.seq
1452029512 gbrod95.seq
1391575059 gbrod96.seq
1477641360 gbrod97.seq
1461787631 gbrod98.seq
1303790964 gbrod99.seq
1499999781 gbsts1.seq
1499998829 gbsts2.seq
1449788585 gbsts3.seq
1434557915 gbsyn1.seq
157796814 gbsyn10.seq
1317756404 gbsyn2.seq
1363478773 gbsyn3.seq
1429349564 gbsyn4.seq
1317756374 gbsyn5.seq
1363478755 gbsyn6.seq
1499793795 gbsyn7.seq
1499969385 gbsyn8.seq
1499559423 gbsyn9.seq
1499999359 gbtsa1.seq
1499998508 gbtsa10.seq
1500000159 gbtsa11.seq
1500000201 gbtsa12.seq
1499993158 gbtsa13.seq
1499998613 gbtsa14.seq
1499997759 gbtsa15.seq
1499998876 gbtsa16.seq
1499998539 gbtsa17.seq
1499995974 gbtsa18.seq
1499999739 gbtsa19.seq
1499998717 gbtsa2.seq
1499997897 gbtsa20.seq
1499998549 gbtsa21.seq
1499999000 gbtsa22.seq
1499997559 gbtsa23.seq
1499998735 gbtsa24.seq
1499998860 gbtsa25.seq
1499996876 gbtsa26.seq
1499995576 gbtsa27.seq
1499995973 gbtsa28.seq
1499997623 gbtsa29.seq
1499998829 gbtsa3.seq
1499998212 gbtsa30.seq
1499998363 gbtsa31.seq
1499996349 gbtsa32.seq
1499999114 gbtsa33.seq
1499999214 gbtsa34.seq
1500000041 gbtsa35.seq
1499998235 gbtsa36.seq
172310036 gbtsa37.seq
1499998170 gbtsa4.seq
1499998155 gbtsa5.seq
1499997467 gbtsa6.seq
1499998473 gbtsa7.seq
1499999789 gbtsa8.seq
1499999573 gbtsa9.seq
7358236 gbuna1.seq
1499994032 gbvrl1.seq
1499998007 gbvrl10.seq
1499998833 gbvrl100.seq
1499939847 gbvrl101.seq
1499982432 gbvrl102.seq
1499989456 gbvrl103.seq
1499942897 gbvrl104.seq
1499985291 gbvrl105.seq
1499944925 gbvrl106.seq
1499939580 gbvrl107.seq
1499979559 gbvrl108.seq
1499938745 gbvrl109.seq
1499813025 gbvrl11.seq
1499944227 gbvrl110.seq
1499937160 gbvrl111.seq
1499964447 gbvrl112.seq
1499934908 gbvrl113.seq
1499997727 gbvrl114.seq
1499996116 gbvrl115.seq
1499994815 gbvrl116.seq
1499936457 gbvrl117.seq
1499933831 gbvrl118.seq
1499949451 gbvrl119.seq
1499995770 gbvrl12.seq
1499937520 gbvrl120.seq
1499985141 gbvrl121.seq
1499946597 gbvrl122.seq
1499979615 gbvrl123.seq
1499941731 gbvrl124.seq
1499999142 gbvrl125.seq
1499933856 gbvrl126.seq
1499956828 gbvrl127.seq
1499973634 gbvrl128.seq
1499958015 gbvrl129.seq
1499965242 gbvrl13.seq
1499981654 gbvrl130.seq
1499991269 gbvrl131.seq
1499933955 gbvrl132.seq
1499969253 gbvrl133.seq
1499976888 gbvrl134.seq
1499986770 gbvrl135.seq
1499981249 gbvrl136.seq
1499955662 gbvrl137.seq
1499999411 gbvrl138.seq
1499942861 gbvrl139.seq
1499992395 gbvrl14.seq
1499958398 gbvrl140.seq
1499963642 gbvrl141.seq
1499967897 gbvrl142.seq
1499954052 gbvrl143.seq
1499995742 gbvrl144.seq
1499961529 gbvrl145.seq
1499963236 gbvrl146.seq
1499964488 gbvrl147.seq
1499965082 gbvrl148.seq
1499961441 gbvrl149.seq
1499970829 gbvrl15.seq
1499954305 gbvrl150.seq
1499969383 gbvrl151.seq
1499974215 gbvrl152.seq
1499959317 gbvrl153.seq
1499966619 gbvrl154.seq
1499983541 gbvrl155.seq
1499948002 gbvrl156.seq
1499944995 gbvrl157.seq
1499968775 gbvrl158.seq
1499957890 gbvrl159.seq
1499958533 gbvrl16.seq
1499995789 gbvrl160.seq
1499971493 gbvrl161.seq
1499994768 gbvrl162.seq
1499974131 gbvrl163.seq
1499944941 gbvrl164.seq
1499986849 gbvrl165.seq
1499964536 gbvrl166.seq
1499975415 gbvrl167.seq
1499937842 gbvrl168.seq
1499937148 gbvrl169.seq
1499972468 gbvrl17.seq
1499956615 gbvrl170.seq
1499959248 gbvrl171.seq
1499997263 gbvrl172.seq
1499996456 gbvrl173.seq
1499990774 gbvrl174.seq
1499965858 gbvrl175.seq
1499967836 gbvrl176.seq
1499951875 gbvrl177.seq
1499994200 gbvrl178.seq
1499810522 gbvrl179.seq
1499982932 gbvrl18.seq
1499954410 gbvrl180.seq
1499971707 gbvrl181.seq
1499987420 gbvrl182.seq
1499995279 gbvrl183.seq
1499947824 gbvrl184.seq
1499967881 gbvrl185.seq
1499999545 gbvrl186.seq
1499976355 gbvrl187.seq
1499974392 gbvrl188.seq
1499983016 gbvrl189.seq
1499960502 gbvrl19.seq
1499994185 gbvrl190.seq
1499999788 gbvrl191.seq
1499990501 gbvrl192.seq
1499986266 gbvrl193.seq
1499968790 gbvrl194.seq
1499976538 gbvrl195.seq
1499977109 gbvrl196.seq
1499963938 gbvrl197.seq
1499976852 gbvrl198.seq
1499961978 gbvrl199.seq
1499997042 gbvrl2.seq
1499952684 gbvrl20.seq
1499999043 gbvrl200.seq
1499961152 gbvrl201.seq
1499980165 gbvrl202.seq
1499979593 gbvrl203.seq
1499975328 gbvrl204.seq
1499995982 gbvrl205.seq
1499981052 gbvrl206.seq
1499994291 gbvrl207.seq
1499989619 gbvrl208.seq
1499984801 gbvrl209.seq
1499993210 gbvrl21.seq
1499988380 gbvrl210.seq
1499977165 gbvrl211.seq
1499967703 gbvrl212.seq
1499967212 gbvrl213.seq
1499962347 gbvrl214.seq
1499979598 gbvrl215.seq
1499966768 gbvrl216.seq
1499977152 gbvrl217.seq
1499961958 gbvrl218.seq
1499960040 gbvrl219.seq
1499954797 gbvrl22.seq
1499965291 gbvrl220.seq
1499996146 gbvrl221.seq
1499997170 gbvrl222.seq
1499974415 gbvrl223.seq
1499974657 gbvrl224.seq
1499979021 gbvrl225.seq
1499974854 gbvrl226.seq
1499998073 gbvrl227.seq
1499965173 gbvrl228.seq
1499966311 gbvrl229.seq
1499955887 gbvrl23.seq
1499966229 gbvrl230.seq
1499962236 gbvrl231.seq
1499998871 gbvrl232.seq
1499985030 gbvrl233.seq
1499973931 gbvrl234.seq
1499999539 gbvrl235.seq
1499972123 gbvrl236.seq
1499987289 gbvrl237.seq
1499983417 gbvrl238.seq
1499986042 gbvrl239.seq
1499970011 gbvrl24.seq
1499985375 gbvrl240.seq
1499966663 gbvrl241.seq
1499962748 gbvrl242.seq
1499969244 gbvrl243.seq
1499971740 gbvrl244.seq
1499978989 gbvrl245.seq
1499971627 gbvrl246.seq
1499995231 gbvrl247.seq
1499991713 gbvrl248.seq
1499991149 gbvrl249.seq
1499950408 gbvrl25.seq
1499963948 gbvrl250.seq
1499992131 gbvrl251.seq
1500000011 gbvrl252.seq
1499987193 gbvrl253.seq
1499982065 gbvrl254.seq
1499967874 gbvrl255.seq
1499973420 gbvrl256.seq
1499961775 gbvrl257.seq
1499979895 gbvrl258.seq
1499970291 gbvrl259.seq
1499990796 gbvrl26.seq
1499966632 gbvrl260.seq
1499992771 gbvrl261.seq
1499991883 gbvrl262.seq
1499991948 gbvrl263.seq
1499986076 gbvrl264.seq
1499981821 gbvrl265.seq
1499981402 gbvrl266.seq
1499985442 gbvrl267.seq
1499971508 gbvrl268.seq
1499981167 gbvrl269.seq
1499948816 gbvrl27.seq
1499979892 gbvrl270.seq
1499976476 gbvrl271.seq
1499982534 gbvrl272.seq
1499986905 gbvrl273.seq
1499989831 gbvrl274.seq
1499976785 gbvrl275.seq
1499970545 gbvrl276.seq
1499981109 gbvrl277.seq
1499965345 gbvrl278.seq
1499959257 gbvrl279.seq
1499948956 gbvrl28.seq
1499993725 gbvrl280.seq
1499985523 gbvrl281.seq
1499995791 gbvrl282.seq
1499959376 gbvrl283.seq
1499986142 gbvrl284.seq
1499982201 gbvrl285.seq
1499962845 gbvrl286.seq
1499991786 gbvrl287.seq
1499978777 gbvrl288.seq
1499984426 gbvrl289.seq
1499954581 gbvrl29.seq
1499976686 gbvrl290.seq
1499962396 gbvrl291.seq
1499990676 gbvrl292.seq
1499976338 gbvrl293.seq
1499981341 gbvrl294.seq
1499987027 gbvrl295.seq
1499964273 gbvrl296.seq
1499981919 gbvrl297.seq
1499978524 gbvrl298.seq
1499968577 gbvrl299.seq
1499996547 gbvrl3.seq
1499950580 gbvrl30.seq
1499978631 gbvrl300.seq
1499985280 gbvrl301.seq
1499961076 gbvrl302.seq
1499985660 gbvrl303.seq
1499973480 gbvrl304.seq
1499983519 gbvrl305.seq
1499975982 gbvrl306.seq
1499962692 gbvrl307.seq
1499962948 gbvrl308.seq
1499964576 gbvrl309.seq
1499978596 gbvrl31.seq
1499964420 gbvrl310.seq
1499973644 gbvrl311.seq
1499982252 gbvrl312.seq
1499997777 gbvrl313.seq
1499991136 gbvrl314.seq
1499997802 gbvrl315.seq
1499962248 gbvrl316.seq
1499976871 gbvrl317.seq
1499981562 gbvrl318.seq
1499993278 gbvrl319.seq
1499986518 gbvrl32.seq
1499961997 gbvrl320.seq
1499989772 gbvrl321.seq
1499996248 gbvrl322.seq
1500000092 gbvrl323.seq
1499996846 gbvrl324.seq
1499998415 gbvrl325.seq
1499964071 gbvrl326.seq
1499986975 gbvrl327.seq
1499978705 gbvrl328.seq
1499952865 gbvrl329.seq
1499939016 gbvrl33.seq
1499976542 gbvrl330.seq
1499936503 gbvrl331.seq
1499979618 gbvrl332.seq
1499982786 gbvrl333.seq
1499995868 gbvrl334.seq
1499961257 gbvrl335.seq
1499998092 gbvrl336.seq
1499996819 gbvrl337.seq
1500000246 gbvrl338.seq
1499994292 gbvrl339.seq
1499987329 gbvrl34.seq
690086825 gbvrl340.seq
1499963323 gbvrl35.seq
1500000156 gbvrl36.seq
1499945797 gbvrl37.seq
1499937302 gbvrl38.seq
1499951341 gbvrl39.seq
1499981278 gbvrl4.seq
1499993300 gbvrl40.seq
1499964019 gbvrl41.seq
1499976919 gbvrl42.seq
1499984328 gbvrl43.seq
1499965536 gbvrl44.seq
1499999893 gbvrl45.seq
1499937094 gbvrl46.seq
1499951383 gbvrl47.seq
1499985620 gbvrl48.seq
1499996208 gbvrl49.seq
1499995749 gbvrl5.seq
1499996163 gbvrl50.seq
1499950135 gbvrl51.seq
1499987965 gbvrl52.seq
1499935811 gbvrl53.seq
1499950725 gbvrl54.seq
1499942911 gbvrl55.seq
1499969497 gbvrl56.seq
1499953682 gbvrl57.seq
1499971808 gbvrl58.seq
1499982272 gbvrl59.seq
1499946483 gbvrl6.seq
1499974874 gbvrl60.seq
1499966268 gbvrl61.seq
1499943286 gbvrl62.seq
1499938987 gbvrl63.seq
1499970878 gbvrl64.seq
1499942383 gbvrl65.seq
1499962119 gbvrl66.seq
1499993227 gbvrl67.seq
1499951992 gbvrl68.seq
1499936749 gbvrl69.seq
1499996286 gbvrl7.seq
1499948451 gbvrl70.seq
1499979039 gbvrl71.seq
1499934366 gbvrl72.seq
1499986678 gbvrl73.seq
1499992945 gbvrl74.seq
1499945892 gbvrl75.seq
1499954068 gbvrl76.seq
1499990024 gbvrl77.seq
1499936140 gbvrl78.seq
1499985387 gbvrl79.seq
1499996627 gbvrl8.seq
1499973763 gbvrl80.seq
1499949613 gbvrl81.seq
1499996783 gbvrl82.seq
1499966277 gbvrl83.seq
1499940018 gbvrl84.seq
1499993188 gbvrl85.seq
1499947586 gbvrl86.seq
1499967448 gbvrl87.seq
1499962742 gbvrl88.seq
1499935681 gbvrl89.seq
1499989326 gbvrl9.seq
1499951021 gbvrl90.seq
1499988682 gbvrl91.seq
1499984902 gbvrl92.seq
1499933806 gbvrl93.seq
1499974802 gbvrl94.seq
1499957752 gbvrl95.seq
1499959941 gbvrl96.seq
1499952811 gbvrl97.seq
1499985997 gbvrl98.seq
1499980135 gbvrl99.seq
1468752499 gbvrt1.seq
1282109096 gbvrt10.seq
1495827000 gbvrt100.seq
1495396215 gbvrt101.seq
1484013560 gbvrt102.seq
1482078002 gbvrt103.seq
1197613438 gbvrt104.seq
1262095184 gbvrt105.seq
1090722360 gbvrt106.seq
1424049174 gbvrt107.seq
1496909957 gbvrt108.seq
1493025075 gbvrt109.seq
1394599173 gbvrt11.seq
1320575219 gbvrt110.seq
1436638097 gbvrt111.seq
1458922406 gbvrt112.seq
1491575244 gbvrt113.seq
1281300277 gbvrt114.seq
1411652468 gbvrt115.seq
1421545558 gbvrt116.seq
1476891269 gbvrt117.seq
1386060829 gbvrt118.seq
1433021643 gbvrt119.seq
1454801948 gbvrt12.seq
1497612563 gbvrt120.seq
1486330678 gbvrt121.seq
1462604299 gbvrt122.seq
1476857854 gbvrt123.seq
1488438777 gbvrt124.seq
1462478284 gbvrt125.seq
1498078979 gbvrt126.seq
1484861739 gbvrt127.seq
1477143564 gbvrt128.seq
1483219404 gbvrt129.seq
1490402563 gbvrt13.seq
1463588150 gbvrt130.seq
1491354277 gbvrt131.seq
1497114650 gbvrt132.seq
1478208496 gbvrt133.seq
1462060438 gbvrt134.seq
1385911851 gbvrt135.seq
1470368193 gbvrt136.seq
1487646132 gbvrt137.seq
1420160724 gbvrt138.seq
1491622767 gbvrt139.seq
1457665213 gbvrt14.seq
1480809421 gbvrt140.seq
1474599966 gbvrt141.seq
1498459033 gbvrt142.seq
1436819628 gbvrt143.seq
1480754470 gbvrt144.seq
1473702580 gbvrt145.seq
1483456760 gbvrt146.seq
1460587689 gbvrt147.seq
1491277907 gbvrt148.seq
1433698722 gbvrt149.seq
1477785081 gbvrt15.seq
1392969255 gbvrt150.seq
1458594989 gbvrt151.seq
1497316015 gbvrt152.seq
1416739574 gbvrt153.seq
1485249531 gbvrt154.seq
1468995634 gbvrt155.seq
1495839785 gbvrt156.seq
1361029027 gbvrt157.seq
1454564111 gbvrt158.seq
1463902579 gbvrt159.seq
1494487498 gbvrt16.seq
1483704254 gbvrt160.seq
1320939161 gbvrt161.seq
1450812981 gbvrt162.seq
1478017801 gbvrt163.seq
1392442116 gbvrt164.seq
1496121979 gbvrt165.seq
1429716567 gbvrt166.seq
1495014546 gbvrt167.seq
1444533644 gbvrt168.seq
1472525288 gbvrt169.seq
1489663143 gbvrt17.seq
1371889473 gbvrt170.seq
1458168336 gbvrt171.seq
1480325666 gbvrt172.seq
1333470830 gbvrt173.seq
1339390452 gbvrt174.seq
1446769447 gbvrt175.seq
1432904863 gbvrt176.seq
1469966670 gbvrt177.seq
1484040009 gbvrt178.seq
1496855706 gbvrt179.seq
1490286731 gbvrt18.seq
1433040470 gbvrt180.seq
1375266246 gbvrt181.seq
1483347947 gbvrt182.seq
1364574160 gbvrt183.seq
1442347330 gbvrt184.seq
1494535064 gbvrt185.seq
1440727248 gbvrt186.seq
1472724385 gbvrt187.seq
1399605061 gbvrt188.seq
1291348384 gbvrt189.seq
1491870853 gbvrt19.seq
1492986566 gbvrt190.seq
1497829903 gbvrt191.seq
1436699186 gbvrt192.seq
1173719027 gbvrt193.seq
1470502273 gbvrt194.seq
1336897357 gbvrt195.seq
1451022601 gbvrt196.seq
1496444625 gbvrt197.seq
1452606394 gbvrt198.seq
1498405608 gbvrt199.seq
1488073608 gbvrt2.seq
1499998255 gbvrt20.seq
1458261551 gbvrt200.seq
1422476619 gbvrt201.seq
1465708115 gbvrt202.seq
1479745451 gbvrt203.seq
1495244154 gbvrt204.seq
1468455350 gbvrt205.seq
1484551004 gbvrt206.seq
1341285700 gbvrt207.seq
1391197912 gbvrt208.seq
1409281707 gbvrt209.seq
1331576692 gbvrt21.seq
1244065533 gbvrt210.seq
1487136121 gbvrt211.seq
1490014032 gbvrt212.seq
1493866969 gbvrt213.seq
1487060040 gbvrt214.seq
1485132106 gbvrt215.seq
1449198453 gbvrt216.seq
1499714857 gbvrt217.seq
1410198280 gbvrt218.seq
1147311112 gbvrt219.seq
1499999251 gbvrt22.seq
1750969594 gbvrt220.seq
1582584122 gbvrt221.seq
1439178988 gbvrt222.seq
1385914538 gbvrt223.seq
1260623871 gbvrt224.seq
1241027078 gbvrt225.seq
1394205943 gbvrt226.seq
647635060 gbvrt227.seq
1800655812 gbvrt228.seq
1625880297 gbvrt229.seq
1499998243 gbvrt23.seq
1452341451 gbvrt230.seq
1413268707 gbvrt231.seq
1301679404 gbvrt232.seq
1265017882 gbvrt233.seq
1398329117 gbvrt234.seq
646313711 gbvrt235.seq
2486764648 gbvrt236.seq
2399841711 gbvrt237.seq
2168065652 gbvrt238.seq
1730481357 gbvrt239.seq
1499996983 gbvrt24.seq
1674077467 gbvrt240.seq
1643880041 gbvrt241.seq
1613167793 gbvrt242.seq
1585967368 gbvrt243.seq
1573317635 gbvrt244.seq
1525189779 gbvrt245.seq
1522308102 gbvrt246.seq
1503557506 gbvrt247.seq
1502833827 gbvrt248.seq
1439581620 gbvrt249.seq
1499997960 gbvrt25.seq
1297818631 gbvrt250.seq
1258324368 gbvrt251.seq
1369247334 gbvrt252.seq
1368865938 gbvrt253.seq
1472115430 gbvrt254.seq
1449680126 gbvrt255.seq
1309689855 gbvrt256.seq
1469430849 gbvrt257.seq
1466100957 gbvrt258.seq
1392101492 gbvrt259.seq
1499771203 gbvrt26.seq
1390671725 gbvrt260.seq
1408841519 gbvrt261.seq
1498224495 gbvrt262.seq
1475026708 gbvrt263.seq
1464576040 gbvrt264.seq
1459906041 gbvrt265.seq
1465282649 gbvrt266.seq
286802878 gbvrt267.seq
2737865440 gbvrt268.seq
582597811 gbvrt269.seq
1499982879 gbvrt27.seq
2729824435 gbvrt270.seq
666748676 gbvrt271.seq
2720117404 gbvrt272.seq
646964638 gbvrt273.seq
2731547963 gbvrt274.seq
195179179 gbvrt275.seq
2734657827 gbvrt276.seq
21623841 gbvrt277.seq
2728895745 gbvrt278.seq
2505979018 gbvrt279.seq
1499349953 gbvrt28.seq
2204702755 gbvrt280.seq
1642333222 gbvrt281.seq
1549476405 gbvrt282.seq
1535228181 gbvrt283.seq
1466613005 gbvrt284.seq
1478204774 gbvrt285.seq
1470950309 gbvrt286.seq
186687778 gbvrt287.seq
2736013151 gbvrt288.seq
466831313 gbvrt289.seq
1470118406 gbvrt29.seq
2724707547 gbvrt290.seq
428842069 gbvrt291.seq
2726904396 gbvrt292.seq
418344636 gbvrt293.seq
2737394570 gbvrt294.seq
32900508 gbvrt295.seq
2595542382 gbvrt296.seq
2455087006 gbvrt297.seq
2265220339 gbvrt298.seq
2012454031 gbvrt299.seq
1487660705 gbvrt3.seq
1462956165 gbvrt30.seq
1582208555 gbvrt300.seq
1469382459 gbvrt301.seq
1410611776 gbvrt302.seq
1422258498 gbvrt303.seq
1462005873 gbvrt304.seq
1484741498 gbvrt305.seq
1485090184 gbvrt306.seq
1490726491 gbvrt307.seq
1409295542 gbvrt308.seq
1415524312 gbvrt309.seq
1469625725 gbvrt31.seq
1419887839 gbvrt310.seq
1489004865 gbvrt311.seq
1440469467 gbvrt312.seq
1434214929 gbvrt313.seq
1463440865 gbvrt314.seq
1461640335 gbvrt315.seq
1416024276 gbvrt316.seq
1472880226 gbvrt317.seq
1486571850 gbvrt318.seq
1457522589 gbvrt319.seq
1413169454 gbvrt32.seq
1469858789 gbvrt320.seq
1275996161 gbvrt321.seq
1473886314 gbvrt322.seq
1407628850 gbvrt323.seq
1470508850 gbvrt324.seq
1490724356 gbvrt325.seq
1487540532 gbvrt326.seq
1427325051 gbvrt327.seq
1439839498 gbvrt328.seq
1072255647 gbvrt329.seq
1296370380 gbvrt33.seq
1417155344 gbvrt330.seq
1328714210 gbvrt331.seq
1135819087 gbvrt332.seq
952384782 gbvrt333.seq
872251544 gbvrt334.seq
858760811 gbvrt335.seq
1138273420 gbvrt336.seq
1420474204 gbvrt337.seq
1408136024 gbvrt338.seq
1486210615 gbvrt339.seq
1275178748 gbvrt34.seq
1489796585 gbvrt340.seq
1401076841 gbvrt341.seq
1473258470 gbvrt342.seq
1404838293 gbvrt343.seq
1473583203 gbvrt344.seq
1404913548 gbvrt345.seq
1477020194 gbvrt346.seq
1397059913 gbvrt347.seq
1475549804 gbvrt348.seq
1410126884 gbvrt349.seq
1464690866 gbvrt35.seq
1472429474 gbvrt350.seq
1388472387 gbvrt351.seq
1444039874 gbvrt352.seq
1448790743 gbvrt353.seq
1444806391 gbvrt354.seq
1354493522 gbvrt355.seq
1475110803 gbvrt356.seq
1407513438 gbvrt357.seq
1470754045 gbvrt358.seq
1410492150 gbvrt359.seq
1472900752 gbvrt36.seq
1451274358 gbvrt360.seq
1491827559 gbvrt361.seq
1469217906 gbvrt362.seq
1431508692 gbvrt363.seq
1465875271 gbvrt364.seq
1492092147 gbvrt365.seq
1489236528 gbvrt366.seq
1431830177 gbvrt367.seq
1408044624 gbvrt368.seq
1479094683 gbvrt369.seq
1494357791 gbvrt37.seq
1439463209 gbvrt370.seq
1496026598 gbvrt371.seq
1255931528 gbvrt372.seq
1480007582 gbvrt373.seq
1462048160 gbvrt374.seq
1489631834 gbvrt375.seq
1467867486 gbvrt376.seq
1221284964 gbvrt377.seq
1393845451 gbvrt378.seq
1428120823 gbvrt379.seq
711507248 gbvrt38.seq
1390966277 gbvrt380.seq
1351498425 gbvrt381.seq
1346310370 gbvrt382.seq
1481311708 gbvrt383.seq
1487234842 gbvrt384.seq
1367267779 gbvrt385.seq
1482474115 gbvrt386.seq
1473198814 gbvrt387.seq
1485655241 gbvrt388.seq
1465537646 gbvrt389.seq
1063697372 gbvrt39.seq
1498352825 gbvrt390.seq
1452420537 gbvrt391.seq
1499581995 gbvrt392.seq
1405469990 gbvrt393.seq
1462829681 gbvrt394.seq
1387786791 gbvrt395.seq
1460116530 gbvrt396.seq
1463364218 gbvrt397.seq
1466761052 gbvrt398.seq
1474907543 gbvrt399.seq
1500000195 gbvrt4.seq
1045817455 gbvrt40.seq
1484337526 gbvrt400.seq
1488915586 gbvrt401.seq
1489982193 gbvrt402.seq
1491678527 gbvrt403.seq
1471156049 gbvrt404.seq
1364883283 gbvrt405.seq
1466059588 gbvrt406.seq
1433946235 gbvrt407.seq
1457813132 gbvrt408.seq
1211504142 gbvrt409.seq
1371630420 gbvrt41.seq
1484767355 gbvrt410.seq
1402052694 gbvrt411.seq
1388694647 gbvrt412.seq
1493784267 gbvrt413.seq
1434807079 gbvrt414.seq
1445947000 gbvrt415.seq
1408721211 gbvrt416.seq
1365308427 gbvrt417.seq
1335123340 gbvrt418.seq
1434807079 gbvrt419.seq
1358087426 gbvrt42.seq
1482815373 gbvrt420.seq
1493104228 gbvrt421.seq
1456914765 gbvrt422.seq
1465177756 gbvrt423.seq
1354731927 gbvrt424.seq
1377885857 gbvrt425.seq
1306093102 gbvrt426.seq
1439258793 gbvrt427.seq
1446499400 gbvrt428.seq
1362562724 gbvrt429.seq
1409890116 gbvrt43.seq
1462223295 gbvrt430.seq
1469876767 gbvrt431.seq
1435670402 gbvrt432.seq
1463242615 gbvrt433.seq
1447291218 gbvrt434.seq
1456936856 gbvrt435.seq
1483970342 gbvrt436.seq
1415408582 gbvrt437.seq
1493047415 gbvrt438.seq
1482345890 gbvrt439.seq
1495658777 gbvrt44.seq
1466508801 gbvrt440.seq
1477005963 gbvrt441.seq
1483724547 gbvrt442.seq
1476820354 gbvrt443.seq
1452521420 gbvrt444.seq
1488393976 gbvrt445.seq
1494760689 gbvrt446.seq
1336443883 gbvrt447.seq
1294322479 gbvrt448.seq
1472806982 gbvrt449.seq
1468214202 gbvrt45.seq
1497521680 gbvrt450.seq
1494764371 gbvrt451.seq
1494230516 gbvrt452.seq
1459795936 gbvrt453.seq
1451587015 gbvrt454.seq
1434129532 gbvrt455.seq
1423498557 gbvrt456.seq
1499988854 gbvrt457.seq
355606134 gbvrt458.seq
1497507497 gbvrt46.seq
1392041424 gbvrt47.seq
838606763 gbvrt48.seq
1154852032 gbvrt49.seq
1460044426 gbvrt5.seq
1294541035 gbvrt50.seq
1495334811 gbvrt51.seq
1471849771 gbvrt52.seq
1495075479 gbvrt53.seq
1443062910 gbvrt54.seq
1495785632 gbvrt55.seq
1476010173 gbvrt56.seq
1465137891 gbvrt57.seq
1282827346 gbvrt58.seq
1432076919 gbvrt59.seq
1488052262 gbvrt6.seq
1499422661 gbvrt60.seq
1473624134 gbvrt61.seq
1494431972 gbvrt62.seq
1230349555 gbvrt63.seq
1413618697 gbvrt64.seq
1330262106 gbvrt65.seq
1463202068 gbvrt66.seq
1491604647 gbvrt67.seq
1469825980 gbvrt68.seq
1495977022 gbvrt69.seq
1498753855 gbvrt7.seq
1412203616 gbvrt70.seq
1485152845 gbvrt71.seq
1499863036 gbvrt72.seq
1421892042 gbvrt73.seq
1440473233 gbvrt74.seq
1451333745 gbvrt75.seq
1480202965 gbvrt76.seq
1472327219 gbvrt77.seq
1460723763 gbvrt78.seq
1492550873 gbvrt79.seq
1480906084 gbvrt8.seq
612354411 gbvrt80.seq
1068402515 gbvrt81.seq
1067356332 gbvrt82.seq
896844818 gbvrt83.seq
805318346 gbvrt84.seq
1275607077 gbvrt85.seq
1208361643 gbvrt86.seq
874873714 gbvrt87.seq
1313422786 gbvrt88.seq
1438940816 gbvrt89.seq
1444675895 gbvrt9.seq
1490321479 gbvrt90.seq
1467796566 gbvrt91.seq
1500000013 gbvrt92.seq
1500000016 gbvrt93.seq
1445601115 gbvrt94.seq
1499771743 gbvrt95.seq
1468775314 gbvrt96.seq
1481671623 gbvrt97.seq
1485228638 gbvrt98.seq
1459231675 gbvrt99.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 179375 605524051
BCT10 328 681959361
BCT100 329 671292197
BCT101 426 659953938
BCT102 374 686107327
BCT103 269 666203960
BCT104 281 697646643
BCT105 323 671124867
BCT106 350 657678455
BCT107 351 700063942
BCT108 256 673793237
BCT109 482 691252293
BCT11 398 744047040
BCT110 397 694022701
BCT111 426 714736229
BCT112 959 699342382
BCT113 641 677486950
BCT114 342 648721450
BCT115 565 685156602
BCT116 385 662655459
BCT117 416 686951098
BCT118 335 693370486
BCT119 386 677202496
BCT12 431 753399892
BCT120 340 681499384
BCT121 213 667849844
BCT122 439 699370998
BCT123 488 690303703
BCT124 258 709025881
BCT125 278 650557917
BCT126 351 707799723
BCT127 394 699840928
BCT128 645 720140132
BCT129 400 713166906
BCT13 416 685485982
BCT130 306 678543177
BCT131 357 682071939
BCT132 310 667235805
BCT133 389 797327461
BCT134 331 727324363
BCT135 368 668677903
BCT136 386 672866117
BCT137 437 677223588
BCT138 425 687685916
BCT139 391 660606075
BCT14 583 672320818
BCT140 320 693370667
BCT141 332 757912867
BCT142 339 662716331
BCT143 304 707198870
BCT144 338 662959940
BCT145 404 703041265
BCT146 559 642525038
BCT147 308 692033444
BCT148 349 737267088
BCT149 349 673327009
BCT15 541 673440342
BCT150 330 659214723
BCT151 361 671340245
BCT152 377 658332334
BCT153 817 640837540
BCT154 456 653781183
BCT155 479 640033672
BCT156 432 636821154
BCT157 431 639252468
BCT158 423 664666889
BCT159 511 702421159
BCT16 486 672719556
BCT160 370 676746997
BCT161 411 688531633
BCT162 328 685021480
BCT163 297 748834414
BCT164 407 675977886
BCT165 447 660478371
BCT166 362 698140422
BCT167 384 670496766
BCT168 378 666180429
BCT169 456 687329726
BCT17 304 674156459
BCT170 455 862935813
BCT171 444 670281547
BCT172 304 669987329
BCT173 323 674330896
BCT174 396 651018115
BCT175 471 671139821
BCT176 451 687662936
BCT177 391 652135419
BCT178 495 641184697
BCT179 422 684932549
BCT18 154 675727203
BCT180 432 687717416
BCT181 357 680005338
BCT182 460 710603157
BCT183 383 733043331
BCT184 411 678982829
BCT185 328 666938357
BCT186 283 670992438
BCT187 316 677239434
BCT188 404 669725173
BCT189 408 677976553
BCT19 217 676861557
BCT190 495 711182642
BCT191 343 663562852
BCT192 407 651944564
BCT193 310 653646620
BCT194 327 639847776
BCT195 347 664270676
BCT196 453 734403655
BCT197 257 666716776
BCT198 313 663395462
BCT199 364 658562554
BCT2 26412 631722729
BCT20 307 681003402
BCT200 371 648253955
BCT201 423 681910112
BCT202 357 678003838
BCT203 379 717550410
BCT204 355 979790564
BCT205 393 662095481
BCT206 431 651297989
BCT207 435 727699706
BCT208 300 666459931
BCT209 484 737486415
BCT21 339 671837421
BCT210 542 657405584
BCT211 386 700265099
BCT212 405 637587421
BCT213 430 651736550
BCT214 431 688731399
BCT215 399 682686352
BCT216 426 685604268
BCT217 383 660034942
BCT218 430 688618281
BCT219 235 649548731
BCT22 385 704832900
BCT220 291 655256540
BCT221 387 677114903
BCT222 494 650361346
BCT223 385 697485512
BCT224 310 652975010
BCT225 384 650223528
BCT226 389 640453524
BCT227 351 674587904
BCT228 292 707502677
BCT229 381 667480435
BCT23 251 678533787
BCT230 337 669210667
BCT231 369 679371395
BCT232 340 660852158
BCT233 371 648879789
BCT234 395 675677565
BCT235 292 656380692
BCT236 353 638860349
BCT237 327 639492460
BCT238 326 633520532
BCT239 373 644514014
BCT24 70219 632842048
BCT240 432 675902405
BCT241 548 662581213
BCT242 343 638017042
BCT243 341 709912110
BCT244 353 650112367
BCT245 311 665575280
BCT246 361 640928515
BCT247 399 632893243
BCT248 365 621795075
BCT249 324 618261142
BCT25 426 677259545
BCT250 320 636139266
BCT251 485 745487588
BCT252 413 638036321
BCT253 465 669390960
BCT254 394 651442726
BCT255 303 656947852
BCT256 359 654880761
BCT257 298 663161576
BCT258 424 669522471
BCT259 351 632944949
BCT26 347 669602348
BCT260 329 647498022
BCT261 386 630116040
BCT262 308 656435429
BCT263 321 673139591
BCT264 471 746138407
BCT265 121 647848949
BCT266 104 644187235
BCT267 126 649837675
BCT268 129 651116482
BCT269 131 650059032
BCT27 490 675301917
BCT270 167 650952992
BCT271 162 650522239
BCT272 146 647302167
BCT273 121 648442669
BCT274 138 644302905
BCT275 135 646379848
BCT276 136 649697230
BCT277 259 659785692
BCT278 359 703245359
BCT279 335 659195263
BCT28 451 676108846
BCT280 382 654440161
BCT281 1268 626931423
BCT282 738 659582182
BCT283 330 677582845
BCT284 183 631627266
BCT285 502 694565108
BCT286 206 627944581
BCT287 290 634774776
BCT288 459 663645026
BCT289 362 646963485
BCT29 399 671890196
BCT290 451 642509538
BCT291 229 627690640
BCT292 463 682751755
BCT293 300 632645501
BCT294 347 684437686
BCT295 447 681812472
BCT296 397 672085107
BCT297 397 637036260
BCT298 298 672167379
BCT299 336 652492797
BCT3 383 730513354
BCT30 382 667588220
BCT300 390 666183125
BCT301 405 711261855
BCT302 586 622549075
BCT303 474 657359823
BCT304 514 664251146
BCT305 360 623839021
BCT306 381 618523541
BCT307 385 643327068
BCT308 202 623240432
BCT309 236 634441997
BCT31 361 687276329
BCT310 392 619744628
BCT311 307 642098210
BCT312 409 633965100
BCT313 445 627753913
BCT314 262 649541606
BCT315 404 611885561
BCT316 444 642908611
BCT317 396 656470324
BCT318 405 679066703
BCT319 382 915434954
BCT32 397 694117152
BCT320 635 686603494
BCT321 416 678409992
BCT322 392 641989379
BCT323 332 665980290
BCT324 286 628586734
BCT325 366 630819522
BCT326 346 638522195
BCT327 436 653473078
BCT328 392 628361184
BCT329 324 678028134
BCT33 382 699504957
BCT330 315 649892524
BCT331 350 669665874
BCT332 330 638385383
BCT333 334 672378461
BCT334 460 752613198
BCT335 360 695208067
BCT336 345 668610956
BCT337 356 626828291
BCT338 362 639778043
BCT339 350 654881950
BCT34 796 703832880
BCT340 373 644913430
BCT341 189 633841553
BCT342 233 620063177
BCT343 462 639214774
BCT344 369 636371671
BCT345 334 643695396
BCT346 404 629879378
BCT347 408 627347563
BCT348 510 692609717
BCT349 419 646615531
BCT35 361 680794345
BCT350 557 673536485
BCT351 330 662952203
BCT352 552 610009758
BCT353 413 623120067
BCT354 355 626363381
BCT355 350 636020927
BCT356 119 625467573
BCT357 76 642553016
BCT358 121 684309334
BCT359 351 693671347
BCT36 288 680432472
BCT360 466 658575711
BCT361 289 636384750
BCT362 265 623882044
BCT363 321 639978189
BCT364 338 601137027
BCT365 365 598798250
BCT366 385 596940739
BCT367 359 597374811
BCT368 411 611741614
BCT369 282 621381469
BCT37 174 644487570
BCT370 326 629054206
BCT371 279 641084798
BCT372 390 636275376
BCT373 304 663058142
BCT374 355 634159143
BCT375 358 913285425
BCT376 335 627050671
BCT377 319 639456715
BCT378 291 630482474
BCT379 543 678489611
BCT38 179 649799616
BCT380 367 641291074
BCT381 373 632196809
BCT382 267 635589961
BCT383 544 604949813
BCT384 573 607641360
BCT385 548 609270373
BCT386 477 622691091
BCT387 294 609958849
BCT388 348 632376554
BCT389 322 649426923
BCT39 337 692899920
BCT390 289 623921300
BCT391 377 642957359
BCT392 348 619658258
BCT393 348 640835533
BCT394 446 714169148
BCT395 323 674315455
BCT396 556 636055498
BCT397 449 804146547
BCT398 405 717340298
BCT399 244 610225749
BCT4 489 741671547
BCT40 268 708985739
BCT400 239 670065769
BCT401 311 650750242
BCT402 375 639373512
BCT403 299 683609115
BCT404 898 607206967
BCT405 415 618977318
BCT406 298 701189068
BCT407 286 612099053
BCT408 784 990998867
BCT409 381 698990881
BCT41 243 684204223
BCT410 250 636105254
BCT411 926 701243044
BCT412 352 644865335
BCT413 347 680610344
BCT414 320 606098770
BCT415 392 598047862
BCT416 340 661854251
BCT417 331 621738399
BCT418 438 709189074
BCT419 388 671357421
BCT42 317 702959055
BCT420 477 718275335
BCT421 446 752571528
BCT422 386 810327598
BCT423 355 652012725
BCT424 360 669584116
BCT425 420 673320516
BCT426 301 632484960
BCT427 305 617244116
BCT428 244 609382821
BCT429 367 623298895
BCT43 344 692003574
BCT430 431 644599992
BCT431 394 690926206
BCT432 158 618077457
BCT433 97 625739211
BCT434 101 614371804
BCT435 212 643851632
BCT436 257 732276643
BCT437 345 649096995
BCT438 297 690138036
BCT439 311 776719968
BCT44 304 657487230
BCT440 420 644989248
BCT441 395 624141662
BCT442 262 692541563
BCT443 39101 597053362
BCT444 227785 537584027
BCT445 9922 655641981
BCT446 127830 591143474
BCT447 302725 527451408
BCT448 419997 473360438
BCT449 218160 663916870
BCT45 470 668486005
BCT450 14297 712884012
BCT451 1580 713148504
BCT452 267 672885282
BCT453 2751 715580226
BCT454 2203 967431150
BCT455 4123 907077038
BCT456 1063 1086506066
BCT457 2238 662899197
BCT458 5709 751919492
BCT459 2501 761217885
BCT46 256 671567886
BCT460 3483 828251396
BCT461 225469 654010192
BCT462 333650 589336702
BCT463 290300 698847550
BCT464 25974 770815234
BCT465 602 616386423
BCT466 550 618631019
BCT467 591 618466690
BCT468 1269 673557471
BCT469 1498 828437195
BCT47 246 676762917
BCT470 757 824849100
BCT471 729 1158850885
BCT472 789 1180640666
BCT473 753 1178587745
BCT474 986 1128522195
BCT475 554 1052611740
BCT476 109220 737154237
BCT477 116215 239835498
BCT48 253 663937666
BCT49 277 675514949
BCT5 535 720960951
BCT50 370 669705021
BCT51 297 673726491
BCT52 305 681480790
BCT53 365 662135853
BCT54 298 667363023
BCT55 299 658208673
BCT56 417 662687662
BCT57 349 665328448
BCT58 378 665873584
BCT59 345 680804416
BCT6 421 681407729
BCT60 305 671973600
BCT61 397 666653961
BCT62 300 672445131
BCT63 348 683725007
BCT64 282 678153816
BCT65 317 669519009
BCT66 355 676599798
BCT67 383 669239154
BCT68 387 665406103
BCT69 270 661800896
BCT7 483 668491491
BCT70 383 706733363
BCT71 335 679247578
BCT72 342 664384425
BCT73 369 716199458
BCT74 399 660339305
BCT75 303 684328663
BCT76 302 685064382
BCT77 301 681217806
BCT78 326 680234009
BCT79 260 813245536
BCT8 358 686419098
BCT80 430 675879565
BCT81 536 718346294
BCT82 282 673620222
BCT83 267 680125625
BCT84 295 675762375
BCT85 336 740919066
BCT86 325 698770027
BCT87 329 726637062
BCT88 306 710834088
BCT89 426 830618038
BCT9 304 694758490
BCT90 209 692639840
BCT91 301 689161368
BCT92 281 657245128
BCT93 354 682761341
BCT94 321 683165160
BCT95 301 672545104
BCT96 270 700594303
BCT97 404 665459065
BCT98 406 681685179
BCT99 383 720230086
ENV1 298786 549921109
ENV10 662740 361006192
ENV11 564123 376884887
ENV12 472127 460066448
ENV13 547181 318473092
ENV14 473830 382925679
ENV15 577935 349714066
ENV16 474862 408425332
ENV17 597603 295340741
ENV18 640821 270570399
ENV19 634788 305252959
ENV2 106572 705750030
ENV20 559195 329243899
ENV21 582399 420470757
ENV22 517575 394211641
ENV23 273128 568696403
ENV24 181090 674145652
ENV25 89395 1074802876
ENV26 556 1180427416
ENV27 1283 1176772559
ENV28 337 1182366836
ENV29 3141 1131458700
ENV3 265 656375014
ENV30 711 913409944
ENV31 646 1181276344
ENV32 315 1179519311
ENV33 339 1182570712
ENV34 312 1182401767
ENV35 301 1180501365
ENV36 383 1179073797
ENV37 350 1181659999
ENV38 98464 980634437
ENV39 15331 77813413
ENV4 299 674132883
ENV5 463 715565084
ENV6 182750 600213450
ENV7 581681 407807338
ENV8 626975 384553128
ENV9 592365 336158098
EST1 465978 174308808
EST10 482060 205981912
EST100 517152 306917161
EST101 571765 237751130
EST102 559494 267285764
EST103 439254 278779036
EST104 452246 282618511
EST105 457931 286459115
EST106 453220 315974444
EST107 467085 316336301
EST108 406791 276486239
EST109 451165 300762538
EST11 471694 197490837
EST110 443729 266645751
EST111 431088 269604826
EST112 464501 261466462
EST113 350586 222848830
EST114 475793 240511406
EST115 485171 274144818
EST116 396254 254747738
EST117 481957 288207053
EST118 383600 254685541
EST119 369362 210602159
EST12 322614 106776527
EST120 444540 108769364
EST121 654648 336026570
EST122 446509 269033442
EST123 523620 278036590
EST124 590513 301983723
EST125 513936 307801333
EST126 514387 333474104
EST127 492289 335424768
EST128 530621 311166484
EST129 557314 333612389
EST13 301748 92374489
EST130 597844 376630466
EST131 584172 425279511
EST132 519306 262005631
EST133 450442 56483164
EST134 437405 141329944
EST135 494091 302954574
EST136 424810 297245989
EST137 466039 306144748
EST138 478298 184656439
EST139 441879 281406484
EST14 347448 167060316
EST140 483336 309589089
EST141 423651 267083649
EST142 475823 271537745
EST143 418117 264879463
EST144 305380 201622630
EST145 388957 242056173
EST146 469777 263905859
EST147 469242 272265284
EST148 478563 305101196
EST149 546887 328205878
EST15 493160 244485574
EST150 404754 269153961
EST151 555357 236972002
EST152 548464 276822352
EST153 557080 342187815
EST154 545491 302369424
EST155 603590 357347429
EST156 549801 332331705
EST157 462109 295340383
EST158 468148 249361314
EST159 493049 285257934
EST16 474036 251365315
EST160 521770 331178056
EST161 528591 336831017
EST162 697721 312608390
EST163 532124 270646937
EST164 173278 66704099
EST17 457757 255534075
EST18 450194 229868113
EST19 474489 243736077
EST2 491819 192418618
EST20 456029 290311552
EST21 490015 267405365
EST22 438190 247244111
EST23 475099 272527565
EST24 580904 324438280
EST25 475184 257871420
EST26 435808 254788749
EST27 459601 251063056
EST28 612278 324498593
EST29 477767 253037113
EST3 502235 208188383
EST30 458345 254198117
EST31 440862 288214816
EST32 407544 291500803
EST33 505945 301594133
EST34 646490 372227995
EST35 492899 313688880
EST36 399412 228859319
EST37 251802 94152925
EST38 250658 102505202
EST39 326414 157942812
EST4 481132 204967712
EST40 458890 260652174
EST41 481734 267290936
EST42 445814 239494789
EST43 477617 281946431
EST44 515061 258521477
EST45 431892 256049335
EST46 555971 284680432
EST47 428573 244741930
EST48 428124 248797874
EST49 356425 171205271
EST5 553101 304461922
EST50 380246 161063574
EST51 497858 268881099
EST52 567515 320908215
EST53 424882 286351815
EST54 443970 244386737
EST55 479799 282562857
EST56 435732 238158738
EST57 475516 267197656
EST58 456963 277435552
EST59 423436 247692848
EST6 554199 330662955
EST60 493656 328101411
EST61 453369 279963791
EST62 446386 228452420
EST63 442027 273196070
EST64 430815 276046886
EST65 386889 256015388
EST66 499520 272857007
EST67 492303 275421007
EST68 505066 275651943
EST69 546238 305016425
EST7 540079 306856709
EST70 553811 334867647
EST71 537262 343606221
EST72 571848 312642272
EST73 457938 272414142
EST74 455339 315111252
EST75 436990 292902885
EST76 478516 283527203
EST77 381925 266607566
EST78 394079 275406942
EST79 386871 268046198
EST8 444537 136310334
EST80 405939 312523815
EST81 481913 303452421
EST82 444024 320647890
EST83 527373 302512029
EST84 595618 185407135
EST85 484764 324369916
EST86 500815 319910098
EST87 514290 307348035
EST88 665630 324971925
EST89 573558 245776940
EST9 610678 285513474
EST90 502498 317525968
EST91 506447 297243001
EST92 556722 189160933
EST93 522874 322487296
EST94 435773 248344046
EST95 563991 195676331
EST96 540074 244711310
EST97 565958 213866573
EST98 479821 291305106
EST99 493862 315767558
GSS1 483478 349296030
GSS10 549399 306201036
GSS11 509421 310374697
GSS12 538965 349860318
GSS13 509957 374565014
GSS14 512828 347179564
GSS15 616178 341877112
GSS16 601326 382164424
GSS17 554042 299119992
GSS18 526424 376161672
GSS19 511153 347730198
GSS2 460201 347842236
GSS20 577590 368081710
GSS21 605054 430635303
GSS22 539616 313904444
GSS23 480138 288782337
GSS24 520408 344355917
GSS25 527699 338235611
GSS26 534446 340909185
GSS27 635736 302783736
GSS28 603376 311437786
GSS29 565888 358948643
GSS3 458540 341240541
GSS30 481749 375294866
GSS31 477296 346751060
GSS32 527286 371221463
GSS33 582842 334756700
GSS34 455631 343002982
GSS35 527877 355605639
GSS36 503619 237663877
GSS37 570820 298494676
GSS38 410602 304890012
GSS39 400427 328714536
GSS4 570407 278280883
GSS40 413869 339234794
GSS41 405540 322834964
GSS42 412889 336678949
GSS43 411115 339554770
GSS44 403682 324241250
GSS45 491764 342576709
GSS46 551677 342709156
GSS47 595540 396731222
GSS48 591277 416016488
GSS49 485841 343386034
GSS5 490745 253737705
GSS50 503540 287311751
GSS51 554260 374190717
GSS52 550875 333322635
GSS53 524903 392803915
GSS54 619536 367540625
GSS55 483468 336745823
GSS56 451780 409979866
GSS57 450094 353231278
GSS58 541441 372259718
GSS59 549578 336341146
GSS6 467594 255862160
GSS60 603050 386693435
GSS61 551130 394432177
GSS62 479339 405008794
GSS63 483489 432181500
GSS64 500742 387041998
GSS65 693255 182573467
GSS66 722684 183048360
GSS67 550845 296241442
GSS68 486447 437740289
GSS69 663626 210333166
GSS7 387194 193365402
GSS70 498380 271273114
GSS71 468841 372096583
GSS72 557992 396528999
GSS73 515241 302280461
GSS74 536409 325189487
GSS75 577343 421788836
GSS76 591798 423013371
GSS77 614877 293784759
GSS78 578039 441923032
GSS79 221663 108909734
GSS8 446635 219820040
GSS9 493290 281338016
HTC1 105590 213533747
HTC2 401591 390665398
HTC3 144384 137071023
HTG1 11398 1117560132
HTG10 6350 1134106153
HTG11 7062 1123865166
HTG12 7026 1130939026
HTG13 7013 1154694359
HTG14 7057 1150125682
HTG15 6831 1156870599
HTG16 6287 1141547857
HTG17 6819 1143695002
HTG18 8686 1144543963
HTG19 9215 1092227754
HTG2 7566 1119083438
HTG20 9512 1082832923
HTG21 8342 1123201930
HTG22 7079 1136335249
HTG23 6609 1155598595
HTG24 7648 1153326826
HTG25 4369 486232722
HTG3 5928 1131528069
HTG4 5455 1141252380
HTG5 5356 1144862828
HTG6 5358 1145015310
HTG7 6607 1133078642
HTG8 6863 1144292626
HTG9 6252 1140248232
INV1 273652 651026204
INV10 68 1058320446
INV100 41 1174569690
INV100 70 1179552638
INV100 96 1165511451
INV100 74 1179023592
INV100 73 1177448536
INV100 72 1178439201
INV100 25 1014805375
INV100 66 1167455293
INV100 58 1167783412
INV100 38 1171852050
INV100 24 1157379412
INV101 74 1182456330
INV101 27 1162242232
INV101 29 1171815059
INV101 6 1126908290
INV101 8 1142820701
INV101 10 1129994020
INV101 38 1099439611
INV101 11 1131081183
INV101 32 1165278269
INV101 9 1181690397
INV101 51 1178032646
INV102 72 1180300921
INV102 84 1180498858
INV102 78 1130672781
INV102 46 1176662726
INV102 94 1182202790
INV102 54 1163615297
INV102 44 1171057362
INV102 46 1175423156
INV102 95 1173236493
INV102 68 1153822837
INV102 51 1148881205
INV103 63 1183268016
INV103 111 1180763565
INV103 73 1176314362
INV103 41 1128864743
INV103 10 1098002852
INV103 52 1174697800
INV103 58 1166794818
INV103 40 1164346843
INV103 46 1177065364
INV103 34 1152660147
INV103 10 1153232489
INV104 46 1172729285
INV104 12 1145634183
INV104 17 1176013975
INV104 81 1127908515
INV104 45 907957700
INV104 4 1038349671
INV104 11 1112847074
INV104 23 1180169940
INV104 96 1175189594
INV104 69 1177765537
INV104 49 1172708448
INV105 67 1174257075
INV105 50 1179891960
INV105 68 1180478550
INV105 67 1165816759
INV105 69 1177399551
INV105 84 1170778360
INV105 74 1171194616
INV105 93 1175862292
INV105 15 258557877
INV105 1 1293457734
INV105 1 1291298704
INV106 775 1174689749
INV106 1 1179439348
INV106 1 1160478065
INV106 1 992416756
INV106 1 914908903
INV106 1 861557771
INV106 14 1170637745
INV106 70 1179993066
INV106 65 1180400965
INV106 68 1180582022
INV106 61 1167260307
INV107 61 1157120031
INV107 47 1168264666
INV107 43 957334016
INV107 5 998238218
INV107 7 1162124634
INV107 26 1171141546
INV107 71 1172536328
INV107 43 1132527409
INV107 14 1107342459
INV107 4 1176433905
INV107 4 1040449989
INV108 31 1173292515
INV108 6 1181496301
INV108 43 1177465240
INV108 73 1169539680
INV108 77 1155892558
INV108 39 1145061367
INV108 20 1120353990
INV108 5 1116536280
INV108 6 1066914655
INV108 21 1153608646
INV108 15 998564496
INV109 42299 972986076
INV109 4 988001525
INV109 5 1081838651
INV109 6 1117395520
INV109 72 1182999170
INV109 10 1169370837
INV109 40 1179546201
INV109 52 1180037318
INV109 76 1178301101
INV109 53 1175465534
INV109 46 1156793134
INV11 698 1181425117
INV110 416625 268806019
INV110 7 1160484181
INV110 13 1144818117
INV110 17 1169665970
INV110 72 1166225611
INV110 41 1177388950
INV110 12 982062496
INV110 6 1139301242
INV110 10 1107965717
INV110 15 1141715146
INV110 167 1156241592
INV111 442056 322230592
INV111 19 1155658027
INV111 12 1171389006
INV111 11 1136128320
INV111 8 1047756814
INV111 5 1015574311
INV111 60 1181256184
INV111 70 1177569054
INV111 61 1122962229
INV111 24 1162418068
INV111 45 1180178942
INV112 451069 362396757
INV112 22 1020519631
INV112 6 1141055961
INV112 10 1141363043
INV112 21 1057987053
INV112 5 1075944305
INV112 6 1045444783
INV112 53 1150519615
INV112 22 1154010458
INV112 43 1175809277
INV112 114 1166279806
INV113 420626 403929239
INV113 81 1179823167
INV113 32 1168188588
INV113 48 1167782269
INV113 69 1179016942
INV113 40 1170265558
INV113 19 1105957632
INV113 44 1148946847
INV113 38 1157116190
INV113 75 1182366179
INV113 65 1157844742
INV114 214464 731170927
INV114 34 978012395
INV114 2 909783825
INV114 3 1002271032
INV114 7 1168892024
INV114 18 1179333230
INV114 44 1182137587
INV114 29 1148623400
INV114 11 1085996202
INV114 8 1110592716
INV114 14 1139414946
INV115 330538 914261839
INV115 24 1070944420
INV115 12 1148197521
INV115 20 1180092143
INV115 11 1165817857
INV115 9 1125014429
INV115 10 1166013097
INV115 8 1108611473
INV115 17 1172870526
INV115 65 1170069027
INV115 10 1042031736
INV116 181061 1003888063
INV116 5 1178347630
INV116 5 1058329761
INV116 6 1128552929
INV116 6 1151784001
INV116 17 1156782812
INV116 8 995333903
INV116 5 1076260869
INV116 17 1154293172
INV116 16 1132740173
INV116 76 1181120499
INV117 189992 1023679326
INV117 28 1135146740
INV117 84 1183040619
INV117 63 1168983052
INV117 45 1180379823
INV117 50 1174747212
INV117 81 1161275004
INV117 37 1078366844
INV117 14 1141447352
INV117 52 1177959398
INV117 82 1175545160
INV118 314729 948951018
INV118 53 1173924815
INV118 90 1180805955
INV118 57 1170380872
INV118 45 1174157321
INV118 42 1150241946
INV118 14 1113023237
INV118 39 1142688989
INV118 27 1147024074
INV118 20 1166783738
INV118 39 1178897215
INV119 519218 820069500
INV119 52 1160234327
INV119 31 1140957229
INV119 12 1033855403
INV119 10 1140642037
INV119 52 1135997296
INV119 14 1017297254
INV119 4 1030473908
INV119 5 1136951425
INV119 5 1007390768
INV119 7 1133103413
INV12 166746 838570040
INV120 163545 939011394
INV120 6 1029560401
INV120 12 1156314643
INV120 53 1164791138
INV120 65 1182022424
INV120 67 1176922269
INV120 62 1181264443
INV120 24 1152143384
INV120 50 1149594725
INV120 30 1173684468
INV120 64 1183268994
INV121 560235 798509391
INV121 102 1179919515
INV121 49 1163819803
INV121 73 1172528031
INV121 11 1092091770
INV121 7 1109536810
INV121 21 1143978763
INV121 38 1181134240
INV121 22 1134428635
INV121 54 1176592991
INV121 97 1171031767
INV122 322009 942824246
INV122 64 1170462638
INV122 39 1148901830
INV122 50 1182346861
INV122 17 1142752485
INV122 48 1136399091
INV122 90 1128363014
INV122 26 1121403460
INV122 8 1139867544
INV122 41 1165675730
INV122 44 1171230957
INV123 79554 1083008223
INV123 57 1155429487
INV123 33 1132294652
INV123 54 1183106017
INV123 72 1183688397
INV123 57 1179778441
INV123 95 1182814743
INV123 60 1181635477
INV123 55 1178306964
INV123 51 1183123419
INV123 10 1080110743
INV124 192234 1019052950
INV124 17 1161940345
INV124 17 1163354238
INV124 8 1084983958
INV124 4 1161620295
INV124 6 1118058588
INV124 239 1155444393
INV124 65 1155292851
INV124 49 1157204977
INV124 18 1121979887
INV124 67 1131615244
INV125 584291 773736113
INV125 36 1171346633
INV125 64 1173798416
INV125 68 1176010127
INV125 68 1161391857
INV125 52 1103296311
INV125 11 1083436122
INV125 7 987056403
INV125 26 1166192875
INV125 61 1166199675
INV125 45 1166667975
INV126 297584 606837486
INV126 32 1087567025
INV126 4 1030960070
INV126 6 1025456737
INV126 46 1137100475
INV126 18 1131337170
INV126 14 1128708603
INV126 17 774293074
INV126 2 933831858
INV126 3 1150200228
INV126 10 1177522417
INV127 286502 109989726
INV127 28 1156995881
INV127 17 1118927566
INV127 60 1178648153
INV127 46 1162795116
INV127 30 1166369808
INV127 16 1098951843
INV127 73 1168047785
INV127 40 1171479972
INV127 21 1167649390
INV127 26 1169864566
INV128 305336 166997143
INV128 20 1172103784
INV128 30 1182256919
INV128 29 1142024815
INV128 29 1176797100
INV128 28 1162934909
INV128 66 1181408289
INV128 84 1183022233
INV128 26 1159233645
INV128 12 1087918766
INV128 23 1174845876
INV129 428825 362720731
INV129 53 1166491357
INV129 27 1111966776
INV129 49 1160418488
INV129 37 1172932802
INV129 64 1179192768
INV129 55 1168193245
INV129 36 1162023982
INV129 53 1180483293
INV129 26 1142169690
INV129 24 1169682239
INV13 116 1115913924
INV130 217049 726072689
INV130 57 1182198083
INV130 47 1154777035
INV130 43 1170066446
INV130 25 1055490968
INV130 47 1169559966
INV130 59 1158912840
INV130 73 1175955448
INV130 56 1176539405
INV130 66 1177679083
INV130 74 1169328399
INV131 17 1169288939
INV131 37 1157326669
INV131 40 1164777793
INV131 60 1104767758
INV131 4 999981639
INV131 55 1163177761
INV131 31 1175580819
INV131 67 1128372091
INV131 41 1172416935
INV131 37 1144199766
INV131 27 1170860852
INV132 5 1069690714
INV132 32 1147608705
INV132 30 1152439975
INV132 72 1156474400
INV132 49 1175938839
INV132 13 1035349715
INV132 22 1162858964
INV132 41 1164819519
INV132 58 1159256293
INV132 28 1120957566
INV132 12 1122456144
INV133 24 1162836797
INV133 15 1133421723
INV133 28 1137166643
INV133 36 1141390408
INV133 39 1154202694
INV133 50 1167960878
INV133 82 1176236579
INV133 73 1179835370
INV133 50 1148774433
INV133 13 1072372875
INV133 13 1181340281
INV134 59 1158687670
INV134 41 1107493197
INV134 27 1130472345
INV134 52 1172197289
INV134 22 1014985741
INV134 47 1175144434
INV134 102 1169796218
INV134 30 1083043655
INV134 24 1168872612
INV134 51 1181361047
INV134 42 1166668981
INV135 846 1177944383
INV135 47 1179678099
INV135 62 1150767964
INV135 31 1177580588
INV135 47 1171497596
INV135 47 1175789896
INV135 80 1169544734
INV135 29 1177852824
INV135 5 1062950155
INV135 24 1175948983
INV135 58 1171111909
INV136 73 1164213597
INV136 65 1162688335
INV136 17 1168477902
INV136 41 1180304140
INV136 47 1172853525
INV136 44 1181988105
INV136 28 1170593287
INV136 78 1177947052
INV136 18 1169627344
INV136 10 1120492286
INV136 11 1121271366
INV137 11 1075757141
INV137 63 1164908796
INV137 85 1179345458
INV137 31 1049453696
INV137 12 1178992213
INV137 37 1179116242
INV137 37 1176989464
INV137 58 1161484067
INV137 70 1180153937
INV137 56 1176431441
INV137 10 977533688
INV138 915 1173638389
INV138 3 1018445127
INV138 41 1169540442
INV138 35 1175345262
INV138 25 1179487368
INV138 67 1165428216
INV138 55 1181288510
INV138 37 1163419772
INV138 57 1176844491
INV138 51 1168928963
INV138 57 1169337903
INV139 74 1178807631
INV139 46 1167285839
INV139 18 1143849572
INV139 14 1140256562
INV139 9 1052788231
INV139 16 1153382259
INV139 15 925839449
INV139 30 1171619784
INV139 50 1166035322
INV139 12 1028028650
INV139 9 1161503014
INV14 148 1128010528
INV140 82 1182787957
INV140 58 1166429890
INV140 61 1171332075
INV140 29 1168559349
INV140 16 1040121210
INV140 11 1167239847
INV140 22 1169591442
INV140 29 1176455384
INV140 12 1071438916
INV140 10 1126496555
INV140 14 1176773160
INV141 44 1172446807
INV141 17 1134597021
INV141 8 1180647166
INV141 18 1143862257
INV141 27 1170864363
INV141 43 1150336127
INV141 12 1106811681
INV141 13 1147718861
INV141 61 1173307315
INV141 52 1180405073
INV141 53 1079648700
INV142 54 1173395201
INV142 13 1145218434
INV142 43 1163097532
INV142 42 1152719214
INV142 40 1163448206
INV142 29 1152987000
INV142 24 1180290461
INV142 20 1171901913
INV142 8 1165030444
INV142 4 1095697250
INV142 5 1135037032
INV143 77 1175033503
INV143 5 995819607
INV143 5 1043254890
INV143 8 1029187023
INV143 16 1039967922
INV143 11 1148657136
INV143 11 981758791
INV143 5 1001110746
INV143 9 1048048490
INV143 13 1164331457
INV143 9 1082267824
INV144 53 1110435514
INV144 10 1157238887
INV144 18 1153332234
INV144 40 1122380822
INV144 13 1182238811
INV144 9 1167176384
INV144 6 1094654308
INV144 30 1123031855
INV144 34 1184035849
INV144 24 1087457769
INV144 7 1103340807
INV145 39 1177658136
INV145 8 1083401067
INV145 7 1028443654
INV145 6 1123852269
INV145 4 1181213180
INV145 5 1179467844
INV145 6 1030285985
INV145 6 1159026225
INV145 4 1152059062
INV145 21 1145854505
INV145 20 1128851935
INV146 46 1156001825
INV146 11 1135563500
INV146 53 1175091133
INV146 9 933237668
INV146 5 1087417316
INV146 77 1152002568
INV146 30 965057732
INV146 7 1149096613
INV146 30 1175787672
INV146 25 1142151468
INV146 8 1089886933
INV147 31 1179378047
INV147 12 1133337208
INV147 40 1157909220
INV147 18 1153583097
INV147 144 1164406166
INV147 22 1164760565
INV147 6 925294241
INV147 2 997939740
INV147 2 939381890
INV147 4 1114495493
INV147 2 1010290375
INV148 23 1103621514
INV148 2 956517273
INV148 2 852483235
INV148 5 1154000351
INV148 14 1177380507
INV148 5 1029760561
INV148 8 1077160140
INV148 11 1149922006
INV148 28 1129228682
INV148 9 1127119764
INV148 7 1106842868
INV149 55 1171906377
INV149 5 1173270638
INV149 13 1156344884
INV149 45 1151481641
INV149 29 1096098176
INV149 3 1059293851
INV149 4 1112205957
INV149 3 1076707575
INV149 43 1176549635
INV149 98 1181821965
INV149 26 1073674733
INV15 55 1174872431
INV150 61 1176595073
INV150 11 1168975743
INV150 22 1150586260
INV150 23 1165885360
INV150 23 843961488
INV150 3 931513797
INV150 30 1078540764
INV150 20 1170006908
INV150 35 1167858067
INV150 23 1149648485
INV150 10 1071181829
INV151 22 1065753823
INV151 9 1149983304
INV151 23 1116665399
INV151 112981 915041772
INV151 269166 306474265
INV152 8 1160095586
INV153 82 1175596191
INV154 61 1160003533
INV155 49 1177578721
INV156 94 1182399343
INV157 107 1164654370
INV158 348 1178754731
INV159 81 1173603914
INV16 84 1146444201
INV160 62 1163741821
INV161 68 1176341161
INV162 23 1117715873
INV163 17 1165496987
INV164 31 1177864835
INV165 63 1173828113
INV166 42 1098488573
INV167 197 1182084174
INV168 43 1173758629
INV169 30 1163071443
INV17 13 1148129104
INV170 33 1150779494
INV171 21 1130641041
INV172 34 1165811549
INV173 69 1167363915
INV174 107 1139707051
INV175 46 1144147418
INV176 64 1181555988
INV177 26 1149655799
INV178 25 1129595560
INV179 4 1063536830
INV18 13 1178733714
INV180 36 1180705104
INV181 26 1177137263
INV182 26 1137588813
INV183 23 1162215868
INV184 38 1009439894
INV185 18 1078663242
INV186 7 1139607402
INV187 63 1109671322
INV188 72 1128292515
INV189 36 1075862039
INV19 14 1159229737
INV190 83 1177178814
INV191 90 1183295929
INV192 49 1163680138
INV193 6 1067536953
INV194 45 1146467224
INV195 19 1046867413
INV196 9 1164226515
INV197 27 1135775304
INV198 133 1102741218
INV199 38 1100396957
INV2 47979 1062327337
INV20 120 1124481273
INV200 13 1179677959
INV201 44 1180076309
INV202 57 1153107140
INV203 29 1135569658
INV204 72 1177627269
INV205 51 1169733098
INV206 35 1148265513
INV207 21 978254821
INV208 37 1153788721
INV209 25 1171345473
INV21 72 1148335729
INV210 25 1138659415
INV211 34 1171237378
INV212 54 1180751072
INV213 13 989789286
INV214 26 1179421211
INV215 41 1084185462
INV216 14 1149630139
INV217 30 1172150422
INV218 12 988256607
INV219 46 1181236856
INV22 26 1110333705
INV220 30 1071303334
INV221 10 1116962374
INV222 39 1105305998
INV223 10 1158047402
INV224 58 1167006603
INV225 73 1181270472
INV226 73 1158289704
INV227 43 1174552499
INV228 96 1174494335
INV229 39 1175669524
INV23 11 1152075317
INV230 41 1174392858
INV231 34 1017303632
INV232 20 1091394276
INV233 46 1071904885
INV234 14 1173538008
INV235 53 1173770120
INV236 22 1174925624
INV237 52 1165222203
INV238 9 1135243928
INV239 37 1091829023
INV24 25 1142731532
INV240 61 1183021647
INV241 40 1163223276
INV242 31 1154223394
INV243 45 1052580145
INV244 6 1093677472
INV245 75 1080810493
INV246 6 1184020055
INV247 23 1164597292
INV248 22 1124986753
INV249 48 1121283596
INV25 88 1120635134
INV250 43 1180336726
INV251 36 1148733597
INV252 29 1162221689
INV253 53 1178763719
INV254 185 1134741007
INV255 14 1067550412
INV256 22 1169773962
INV257 42 1118586349
INV258 9 1182202232
INV259 63 1164008297
INV26 266 1143643317
INV260 10 1160133805
INV261 10 1097001354
INV262 46 1148288042
INV263 27 1163598379
INV264 60 1178007008
INV265 32 1154901090
INV266 13 1098887600
INV267 21 1149605523
INV268 33 1134762344
INV269 53 1178457892
INV27 74 1175942154
INV270 8 1046788973
INV271 47 1183581792
INV272 23 1141449862
INV273 375 1180236783
INV274 96 1139172162
INV275 19 1168497183
INV276 38 1138754106
INV277 17 1166894898
INV278 25 1094539453
INV279 25 1071893119
INV28 158 1149489705
INV280 26 1091050727
INV281 24 1061687259
INV282 10 1056135378
INV283 16 1070828630
INV284 12 1117452242
INV285 14 1123071741
INV286 19 1085845070
INV287 60 1126302065
INV288 11 1142405959
INV289 29 1173978223
INV29 67 1134001949
INV290 61 1171216006
INV291 27 1176340908
INV292 99 1091785749
INV293 10 1128248621
INV294 28 1151851000
INV295 38 1156027306
INV296 50 1179318313
INV297 46 1176220893
INV298 86 1126855865
INV299 11 1150190119
INV3 177 1180760700
INV30 12 963743819
INV300 18 1175856240
INV301 34 1180837817
INV302 13 1046470165
INV303 16 1179517444
INV304 37 1166090880
INV305 23 1158756635
INV306 60 1148464830
INV307 56 1179257620
INV308 38 1182747184
INV309 26 1144860495
INV31 4 1008855096
INV310 26 1164099579
INV311 55 1161028152
INV312 35 1180864303
INV313 11 492041846
INV314 1 2140038457
INV315 1 1533311695
INV316 1 991394496
INV317 1 709211797
INV318 2 1097626663
INV319 3 1157353054
INV32 23 1177944900
INV320 5 1139385694
INV321 25 1133784150
INV322 63 1181878340
INV323 101 1158086146
INV324 38 1181278882
INV325 286 1183080436
INV326 45 1154854736
INV327 61 1174533348
INV328 32 1008528964
INV329 27 1174263346
INV33 173 1126844149
INV330 64 1149369266
INV331 26 1183364031
INV332 67 1168339909
INV333 66 1147884150
INV334 44 965200748
INV335 8 1166380755
INV336 39 1173103949
INV337 62 1126817827
INV338 64 1170795920
INV339 47 1172322211
INV34 20 1122601317
INV340 10 1113379081
INV341 14 1164469949
INV342 61 1167552745
INV343 62 1125544552
INV344 54 1169401059
INV345 31 1176053521
INV346 43 1171176178
INV347 14 1116220489
INV348 17 1150285064
INV349 45 1165961048
INV35 41 1175741148
INV350 56 1112251606
INV351 15 1164046658
INV352 98 1179269248
INV353 40 1157032737
INV354 60 1179722234
INV355 67 1152073239
INV356 80 1180095790
INV357 48 1177743598
INV358 40 1169609794
INV359 49 1167566562
INV36 59 1107345484
INV360 53 1180763297
INV361 64 1167962091
INV362 52 1179788115
INV363 41 1077008198
INV364 8 1143611054
INV365 32 1178180889
INV366 55 1169726953
INV367 30 1143514541
INV368 42 1181985768
INV369 49 1170651243
INV37 48 984834126
INV370 60 1177770436
INV371 58 1163899303
INV372 48 1179283094
INV373 51 1009239312
INV374 45 1170597051
INV375 33 1149912987
INV376 289 1131447836
INV377 63 1171437391
INV378 76 1168488225
INV379 62 1166044751
INV38 4 998366792
INV380 54 1175149356
INV381 44 1155919506
INV382 237 1056358889
INV383 17 1176712065
INV384 30 1120655481
INV385 29 1165843079
INV386 39 1171071737
INV387 56 1177442728
INV388 34 1176994701
INV389 49 1167953952
INV39 5 1050770171
INV390 73 1168533590
INV391 58 1162130134
INV392 35 1173169764
INV393 68 1169176711
INV394 55 1177852925
INV395 47 1183600727
INV396 48 1181899572
INV397 42 1167995858
INV398 337 1170755978
INV399 38 1163700627
INV4 26 1178079121
INV40 6 993715375
INV400 51 1176507144
INV401 23 1109670578
INV402 10 1151709943
INV403 6 1065246632
INV404 292 1180288671
INV405 59 1165848044
INV406 41 1163567748
INV407 12 1044631257
INV408 68 1177050385
INV409 65 1172210463
INV41 5 1151519287
INV410 49 1161182414
INV411 53 1162135205
INV412 61 1169504490
INV413 53 1178451492
INV414 54 1167857969
INV415 41 1157720543
INV416 15 1130065300
INV417 21 1172240161
INV418 23 1179640685
INV419 58 1179007315
INV42 6 1094883419
INV420 65 1168494135
INV421 15 1170602412
INV422 68 1140944349
INV423 20 1182068121
INV424 51 1161151176
INV425 289 1181800355
INV426 58 1183778194
INV427 56 1152524873
INV428 37 1181059764
INV429 33 1183150543
INV43 8 1130260688
INV430 17 1162895880
INV431 8 1168073996
INV432 16 953821265
INV433 23 1165093501
INV434 28 1178140243
INV435 26 1153570909
INV436 57 1183229295
INV437 98 1168775988
INV438 30 1175624374
INV439 48 1183765169
INV44 9 1130297891
INV440 33 1182834679
INV441 62 1166367683
INV442 39 1159631380
INV443 47 1173723338
INV444 29 1179286913
INV445 54 1120407820
INV446 49 1182565343
INV447 44 1173820162
INV448 8 1099778931
INV449 9 1112149363
INV45 11 1061363842
INV450 6 1182219113
INV451 53 1167128077
INV452 57 1099506648
INV453 48 1183468124
INV454 28 1157438427
INV455 264 1160173680
INV456 39 1150347320
INV457 32 1182321740
INV458 60 1180145995
INV459 60 1009480385
INV46 5 1140274668
INV460 6 1089485995
INV461 7 1094680253
INV462 8 1121227790
INV463 40 1040605372
INV464 24 1175286942
INV465 40 1169498334
INV466 69 1169527918
INV467 38 1167718847
INV468 46 1106067541
INV469 76 1181623637
INV47 6 1125723435
INV470 62 1166674309
INV471 48 1128684741
INV472 7 1073869934
INV473 9 1134446170
INV474 29 1155126807
INV475 36 1063228700
INV476 41 1147739941
INV477 35 1174169233
INV478 71 1171166426
INV479 63 1163209472
INV48 6 1010603762
INV480 36 1170458138
INV481 68 1145964553
INV482 52 1183966324
INV483 68 1156021793
INV484 27 1117466149
INV485 33 1174621744
INV486 60 1173659946
INV487 19 1043302169
INV488 17 1163552052
INV489 30 1170798214
INV49 4 1036851011
INV490 12 1162172113
INV491 7 962266698
INV492 10 1122666348
INV493 38 1175274691
INV494 36 1161806043
INV495 21 1098367790
INV496 32 1180972952
INV497 61 1182569584
INV498 13 1096698627
INV499 40 1180574963
INV5 79 1180204163
INV50 5 1047077346
INV500 43 1166132303
INV501 23 852163924
INV502 2 875798541
INV503 25 1182573411
INV504 12 1100891702
INV505 22 1142881286
INV506 9 1085548731
INV507 23 1126059691
INV508 31 1178570313
INV509 29 1169666774
INV51 5 904855149
INV510 58 1180250471
INV511 84 1181418412
INV512 89 1176955766
INV513 42 1077018745
INV514 14 1096214158
INV515 31 1177728372
INV516 21 1110816208
INV517 11 1093891811
INV518 47 1180653691
INV519 38 1118794013
INV52 4 1094673453
INV520 32 1182120112
INV521 19 1162792033
INV522 46 1179300933
INV523 248 1138120716
INV524 68 1162458786
INV525 52 1155916427
INV526 60 1178032588
INV527 58 1183262309
INV528 42 1180405673
INV529 40 1136157887
INV53 5 1081852177
INV530 11 1159975843
INV531 8 1092169088
INV532 10 1136361044
INV533 87 1174578615
INV534 23 1123569485
INV535 8 1175145944
INV536 23 1146981517
INV537 159 1181260338
INV538 22 1176694479
INV539 51 1156761993
INV54 14 1162530826
INV540 37 1099744599
INV541 25 1172379226
INV542 59 1162280930
INV543 26 1108337100
INV544 17 1134093194
INV545 25 1129714994
INV546 72 1011135646
INV547 8 1072050341
INV548 8 1162389588
INV549 132 1174135414
INV55 158047 918570975
INV550 50 1158982056
INV551 26 974149850
INV552 6 827248324
INV553 5 1033425372
INV554 5 1133793345
INV555 6 1097022162
INV556 10 1144083606
INV557 15 1178286721
INV558 56 1151206074
INV559 40 1178349688
INV56 328887 581202287
INV560 212 1125947535
INV561 64 1165292200
INV562 48 1173158005
INV563 98 1180185400
INV564 27 1016054183
INV565 7 1084999665
INV566 22 1159672490
INV567 79 1180045721
INV568 34 1180395502
INV569 24 1176439710
INV57 96 1172550818
INV570 31 1175918517
INV571 60 1173881038
INV572 33 1183137119
INV573 40 1101227863
INV574 13 1172407254
INV575 10 1133270109
INV576 17 1160986959
INV577 63 1172188697
INV578 54 1170794397
INV579 48 1051005091
INV58 77 1171354401
INV580 6 1070516134
INV581 8 1118290074
INV582 45 1146385407
INV583 46 1174606946
INV584 39 1180186297
INV585 14 1154040621
INV586 42 1175882988
INV587 13 1082868413
INV588 9 1097592820
INV589 12 1151483778
INV59 57 1177403601
INV590 20 1178884046
INV591 54 1183961763
INV592 24 1154215854
INV593 36 1160641988
INV594 60 1177039901
INV595 38 947745255
INV596 38 1164056076
INV597 19 968254082
INV598 5 1135738023
INV599 46 1175547441
INV6 176 1135558567
INV60 61 1151453162
INV600 32 956576233
INV601 7 1137083933
INV602 201 1166190476
INV603 38 1182578625
INV604 17 1183129312
INV605 26 1163552733
INV606 20 1135116210
INV607 26 1157264987
INV608 36 1165361880
INV609 25 1068168358
INV61 99 1179883867
INV610 8 1153759493
INV611 13 1168468854
INV612 41 1165774021
INV613 8 1116094366
INV614 27 1179116268
INV615 54 1175536841
INV616 44 890161313
INV617 30 1158313566
INV618 9 1064619624
INV619 43 1157155112
INV62 43 1181610918
INV620 59 1183785476
INV621 46 1178984177
INV622 50 1170246046
INV623 40 1175116562
INV624 57 1150518809
INV625 34 1182961037
INV626 67 1171683919
INV627 32 1036846468
INV628 41 1175776049
INV629 59 1158249913
INV63 74 1164699481
INV630 57 1181123187
INV631 54 1165591773
INV632 24 1157528745
INV633 16 1154368054
INV634 51 1166471254
INV635 27 1124653331
INV636 14 1159484511
INV637 22 1182454075
INV638 17 1003622594
INV639 6 1027416730
INV64 250378 709301343
INV640 21 1161892934
INV641 50 831753780
INV642 4 1089471972
INV643 9 1101980534
INV644 44 1175702680
INV645 41 1131505858
INV646 10 1066812585
INV647 4 980796239
INV648 20 1183594436
INV649 43 1163249106
INV65 28970 1129807391
INV650 47 1144061752
INV651 10 1165110718
INV652 62 1179093290
INV653 52 1180864361
INV654 47 1159707827
INV655 12 1023645300
INV656 3 1157463834
INV657 3 1060904444
INV658 4 1181112588
INV659 15 1171997463
INV66 134 1177390952
INV660 28 938338623
INV661 5 1137688336
INV662 16 1154482827
INV663 50 1180339018
INV664 31 1179713034
INV665 31 1098347645
INV666 8 1160538827
INV667 25 1168517776
INV668 24 1019525644
INV669 20 1147310283
INV67 63 1176539335
INV670 20 1159519960
INV671 8 1077844315
INV672 10 1153381383
INV673 12 1176244129
INV674 26 1164662606
INV675 28 1130017993
INV676 18 1142803524
INV677 52 1157158752
INV678 13 1168387331
INV679 14 1159156235
INV68 76 1165743018
INV680 42 1168871199
INV681 38 1169755794
INV682 13 1068591238
INV683 21 1176695123
INV684 31 1172264547
INV685 62 1137054351
INV686 27 1175819084
INV687 23 891961094
INV688 9 1167542534
INV689 67 1134243551
INV69 166 1179537379
INV690 26 1029705715
INV691 3 1143035150
INV692 43 1165738581
INV693 12 1137462971
INV694 5 1072259877
INV695 7 1180876279
INV696 35 1175805876
INV697 18 1093802415
INV698 22 1176383333
INV699 57 1183010513
INV7 425 1163622155
INV70 66 1152695960
INV700 53 1179327736
INV701 21 1167194720
INV702 40 1176398187
INV703 42 1147439138
INV704 27 1168321087
INV705 23 1166281917
INV706 33 1151216138
INV707 18 1000323493
INV708 25 1183567352
INV709 37 1092604927
INV71 86 1160209850
INV710 195 1163550044
INV711 33 950798212
INV712 30 1152607316
INV713 37 1165714265
INV714 33 1068556053
INV715 11 1115976464
INV716 27 1161045343
INV717 35 1171844836
INV718 33 1159525911
INV719 41 1180390883
INV72 81 1179556238
INV720 11 1024131553
INV721 9 1085975686
INV722 42 1147992208
INV723 37 1181637273
INV724 38 1081813347
INV725 3 1174046842
INV726 20 1178261379
INV727 46 1178413119
INV728 13 1142733896
INV729 10 1130174875
INV73 73 1174979111
INV730 22 1175825264
INV731 19 1163517885
INV732 18 1152640158
INV733 15 1147311777
INV734 11 1091619980
INV735 38 1170155090
INV736 29 1173715878
INV737 273 1181804755
INV738 37 1181297839
INV739 23 1135918136
INV74 58 1178263797
INV740 39 1154560028
INV741 39 1138993052
INV742 11 1148738277
INV743 40 1175719353
INV744 34 1133963708
INV745 38 1123178923
INV746 49 1110255667
INV747 34 1134361193
INV748 30 1141952187
INV749 33 1158187606
INV75 90 1163122154
INV750 14 1097917745
INV751 47 1180182947
INV752 152 1183472516
INV753 44 1169067445
INV754 25 1037104111
INV755 42 1092436922
INV756 33 1076514078
INV757 8 1149458447
INV758 9 1116821197
INV759 11 1147107575
INV76 419149 383028236
INV760 13 1116806692
INV761 47 1152799099
INV762 17 1139365217
INV763 16 1179550682
INV764 42 1150157773
INV765 32 1183044411
INV766 36 1073745053
INV767 17 1161369887
INV768 8 1113384756
INV769 8 1126645824
INV77 456015 336388908
INV770 9 1121211839
INV771 12 1183174636
INV772 16 1178519113
INV773 33 1162232687
INV774 65 1172049650
INV775 30 1134087524
INV776 11 1136717487
INV777 12 1099057754
INV778 12 1133215206
INV779 31 1167273860
INV78 461673 340373361
INV780 19 1126576828
INV781 4 998118856
INV782 11 1172986735
INV783 34 1119944490
INV784 51 1169563167
INV785 13 1118920573
INV786 72 1179683902
INV787 79 1118509722
INV788 7 1078681531
INV789 11 1179163002
INV79 440037 293371618
INV790 22 789281094
INV791 4 1079695977
INV792 9 1111645608
INV793 16 1182708412
INV794 31 1103328307
INV795 25 853793460
INV796 7 1129785984
INV797 19 1105886509
INV798 9 1143534659
INV799 13 1174582815
INV8 57 1081792879
INV80 416296 246700084
INV800 69 1175357321
INV801 80 1153031168
INV802 41 1164065325
INV803 61 1162032954
INV804 40 1123882437
INV805 9 1130047032
INV806 11 1116235507
INV807 13 1126566723
INV808 28 1172489440
INV809 51 1136459610
INV81 410812 264179691
INV810 12 1062372964
INV811 10 1112670569
INV812 68 1181896580
INV813 71 1177368065
INV814 65 1111204596
INV815 15 1173116435
INV816 37 1142589085
INV817 12 1124247542
INV818 19 1161505884
INV819 24 1171403553
INV82 446601 344397490
INV820 41 1165677686
INV821 20 1180506747
INV822 15 1170391368
INV823 42 1165980829
INV824 40 1171861906
INV825 36 1077524818
INV826 9 1047907154
INV827 8 1141384454
INV828 15 1168272058
INV829 61 1178023607
INV83 434478 584457671
INV830 65 1170721200
INV831 14 1053590254
INV832 10 1057950276
INV833 8 1127887377
INV834 4 1020160878
INV835 7 1147749005
INV836 33 1176769105
INV837 20 1168205515
INV838 12 1141663061
INV839 39 1171208474
INV84 307670 866801081
INV840 9 974544864
INV841 10 1175733994
INV842 39 1166578258
INV843 29 1161961409
INV844 21 1037891489
INV845 25 1178490259
INV846 53 1169873765
INV847 86 1176021019
INV848 75 1177037179
INV849 32 1151881647
INV85 278349 857330513
INV850 8 1135911959
INV851 8 919810433
INV852 3 1139338401
INV853 3 972340244
INV854 4 1157140290
INV855 5 1126736368
INV856 31 1182264396
INV857 66 1178364544
INV858 35 1034534722
INV859 44 1177143306
INV86 227307 926212854
INV860 43 1083170751
INV861 9 1127837545
INV862 49 1177583056
INV863 70 1183935958
INV864 70 1175817111
INV865 48 1144611323
INV866 20 1130825940
INV867 84 1178249363
INV868 74 1171197019
INV869 50 1179606929
INV87 3663 1165016883
INV870 78 1175655092
INV871 75 1173593307
INV872 30 1132766399
INV873 13 1149268122
INV874 55 1173118698
INV875 57 1183964102
INV876 72 1163162176
INV877 69 1170172550
INV878 55 1171372002
INV879 69 1174685523
INV88 964 1180486186
INV880 49 1059075259
INV881 11 1138880319
INV882 21 1180633677
INV883 52 1182842349
INV884 20 1136109675
INV885 166 1166973070
INV886 67 1180049046
INV887 60 1152975227
INV888 26 1174031121
INV889 54 1126316641
INV89 10611 1072551043
INV890 38 1179060196
INV891 89 1170538515
INV892 60 1173978256
INV893 48 1160113059
INV894 39 1173248833
INV895 11 1074853584
INV896 63 1183884811
INV897 63 1176071004
INV898 75 1170180101
INV899 69 1173763390
INV9 13 1155235655
INV90 135 1091976539
INV900 25 1121271916
INV901 10 1095899144
INV902 8 1164382747
INV903 93 1165196265
INV904 78 1168904468
INV905 82 1171992942
INV906 65 1167524297
INV907 73 1179022413
INV908 60 1170979057
INV909 58 1040223970
INV91 805 1128427144
INV910 17 1182228057
INV911 30 1178396280
INV912 34 1170657200
INV913 68 1179161421
INV914 73 1177604286
INV915 65 1175686161
INV916 22 1160816021
INV917 20 1121686706
INV918 41 1181858455
INV919 82 1177890348
INV92 62020 1074818142
INV920 60 1183453569
INV921 46 1123649934
INV922 14 1181653645
INV923 59 1146738923
INV924 30 1156276741
INV925 53 1174206506
INV926 53 1133051755
INV927 36 1168921893
INV928 92 1179030018
INV929 68 1165686194
INV93 63 1182498503
INV930 53 1164652568
INV931 75 1179733947
INV932 75 1182677230
INV933 74 1174310330
INV934 65 1172491681
INV935 54 1168937707
INV936 53 1183899948
INV937 29 1116946954
INV938 14 1182872022
INV939 20 1180560669
INV94 87 1161713051
INV940 13 1068614973
INV941 12 1135184891
INV942 66 1170036243
INV943 67 1178147787
INV944 54 1176258633
INV945 52 1173175924
INV946 48 1182987332
INV947 37 1176906847
INV948 25 1165229338
INV949 41 1168712785
INV95 58 1176509978
INV950 64 1173262201
INV951 17 1128782795
INV952 6 1129534681
INV953 41 1168583996
INV954 66 1165626690
INV955 78 1178927010
INV956 37 1165600476
INV957 40 1129415356
INV958 27 1170455825
INV959 8 1122013248
INV96 97 1176767964
INV960 6 1057437514
INV961 7 1076295190
INV962 9 1155288781
INV963 32 1177676732
INV964 28 1120530576
INV965 38 1169820714
INV966 52 1163870155
INV967 39 1163923789
INV968 22 1146968951
INV969 23 1001905370
INV97 53 1183767471
INV970 7 1154394559
INV971 16 1159910001
INV972 10 1125198822
INV973 8 1168893861
INV974 10 1181886938
INV975 11 1124349472
INV976 18 1182045821
INV977 66 1168249651
INV978 46 1181676885
INV979 67 1183721606
INV98 65 1176381598
INV980 69 1181372810
INV981 70 1168976628
INV982 71 1179366520
INV983 75 1179562864
INV984 40 1173998347
INV985 26 1183201499
INV986 54 1179147162
INV987 85 1181655180
INV988 40 1179206274
INV989 66 1166440957
INV99 90 1149938021
INV990 9 1094073791
INV991 49 1168521872
INV992 30 1137158099
INV993 5 1073216512
INV994 7 1125700450
INV995 10 1171368215
INV996 13 1116949082
INV997 31 1167788264
INV998 62 1103315271
INV999 11 1177914708
MAM1 54649 917178765
MAM10 17 1127029450
MAM100 11 1123128407
MAM101 15 1161638067
MAM102 55 980993111
MAM103 7 1146926981
MAM104 9 1148341500
MAM105 11 1096082864
MAM106 12 1138729465
MAM107 14 1043866406
MAM108 7 1172863037
MAM109 16 1053097667
MAM11 18 1142664549
MAM110 10 1162520257
MAM111 11 957089192
MAM112 6 1116763930
MAM113 17 1142046998
MAM114 8 1131294285
MAM115 14 1129345140
MAM116 12 1069190761
MAM117 7 1179239711
MAM118 22 1112642816
MAM119 11 1173438088
MAM12 15 1132274725
MAM120 20 1174355561
MAM121 10 1151843378
MAM122 18 1161906477
MAM123 10 1162508305
MAM124 16 1003753502
MAM125 4 1044858104
MAM126 6 1118368376
MAM127 9 1059085083
MAM128 8 1135087546
MAM129 8 1045852539
MAM13 9 1181471817
MAM130 7 1058266063
MAM131 9 909509829
MAM132 4 1023412101
MAM133 6 1114170190
MAM134 9 1093712676
MAM135 18 1168423018
MAM136 9 1071699428
MAM137 12 1128966733
MAM138 10 1161373152
MAM139 11 1109349525
MAM14 14 1173406720
MAM140 13 1042021231
MAM141 9 1088893088
MAM142 12 1099118976
MAM143 17 1182972727
MAM144 12 1124668268
MAM145 16 1139361885
MAM146 8 1103046001
MAM147 16 1020440593
MAM148 6 1065416239
MAM149 10 1153279637
MAM15 10 1131536607
MAM150 9 996023330
MAM151 7 1082531652
MAM152 13 1108633531
MAM153 11 1133364406
MAM154 15 1131823350
MAM155 10 1121945730
MAM156 13 1026940761
MAM157 7 1116615210
MAM158 13 1062694187
MAM159 11 1159279927
MAM16 14 1173052009
MAM160 14 1133199111
MAM161 8 1172892011
MAM162 13 1183659191
MAM163 9 1144699482
MAM164 15 1092468729
MAM165 10 1119263878
MAM166 15 1121786028
MAM167 7 1153154205
MAM168 9 1003949427
MAM169 7 1071154379
MAM17 12 1057388218
MAM170 14 1060069106
MAM171 7 1116868036
MAM172 17 1151835636
MAM173 6 1048692448
MAM174 12 1110181337
MAM175 7 1119104814
MAM176 11 1131928097
MAM177 10 1073973796
MAM178 9 1107850457
MAM179 12 1149743882
MAM18 10 1098097203
MAM180 14 1159621796
MAM181 12 1101208670
MAM182 9 1122997471
MAM183 237 1012089215
MAM184 11 1140809596
MAM185 16 1183291622
MAM186 20 1124444480
MAM187 7 1106177041
MAM188 17 1002015229
MAM189 7 1170002033
MAM19 15 1026611779
MAM190 13 1161936973
MAM191 7 1072854491
MAM192 11 1148605221
MAM193 14 1100711659
MAM194 15 1131042125
MAM195 18 1108119784
MAM196 13 1108528549
MAM197 21 1087372648
MAM198 12 1121609399
MAM199 19 1128563115
MAM2 7 1177030125
MAM20 6 1069522997
MAM200 13 1100818648
MAM201 18 1144458293
MAM202 24973 319430762
MAM21 12 1147180873
MAM22 13 1089172779
MAM23 8 1147102555
MAM24 17 1161495983
MAM25 7 1160364752
MAM26 14 1119860958
MAM27 12 1168070061
MAM28 11 1147190445
MAM29 16 1179712380
MAM3 45056 812377816
MAM30 10 1156184385
MAM31 16 1138379370
MAM32 9 1133234150
MAM33 12 1136792441
MAM34 14 1083174451
MAM35 10 1114325055
MAM36 16 1100855100
MAM37 8 1087010659
MAM38 12 1132313879
MAM39 86254 1052142795
MAM4 5 977148124
MAM40 67637 1075399786
MAM41 20 1168721798
MAM42 260719 628981819
MAM43 1 716413629
MAM44 1 662751787
MAM45 2 1076242322
MAM46 6 1060323989
MAM47 7 1157094405
MAM48 374 1047383769
MAM49 11 1148682982
MAM5 13 1070912825
MAM50 270 1107760733
MAM51 16 1096674869
MAM52 11 1153008662
MAM53 15 1183890503
MAM54 3346 1174847022
MAM55 212228 666641455
MAM56 14 1092077466
MAM57 14 1163101092
MAM58 283 1113603904
MAM59 9 1139689185
MAM6 13 1061705218
MAM60 400 1104705819
MAM61 8 1083688240
MAM62 36 1141428289
MAM63 10 1174298463
MAM64 17 1141584519
MAM65 9 1177791867
MAM66 12 1142868678
MAM67 278 1016632173
MAM68 8 1175859851
MAM69 13 1079428393
MAM7 15 1160135387
MAM70 8 1131775367
MAM71 14 1079277413
MAM72 11 1080315572
MAM73 17 1101712135
MAM74 13 1051005117
MAM75 10 1174291860
MAM76 10 1119665667
MAM77 9 1177569791
MAM78 17 1028774100
MAM79 9 1137930415
MAM8 20 1124934750
MAM80 14 1061883364
MAM81 8 1162431176
MAM82 14 1127176217
MAM83 7 1104289556
MAM84 10 1116587684
MAM85 15 1097498025
MAM86 16 1122406742
MAM87 13 1044845556
MAM88 10 1183235581
MAM89 15 1154898355
MAM9 21 1147650305
MAM90 12 1149723292
MAM91 165 1088602904
MAM92 12 1142857057
MAM93 22 1023460094
MAM94 6 1069359459
MAM95 12 1067857639
MAM96 10 1096190530
MAM97 12 1006394206
MAM98 7 1130042281
MAM99 13 1091509542
PAT1 1093016 539658172
PAT10 680774 492680504
PAT11 681055 368746966
PAT12 512713 633414678
PAT13 713924 305204754
PAT14 604758 511811739
PAT15 1067049 29471928
PAT16 1086592 20709922
PAT17 1003479 603540419
PAT18 1082285 408235457
PAT19 1269258 483013416
PAT2 771014 511608220
PAT20 957110 648346475
PAT21 703658 781271266
PAT22 959602 614294633
PAT23 1206550 431766753
PAT24 1098494 363437916
PAT25 880420 445344489
PAT26 1584831 67235326
PAT27 1015395 515232965
PAT28 1071418 563344272
PAT29 885120 640007507
PAT3 745609 413099302
PAT30 763803 636252732
PAT31 627120 425469160
PAT32 500771 555999843
PAT33 730076 274346677
PAT34 281601 357450724
PAT35 590798 303966081
PAT36 962170 378854022
PAT37 547666 777361584
PAT38 967940 455315120
PAT39 1548137 54683747
PAT4 842750 549282431
PAT40 781282 691101338
PAT41 635216 559767307
PAT42 299754 606471722
PAT43 444590 290143618
PAT44 897532 198245257
PAT45 1066860 350040409
PAT46 722919 158094621
PAT47 556096 299515212
PAT48 436731 275761213
PAT49 685021 336514182
PAT5 692784 426127256
PAT50 553010 223295521
PAT51 634405 208862289
PAT52 456483 603754065
PAT53 387528 503468713
PAT54 763532 199284306
PAT55 602982 167531855
PAT56 246307 377417794
PAT57 869605 107513321
PAT58 957842 339364027
PAT59 772781 725144283
PAT6 748849 287590803
PAT60 564810 857906642
PAT61 668136 796635383
PAT62 750709 710491056
PAT63 979921 539152249
PAT64 707448 771967321
PAT65 730603 764763454
PAT66 761514 739187014
PAT67 469713 819780044
PAT68 708658 310854860
PAT69 846990 63836990
PAT7 704492 359976251
PAT70 853138 51597656
PAT71 867479 325401678
PAT72 729534 747659739
PAT73 775392 744047933
PAT74 1132815 480944097
PAT75 715743 258325977
PAT76 589184 403195191
PAT77 599819 456658006
PAT78 484113 421088316
PAT79 677980 310808871
PAT8 715915 518614844
PAT80 750445 231741168
PAT81 682399 286956464
PAT82 825095 355224613
PAT83 869017 675579444
PAT84 155758 48607436
PAT9 944169 593980995
PHG1 18866 659224584
PHG2 16413 684627785
PHG3 16802 512185254
PLN1 182538 828009590
PLN10 121 1176725979
PLN100 82 1118048218
PLN100 1 604325310
PLN100 1 582152544
PLN100 2 1158575799
PLN100 1 661621317
PLN100 1 626868012
PLN100 1 607094319
PLN100 2 1149874108
PLN100 2 1149787837
PLN100 1 656602423
PLN100 1 622110859
PLN101 120 1123411044
PLN101 1 612883152
PLN101 2 1142529769
PLN101 2 1154234909
PLN101 1 656789389
PLN101 1 625372561
PLN101 1 603451504
PLN101 2 1159731212
PLN101 2 1150269419
PLN101 1 657552530
PLN101 1 618447767
PLN102 16 1129758581
PLN102 1 613586716
PLN102 2 1143934454
PLN102 2 1152640102
PLN102 1 676241010
PLN102 1 632313166
PLN102 1 603807353
PLN102 2 1155326502
PLN102 2 1150412865
PLN102 1 662000247
PLN102 1 633487160
PLN103 16 1139423786
PLN103 1 612164168
PLN103 2 1159122729
PLN103 2 1150238410
PLN103 1 660449817
PLN103 1 627269420
PLN103 1 602651360
PLN103 2 1162506895
PLN103 2 1158496591
PLN103 1 664401522
PLN103 1 626503588
PLN104 16 1151133023
PLN104 1 611188438
PLN104 2 1171231026
PLN104 2 1156345588
PLN104 1 657436430
PLN104 1 621715108
PLN104 1 610707416
PLN104 2 1147845639
PLN104 2 1151723189
PLN104 1 660500976
PLN104 1 634743673
PLN105 16 1144877896
PLN105 1 616002081
PLN105 2 1150169128
PLN105 2 1153490048
PLN105 1 669356984
PLN105 1 631173187
PLN105 1 607766370
PLN105 2 1145806163
PLN105 2 1143277701
PLN105 1 664077638
PLN105 1 624178744
PLN106 16 1134971335
PLN106 1 609451706
PLN106 2 1144639091
PLN106 1 631526965
PLN106 1 660034972
PLN106 1 625104971
PLN106 1 608830648
PLN106 2 1146797356
PLN106 2 1146984767
PLN106 1 526310788
PLN106 1 664689228
PLN107 16 1128834202
PLN107 1 632403820
PLN107 1 613638454
PLN107 2 1172960765
PLN107 2 1147017396
PLN107 1 660476038
PLN107 1 624334204
PLN107 1 613769411
PLN107 2 1147499918
PLN107 2 1148490360
PLN107 1 663019822
PLN108 16 1130802376
PLN108 1 626669531
PLN108 1 612901747
PLN108 2 1150057662
PLN108 2 1157797487
PLN108 1 667210568
PLN108 1 635382001
PLN108 1 614569426
PLN108 2 1169192410
PLN108 2 1163716432
PLN108 1 626973123
PLN109 16 1153968170
PLN109 1 611284754
PLN109 2 1150481064
PLN109 1 659290088
PLN109 2 1150737255
PLN109 1 660553991
PLN109 1 632999331
PLN109 1 616334843
PLN109 2 1174596045
PLN109 2 1159220941
PLN109 1 659217363
PLN11 81 1074115299
PLN110 54 1182810112
PLN110 1 627225202
PLN110 1 611858135
PLN110 2 1164391514
PLN110 2 1152376894
PLN110 1 660591081
PLN110 1 627080904
PLN110 1 609113147
PLN110 2 1138662036
PLN110 2 1154130688
PLN110 1 659787933
PLN111 25 630620362
PLN111 1 626680366
PLN111 1 612118009
PLN111 2 1146809099
PLN111 2 1153763781
PLN111 1 662624081
PLN111 1 626502968
PLN111 1 614857888
PLN111 2 1161694293
PLN111 2 1153142705
PLN111 1 669220190
PLN112 1 646201372
PLN112 1 629226312
PLN112 1 613110551
PLN112 2 1144904879
PLN112 2 1160236768
PLN112 1 658438119
PLN112 1 628047470
PLN112 1 612916554
PLN112 2 1143852611
PLN112 2 1150763450
PLN112 1 657631428
PLN113 1 587623253
PLN113 1 629616096
PLN113 1 610488678
PLN113 2 1145704528
PLN113 2 1148031132
PLN113 1 655385637
PLN113 1 626286153
PLN113 1 610690180
PLN113 2 1141737084
PLN113 2 1145450335
PLN113 1 659936173
PLN114 1 663525381
PLN114 1 627661034
PLN114 1 608478632
PLN114 2 1164887918
PLN114 2 1157801119
PLN114 1 654540277
PLN114 1 624453744
PLN114 1 610565479
PLN114 2 1154225896
PLN114 2 1144646810
PLN114 1 661109612
PLN115 2 1170194602
PLN115 1 624188817
PLN115 1 609603980
PLN115 2 1153106963
PLN115 2 1149274143
PLN115 1 657668641
PLN115 1 627263816
PLN115 1 611107145
PLN115 2 1143888586
PLN115 2 1151475536
PLN115 1 659552134
PLN116 52 1140868282
PLN116 1 627284235
PLN116 1 612025601
PLN116 2 1148289352
PLN116 2 1155467049
PLN116 1 660627594
PLN116 1 636764043
PLN116 1 612684114
PLN116 2 1172404752
PLN116 2 1143811555
PLN116 1 660087335
PLN117 53 1137938586
PLN117 1 626870575
PLN117 1 607666773
PLN117 2 1160190638
PLN117 2 1151319163
PLN117 1 663157241
PLN117 1 626857742
PLN117 1 607587567
PLN117 2 1166417974
PLN117 2 1149892400
PLN117 1 660726353
PLN118 23 1161219862
PLN118 1 625613366
PLN118 1 606853752
PLN118 2 1145435293
PLN118 2 1148608716
PLN118 1 659649991
PLN118 1 630477981
PLN118 1 612914000
PLN118 2 1159094545
PLN118 2 1155390937
PLN118 1 657190419
PLN119 49 1182120568
PLN119 1 626766831
PLN119 1 610506001
PLN119 2 1139699259
PLN119 2 1151798322
PLN119 1 659109138
PLN119 1 625619081
PLN119 1 605020174
PLN119 2 1144201423
PLN119 2 1150772597
PLN119 1 660123737
PLN12 23 1134451674
PLN120 43 1182331514
PLN120 1 626033862
PLN120 1 611584699
PLN120 2 1146634294
PLN120 1 629468067
PLN120 2 1181536715
PLN120 1 634780758
PLN120 1 613857241
PLN120 2 1153523653
PLN120 2 1157943603
PLN120 1 655608708
PLN121 43 1175719222
PLN121 1 630476109
PLN121 1 611734907
PLN121 2 1148834704
PLN121 2 1153026048
PLN121 1 660958633
PLN121 1 628850999
PLN121 1 613418293
PLN121 2 1149130062
PLN121 2 1149230152
PLN121 1 662192201
PLN122 43 1183406182
PLN122 1 624651312
PLN122 1 607896916
PLN122 2 1144733231
PLN122 2 1148913967
PLN122 1 659736604
PLN122 1 626336238
PLN122 1 607408596
PLN122 2 1149881386
PLN122 2 1156807113
PLN122 1 662539114
PLN123 42 1163229317
PLN123 1 634696490
PLN123 1 614659814
PLN123 2 1155079160
PLN123 2 1150818685
PLN123 1 657222892
PLN123 1 629605540
PLN123 1 613053250
PLN123 2 1144594366
PLN123 2 1153001227
PLN123 1 663034619
PLN124 44 1182265834
PLN124 1 623546353
PLN124 1 613383894
PLN124 2 1145099380
PLN124 21 1178182689
PLN124 43 1173368751
PLN124 16 1115226327
PLN124 5 955353777
PLN124 3 875632936
PLN124 2 877648901
PLN124 3 1033679662
PLN125 82 1008208987
PLN125 34 1141347588
PLN125 12 848648943
PLN125 1 655484837
PLN125 1 626855960
PLN125 1 604911185
PLN125 2 1146256337
PLN125 2 1152814527
PLN125 1 631897805
PLN125 1 637173558
PLN125 1 641960388
PLN126 2 747319580
PLN126 2 1176182574
PLN126 2 1155488842
PLN126 1 660305412
PLN126 1 629753639
PLN126 1 609200707
PLN126 2 1175561398
PLN126 2 1154972860
PLN126 1 659208678
PLN126 1 627226266
PLN126 1 603942392
PLN127 2 884812093
PLN127 2 1145038912
PLN127 2 1141862336
PLN127 1 661554418
PLN127 1 627699516
PLN127 1 609498991
PLN127 2 1148139209
PLN127 51 1161837995
PLN127 39 664623668
PLN127 2 961863683
PLN127 1 639092456
PLN128 2 918639035
PLN128 2 1152889042
PLN128 1 616552515
PLN128 1 734473537
PLN128 2 1100022842
PLN128 2 990953513
PLN128 2 1156725275
PLN128 2 921884013
PLN128 2 954999066
PLN128 1 602817757
PLN128 2 1122645515
PLN129 7 1170902936
PLN129 35 1172890850
PLN129 34 1181509311
PLN129 92 1151713734
PLN129 41 782214027
PLN129 1 663523538
PLN129 1 635405230
PLN129 1 611936476
PLN129 2 1150154113
PLN129 2 1161072711
PLN129 1 660736956
PLN13 19 1043680087
PLN130 28 1037362098
PLN130 1 627598042
PLN130 1 612187513
PLN130 2 1155070448
PLN130 2 1145745297
PLN130 1 673406957
PLN130 1 630137118
PLN130 1 612939186
PLN130 2 1151335502
PLN130 2 1155631783
PLN130 1 657661460
PLN131 2 746994619
PLN131 1 626889213
PLN131 1 610003100
PLN131 2 1148528258
PLN131 2 1146029239
PLN131 1 662475302
PLN131 1 630354994
PLN131 1 612387238
PLN131 2 1155754903
PLN131 2 1149070389
PLN131 1 653250953
PLN132 2 884447165
PLN132 1 631324550
PLN132 1 609093722
PLN132 2 1149523883
PLN132 2 1145083390
PLN132 1 655260812
PLN132 1 634191159
PLN132 1 614681618
PLN132 2 1172767975
PLN132 2 1152836532
PLN132 1 658721539
PLN133 2 918277773
PLN133 1 626163282
PLN133 1 609194012
PLN133 2 1153379980
PLN133 2 1162676726
PLN133 1 656359106
PLN133 1 622273932
PLN133 1 610730036
PLN133 2 1152019255
PLN133 2 1150333174
PLN133 1 657708949
PLN134 31 1165164536
PLN134 1 625240013
PLN134 1 610861510
PLN134 2 1136292166
PLN134 2 1152354408
PLN134 1 657289215
PLN134 1 624169276
PLN134 1 611474174
PLN134 2 1152158626
PLN134 2 1154678582
PLN134 1 664634244
PLN135 31 1155912081
PLN135 1 643202471
PLN135 1 617103718
PLN135 2 1161114768
PLN135 2 1163751838
PLN135 1 660262686
PLN135 1 634680428
PLN135 1 612896067
PLN135 2 1153985512
PLN135 2 1159127655
PLN135 1 658111403
PLN136 29 1158538904
PLN136 1 631828453
PLN136 1 612358733
PLN136 2 1172628206
PLN136 2 1161043722
PLN136 1 661402595
PLN136 1 635870417
PLN136 1 617906818
PLN136 2 1154505804
PLN136 2 1161723662
PLN136 1 666500271
PLN137 20 1152905712
PLN137 1 632086707
PLN137 1 607961820
PLN137 2 1173780312
PLN137 21 1134943785
PLN137 29 1167338095
PLN137 33 1171528235
PLN137 12 1152489829
PLN137 92 1120024293
PLN137 30 1144069965
PLN137 31 1131160060
PLN138 37 1154367395
PLN138 37 1171331343
PLN138 18 1137163367
PLN138 18 1108681313
PLN138 11 1140492879
PLN138 14 1175056220
PLN138 51 1162077512
PLN138 14 989011425
PLN138 4 968685916
PLN138 4 989422041
PLN138 4 1035905487
PLN139 32 1137254786
PLN139 4 964344820
PLN139 4 1168659054
PLN139 5 1115864637
PLN139 18 1160077621
PLN139 33 1000994116
PLN139 1 2143528264
PLN139 1 2138631366
PLN139 1 2132989935
PLN139 1 2142145023
PLN139 1 2142779784
PLN14 4 927535920
PLN140 17 1149535900
PLN140 1 124381055
PLN140 1 2112395848
PLN140 1 2144481838
PLN140 1 2133121580
PLN140 1 2141806609
PLN140 1 1870266305
PLN140 1 2134931027
PLN140 1 2108664250
PLN140 1 2146278775
PLN140 1 2117022170
PLN141 21 1155383232
PLN141 1 1576301307
PLN141 1 2067099338
PLN141 1 2134690998
PLN141 1 2136662657
PLN141 1 2140543523
PLN141 1 1531582847
PLN141 1 2146571508
PLN141 1 2138192289
PLN141 1 2101175359
PLN141 1 2146227213
PLN142 77 1140690999
PLN142 1 621086779
PLN142 1 2138605540
PLN142 1 2083688238
PLN142 1 2144314009
PLN142 1 2139184679
PLN142 1 172723629
PLN142 1 2132146989
PLN142 1 2133919239
PLN142 1 2133305249
PLN142 1 2100933269
PLN143 31 1152653146
PLN143 1 143347570
PLN143 1 2134142781
PLN143 1 2145201137
PLN143 1 2137733646
PLN143 1 1914313492
PLN143 1 2145479601
PLN143 1 2114166385
PLN143 1 2146417222
PLN143 1 1555468501
PLN143 1 2141253099
PLN144 29 1155649750
PLN144 1 2119186544
PLN144 1 2142175433
PLN144 1 1498831827
PLN144 9 1052661862
PLN144 13 1137925323
PLN144 34 858656987
PLN144 2 1034251136
PLN144 2 1041322427
PLN144 2 959575375
PLN144 2 1005137949
PLN145 18 1163148512
PLN145 2 1136683915
PLN145 2 1019386330
PLN145 3 1015418383
PLN145 2 1022027198
PLN145 2 1025363455
PLN145 2 931056427
PLN145 2 969293345
PLN145 2 1064158730
PLN145 2 968690797
PLN145 3 980008249
PLN146 39 1160931060
PLN146 2 1043031688
PLN146 2 1031876872
PLN146 2 943080858
PLN146 2 1000998827
PLN146 2 1157028134
PLN146 2 1004786053
PLN146 3 985677594
PLN146 2 1014843260
PLN146 2 1068644986
PLN146 2 948335936
PLN147 58 1143209109
PLN147 2 879747037
PLN147 2 1127570290
PLN147 2 990438732
PLN147 3 875786730
PLN147 2 991559490
PLN147 2 942009307
PLN147 2 906129229
PLN147 2 936264359
PLN147 2 928886758
PLN147 2 935093463
PLN148 24 1126771548
PLN148 2 930365420
PLN148 2 990803747
PLN148 2 885021138
PLN148 2 908456347
PLN148 2 930959077
PLN148 2 1041934893
PLN148 2 942999660
PLN148 3 908571112
PLN148 2 994915609
PLN148 2 1008745383
PLN149 25 1086508633
PLN149 2 850230395
PLN149 2 915695621
PLN149 2 1025227490
PLN149 2 862764790
PLN149 2 884517818
PLN149 2 958486939
PLN149 2 882430803
PLN149 2 805094337
PLN149 2 912116412
PLN149 2 1080442405
PLN15 5 1105033693
PLN150 26 1156422977
PLN150 2 903251998
PLN150 3 846587112
PLN150 2 997148082
PLN150 2 1024702898
PLN150 3 1046276430
PLN150 2 960152348
PLN150 2 997566044
PLN150 2 926826996
PLN150 2 970728340
PLN150 2 1076556621
PLN151 34 1153997507
PLN151 2 961846356
PLN151 3 1105984004
PLN151 2 1091311779
PLN151 2 928973494
PLN151 4 966977223
PLN151 2 1034513146
PLN151 2 973973117
PLN151 2 836784321
PLN151 2 990350501
PLN151 2 1034765442
PLN152 28 1081209856
PLN152 2 918838269
PLN152 2 998373654
PLN152 2 1023553300
PLN152 2 914623388
PLN152 2 836746646
PLN152 2 993956991
PLN152 2 952571408
PLN152 2 873792954
PLN152 3 942162386
PLN152 2 990124494
PLN153 212 1011667729
PLN153 2 909364021
PLN153 2 882617017
PLN153 2 897026796
PLN153 2 1002960583
PLN153 2 873235512
PLN153 2 976812402
PLN153 2 1096125550
PLN153 2 964192102
PLN153 2 869744809
PLN153 2 940385236
PLN154 31 1071897524
PLN154 2 956987604
PLN154 2 893651928
PLN154 11 1138345400
PLN154 17 1160613983
PLN154 17 1152282495
PLN154 17 1161769737
PLN154 17 1137473602
PLN154 16 1149378136
PLN154 17 1140788494
PLN154 17 1173897061
PLN155 93 1159051621
PLN155 17 1169465378
PLN155 9 1142566106
PLN155 1 827770304
PLN155 1 819590567
PLN155 1 657919172
PLN155 1 735222392
PLN155 1 640551262
PLN155 2 850883630
PLN155 1 641523445
PLN155 1 830702509
PLN156 24 1160432627
PLN156 1 817725293
PLN156 1 657518596
PLN156 1 728079018
PLN156 1 637620844
PLN156 2 841520699
PLN156 2 787615973
PLN156 2 1005487930
PLN156 2 870370402
PLN156 2 954925343
PLN156 2 877145967
PLN157 8 1124139922
PLN157 2 915888348
PLN157 2 951785915
PLN157 2 976596859
PLN157 2 981034558
PLN157 2 853229614
PLN157 2 968208187
PLN157 2 1065368112
PLN157 2 928206292
PLN157 3 960272742
PLN157 2 1022027198
PLN158 138 1111971587
PLN158 2 1025363455
PLN158 2 931056427
PLN158 2 969293345
PLN158 2 1064158730
PLN158 2 968690797
PLN158 3 980008249
PLN158 2 991559490
PLN158 2 942009307
PLN158 2 906129229
PLN158 2 936264359
PLN159 30 1164490168
PLN159 2 928886758
PLN159 2 935093463
PLN159 2 930365420
PLN159 2 990803747
PLN159 2 885021138
PLN159 2 908456347
PLN159 2 930959077
PLN159 2 1041934893
PLN159 2 942999660
PLN159 3 908571112
PLN16 4 1121010413
PLN160 44 1183257891
PLN160 2 934307380
PLN160 2 919820886
PLN160 2 904199719
PLN160 2 879641827
PLN160 2 1019726094
PLN160 2 948044567
PLN160 2 935988512
PLN160 2 1001554393
PLN160 2 1004892626
PLN160 2 870794531
PLN161 187 1105727933
PLN161 2 886494923
PLN161 2 1089597455
PLN161 2 891403268
PLN161 3 916201336
PLN161 2 994915609
PLN161 2 1008745383
PLN161 2 850230395
PLN161 2 915695621
PLN161 2 1025227490
PLN161 2 862764790
PLN162 98 1131765996
PLN162 2 884517818
PLN162 2 958486939
PLN162 2 882430803
PLN162 2 805094337
PLN162 2 912116412
PLN162 2 1080442405
PLN162 2 903251998
PLN162 3 846587112
PLN162 2 1034251136
PLN162 2 1041322427
PLN163 21 1061917101
PLN163 2 959575375
PLN163 2 1005137949
PLN163 2 1136683915
PLN163 2 1019386330
PLN163 3 1015418383
PLN163 2 997148082
PLN163 2 1024702898
PLN163 3 1046276430
PLN163 2 960152348
PLN163 2 997566044
PLN164 15 1091287551
PLN164 2 926826996
PLN164 2 970728340
PLN164 2 1076556621
PLN164 2 961846356
PLN164 3 1105984004
PLN164 2 1091311779
PLN164 2 928973494
PLN164 4 994697394
PLN164 2 1128818178
PLN164 2 1018548947
PLN165 58 1165279963
PLN165 2 883277256
PLN165 2 1015247550
PLN165 2 1033440010
PLN165 2 938819340
PLN165 3 859495519
PLN165 2 1034513146
PLN165 2 973973117
PLN165 2 836784321
PLN165 2 990350501
PLN165 2 1034765442
PLN166 76 1174433204
PLN166 2 973886503
PLN166 2 992822994
PLN166 2 897431557
PLN166 2 808457311
PLN166 2 953662853
PLN166 2 1058778957
PLN166 2 930200695
PLN166 3 895052557
PLN166 2 1043031688
PLN166 2 1031876872
PLN167 7 1023134224
PLN167 2 943080858
PLN167 2 1000998827
PLN167 2 1157028134
PLN167 2 1004786053
PLN167 3 985677594
PLN167 2 787615973
PLN167 2 1005487930
PLN167 2 870370402
PLN167 2 954925343
PLN167 2 877145967
PLN168 3 987843021
PLN168 2 915888348
PLN168 2 951785915
PLN168 2 976596859
PLN168 2 981034558
PLN168 2 853229614
PLN168 2 968208187
PLN168 2 1065368112
PLN168 2 928206292
PLN168 3 960272742
PLN168 4 1031468481
PLN169 13 1147553433
PLN169 29 1161715798
PLN169 18 1164014015
PLN169 86 1098733546
PLN169 12 1140796870
PLN169 53 1160691643
PLN169 29 1105078032
PLN169 50 1145575965
PLN169 43 1177757480
PLN169 43 1150824379
PLN169 34 1155874556
PLN17 5 1117296533
PLN170 30 1169021303
PLN170 50 1155922795
PLN170 47 1132536680
PLN170 23 1141693484
PLN170 26 1169836001
PLN170 5 177893042
PLN170 1 1999785258
PLN170 1 1545728702
PLN170 1 1499997841
PLN170 1 1493209057
PLN170 1 1187610474
PLN171 43 1175210350
PLN171 1 943684407
PLN171 8 1161825966
PLN171 39 1170204862
PLN171 39 1150468932
PLN171 50 1175229069
PLN171 53 1181331990
PLN171 11 787764687
PLN171 1 656850665
PLN171 1 633960920
PLN171 1 609171657
PLN172 27 1138426334
PLN172 2 1143703028
PLN172 2 979242293
PLN172 3 990086045
PLN172 4 1070469512
PLN172 30 961812843
PLN172 2 1109448078
PLN172 1 767071137
PLN172 1 671256291
PLN172 1 670741101
PLN172 1 671191297
PLN173 25 1148725445
PLN173 1 771176557
PLN173 1 643128204
PLN173 1 694350238
PLN173 1 641290954
PLN173 2 1174904300
PLN173 1 745638687
PLN173 8 1174732410
PLN173 35 1180289630
PLN173 18 1181205473
PLN173 41 1176106470
PLN174 26 1166741474
PLN174 8 972308232
PLN174 5 998918288
PLN174 4 1175221657
PLN174 44 1182640697
PLN174 57 1044582350
PLN174 4 954531898
PLN174 5 1025819629
PLN174 6 984147449
PLN174 5 1137917005
PLN174 5 1007898041
PLN175 51 1170654916
PLN175 6 1070397818
PLN175 5 1111212694
PLN175 6 1089162517
PLN175 3 421610440
PLN175 1 956684326
PLN175 1 561974515
PLN175 1 718270646
PLN175 1 682093502
PLN175 1 700447244
PLN175 1 683485999
PLN176 35 1180644427
PLN176 1 723946829
PLN176 1 751391258
PLN176 1 651249186
PLN176 2 1175723351
PLN176 2 1136845382
PLN176 118 1170579475
PLN176 54 1049025390
PLN176 68 1088778107
PLN176 73 1119209590
PLN176 22 1127767597
PLN177 35 1178309823
PLN177 46 1093558514
PLN177 68 1114528363
PLN177 41 1064490534
PLN177 10 1140443142
PLN177 29 1112900486
PLN177 70 1142119072
PLN177 99 1179912936
PLN177 96 1181404594
PLN177 67 1084884007
PLN177 2 933307241
PLN178 34 1165044314
PLN178 7 1182242757
PLN178 22 1177390369
PLN178 8 1153933128
PLN178 37 1144473388
PLN178 49 1180784520
PLN178 55 1171927849
PLN178 47 1114711079
PLN178 13 1109766498
PLN178 8 1107099447
PLN178 16 1149081006
PLN179 34 1166648442
PLN179 29 1127504010
PLN179 13 1018612861
PLN179 16 1052342486
PLN179 5 693259785
PLN179 2 1045973173
PLN179 2 1158403266
PLN179 80 1164277484
PLN179 199 1115126474
PLN179 18 1171120860
PLN179 21 1146591206
PLN18 4 1087849538
PLN180 34 1154235685
PLN180 31 1102785788
PLN180 8 1076126098
PLN180 8 864666226
PLN180 3 1111279011
PLN180 40 1157082133
PLN180 47 1162966031
PLN180 32 1101235099
PLN180 49 1021545126
PLN180 4 1128758998
PLN180 6 1144601540
PLN181 35 1181945520
PLN181 3 940719410
PLN181 5 1181840911
PLN181 4 1038695499
PLN181 4 1011553213
PLN181 111 1166142505
PLN181 24 1172060583
PLN181 51 1162442050
PLN181 10 1136931185
PLN181 1 1022901297
PLN181 1 981102465
PLN182 33 1182117489
PLN182 1 976125608
PLN182 1 917323440
PLN182 1 850457102
PLN182 1 839193984
PLN182 1 817723161
PLN182 1 817139115
PLN182 1 814406492
PLN182 1 772677518
PLN182 1 772908146
PLN182 1 765793897
PLN183 16 963201441
PLN183 1 761983751
PLN183 1 764473882
PLN183 4 1011158055
PLN183 4 1008776197
PLN183 6 815519305
PLN183 2 991469964
PLN183 2 816205905
PLN183 3 1056510218
PLN183 3 989952844
PLN183 3 956055548
PLN184 1 660154351
PLN184 3 919956468
PLN184 7 1163446212
PLN184 28 1167164746
PLN184 16 1110397238
PLN184 39 1150343954
PLN184 39 1166631704
PLN184 107 1138433606
PLN184 55 1175894729
PLN184 35 1154506880
PLN184 7 740342915
PLN185 1 785289892
PLN185 2 984932635
PLN185 2 1071778215
PLN185 1 656130546
PLN185 16 1182073380
PLN185 45 1176527092
PLN185 34 1121126959
PLN185 9 1099497021
PLN185 23 1182637469
PLN185 14 985562895
PLN185 4 1148967398
PLN186 1 752191036
PLN186 7 1119025184
PLN186 5 1091663592
PLN186 6 1099009318
PLN186 27 1135567827
PLN186 13 1133007134
PLN186 15 1135637088
PLN186 41 1163273408
PLN186 22 1080875863
PLN186 95 1103098914
PLN186 1 949323565
PLN187 2 1138634422
PLN187 1 915317115
PLN187 1 901665926
PLN187 1 822089110
PLN187 1 755633405
PLN187 1 854068172
PLN187 2 1141141404
PLN187 2 1041566903
PLN187 2 1001403931
PLN187 2 875973322
PLN187 43 1173385605
PLN188 1 581969875
PLN188 30 1092520979
PLN188 19 1076669045
PLN188 25 1151243202
PLN188 41 1092457164
PLN188 8 1107304518
PLN188 14 1177666894
PLN188 76 1124581439
PLN188 5 1103363314
PLN188 8 1175959732
PLN188 20 1168219198
PLN189 1 742820188
PLN189 141 1182723327
PLN189 64 1153359822
PLN189 11 801094462
PLN189 2 840426663
PLN189 3 1133062094
PLN189 49 967271682
PLN189 2 1130771350
PLN189 2 1164863489
PLN189 2 1091053465
PLN189 2 1110446937
PLN19 5 1095872506
PLN190 1 722258891
PLN190 1 650429017
PLN190 1 615497416
PLN190 1 605521199
PLN190 2 1151975812
PLN190 2 1040516887
PLN190 1 638826493
PLN190 1 605724068
PLN190 2 1161881882
PLN190 2 1174936293
PLN190 2 1161162149
PLN191 1 529961705
PLN191 1 618366599
PLN191 1 606666664
PLN191 2 1134915552
PLN191 2 1149087886
PLN191 1 652904783
PLN191 1 620394872
PLN191 1 604515745
PLN191 2 1143962729
PLN191 2 1109768142
PLN191 1 623097078
PLN192 1 696896727
PLN192 2 1164411152
PLN192 2 1089609646
PLN192 2 1104012305
PLN192 1 653771317
PLN192 1 619592024
PLN192 1 602189318
PLN192 2 1138238587
PLN192 2 1141977764
PLN192 1 662784976
PLN192 1 616351571
PLN193 1 768317091
PLN193 1 604894944
PLN193 2 1131415633
PLN193 2 1143337624
PLN193 1 655822004
PLN193 1 616990145
PLN193 1 608259649
PLN193 2 1145732503
PLN193 48 1158890732
PLN193 21 1122885516
PLN193 42 954794573
PLN194 1 635914663
PLN194 4 1030742943
PLN194 6 1183833334
PLN194 96 1165049834
PLN194 1 1034507165
PLN194 1 739697766
PLN194 1 726504577
PLN194 1 697169871
PLN194 1 657249472
PLN194 11 1183269103
PLN194 59 1158848735
PLN195 1 873778448
PLN195 2 740850932
PLN195 1 613116700
PLN195 2 1110847379
PLN195 1 588160925
PLN195 2 1151556468
PLN195 2 1144988165
PLN195 2 920960533
PLN195 2 964492557
PLN195 2 1026741635
PLN195 2 924313884
PLN196 1 759363255
PLN196 2 1063012415
PLN196 2 1039365721
PLN196 2 984082969
PLN196 2 1129535037
PLN196 1 606904469
PLN196 1 704570097
PLN196 2 1075296834
PLN196 2 959428510
PLN196 2 1120194583
PLN196 2 907700912
PLN197 1 661150927
PLN197 2 932374047
PLN197 1 584039244
PLN197 2 1095368857
PLN197 2 1067733679
PLN197 2 1002164729
PLN197 2 1135772918
PLN197 1 615082505
PLN197 1 702454015
PLN197 2 1045744244
PLN197 2 1009182391
PLN198 1 822617018
PLN198 2 1074824830
PLN198 2 960708153
PLN198 2 1109767937
PLN198 2 861277826
PLN198 2 1005003303
PLN198 2 1145902141
PLN198 1 605355565
PLN198 1 704323042
PLN198 2 1084228640
PLN198 2 960605747
PLN199 1 788135348
PLN199 2 1135996330
PLN199 2 917706652
PLN199 2 937906817
PLN199 1 590402045
PLN199 2 1097711705
PLN199 2 1078735886
PLN199 2 1029184626
PLN199 1 647763942
PLN199 2 1152087092
PLN199 1 728320446
PLN2 215165 732039570
PLN20 4 1116943762
PLN200 1 505466611
PLN200 2 1086474352
PLN200 2 990486535
PLN200 1 580285563
PLN200 2 1032931982
PLN200 2 1103429271
PLN200 2 978248508
PLN200 2 1139236022
PLN200 2 1065837260
PLN200 2 1031299716
PLN200 2 1133272237
PLN201 1 723777933
PLN201 1 630752191
PLN201 1 715059151
PLN201 2 1114037314
PLN201 2 989498261
PLN201 1 582262590
PLN201 2 1043392634
PLN201 2 1117131234
PLN201 2 991631299
PLN201 2 1137043038
PLN201 2 1043686811
PLN202 5 1107711193
PLN202 2 981316446
PLN202 2 1138137611
PLN202 1 612059421
PLN202 1 718679113
PLN202 2 1068000765
PLN202 2 973516933
PLN202 2 1161127165
PLN202 2 917801954
PLN202 2 953364613
PLN202 1 593213508
PLN203 9 1071213085
PLN203 27 1137938961
PLN203 25 1150371405
PLN203 22 1177815125
PLN203 62 1165680709
PLN203 11 768041265
PLN203 1 685330109
PLN203 1 696943691
PLN203 1 629773018
PLN203 1 636614816
PLN203 1 579256678
PLN204 7 1044550543
PLN204 27 1145464043
PLN204 3 938113679
PLN204 36 1177868785
PLN204 58 1179369301
PLN204 59 1175284921
PLN204 6 750509095
PLN204 1 697452890
PLN204 1 716474979
PLN204 1 639720019
PLN204 1 636017747
PLN205 10 1138720651
PLN205 1 586421619
PLN205 24 1173039665
PLN205 44 1184118523
PLN205 47 1166901193
PLN205 45 1174667444
PLN205 45 1178395115
PLN205 34 1155109077
PLN205 15 1149879199
PLN205 155 1151814264
PLN205 24 1141119428
PLN206 7 1023679923
PLN206 10 1153314664
PLN206 21 1169844120
PLN206 56 1152974604
PLN206 20 1129272135
PLN206 2 1115555839
PLN206 2 1002974161
PLN206 2 901479101
PLN206 4 732491706
PLN206 1 1127959451
PLN206 1 1087409829
PLN207 8 1058501289
PLN207 1 1046485798
PLN207 1 1019676980
PLN207 1 967807955
PLN207 1 838786986
PLN207 1 700411051
PLN207 1 694962670
PLN207 39 1151215141
PLN207 10 970223738
PLN207 21 1179220770
PLN207 43 1182912800
PLN208 9 1088046914
PLN208 43 1173064982
PLN208 34 1130980249
PLN208 27 1153123167
PLN208 27 1139309430
PLN208 17 1130303106
PLN208 7 805123679
PLN208 1 731695907
PLN208 1 498928130
PLN208 1 795014878
PLN208 1 801925238
PLN209 8 1113257928
PLN209 1 670943760
PLN209 1 758945776
PLN209 1 869860623
PLN209 1 637624025
PLN209 1 761967929
PLN209 1 691761276
PLN209 1 533851895
PLN209 1 717241891
PLN209 1 738100095
PLN209 1 582137707
PLN21 5 1159914385
PLN210 9 1067049681
PLN210 1 622921430
PLN210 1 746012979
PLN210 1 505005710
PLN210 1 754782214
PLN210 1 767097325
PLN210 26 1180657162
PLN210 14 1135714116
PLN210 13 1142561392
PLN210 9 846608479
PLN210 3 1099362470
PLN211 8 1154254085
PLN211 3 962277806
PLN211 27 1181954211
PLN211 49 1175902110
PLN211 16 1114752513
PLN211 10 1089252646
PLN211 14 1041945905
PLN211 3 996194210
PLN211 4 1162029625
PLN211 5 1135478320
PLN211 8 991361234
PLN212 419 1131241827
PLN212 3 1009806456
PLN212 4 1180940189
PLN212 5 1149349845
PLN212 8 1145450003
PLN212 26 1080482572
PLN212 42 1162023041
PLN212 68 1134148184
PLN212 14 1172237460
PLN212 39 1116825586
PLN212 85 1135213375
PLN213 40 1166956996
PLN213 17 1172907744
PLN213 8 800965308
PLN213 1 656321874
PLN213 1 651505715
PLN213 1 644174002
PLN213 2 1127667560
PLN213 4 1008863458
PLN213 1 667753205
PLN213 1 647043717
PLN213 1 631554701
PLN214 72 1141429415
PLN214 2 1110586516
PLN214 4 1001638190
PLN214 2 956645826
PLN214 2 913338306
PLN214 2 818871538
PLN214 3 1123365863
PLN214 55 1175905135
PLN214 6 1105645123
PLN214 8 1106281670
PLN214 11 1161799587
PLN215 15 1126664634
PLN215 14 964438735
PLN215 2 858791006
PLN215 2 827008786
PLN215 3 1074684201
PLN215 39 1178827213
PLN215 20 699529731
PLN215 2 1061138898
PLN215 2 940965553
PLN215 2 887099997
PLN215 6 1096684262
PLN216 16 1166804795
PLN216 4 1027996786
PLN216 9 1181145447
PLN216 25 1148907437
PLN216 26 1154104031
PLN216 31 1103110592
PLN216 21 1132854120
PLN216 32 1145336635
PLN216 17 1137937859
PLN216 14 1103576729
PLN216 11 1127684862
PLN217 68 1166538560
PLN217 12 1139337127
PLN217 14 1130528758
PLN217 10 1172452672
PLN217 13 1094338854
PLN217 11 1100898515
PLN217 14 1178658871
PLN217 48 1164988630
PLN217 37 1158396193
PLN217 19 1163045581
PLN217 15 1097606314
PLN218 21 1060362529
PLN218 12 1126079850
PLN218 49 1179252764
PLN218 54 1180495350
PLN218 21 1158370784
PLN218 15 901303517
PLN218 4 1056606846
PLN218 4 970045424
PLN218 14 1175815314
PLN218 30 1135519540
PLN218 23 1140759269
PLN219 8 1136679996
PLN219 15 1136230782
PLN219 7 874429687
PLN219 1 630581173
PLN219 1 621322618
PLN219 2 1172198289
PLN219 4 1074886465
PLN219 1 622680414
PLN219 1 620440803
PLN219 2 1176901011
PLN219 2 1119015151
PLN22 4 1050249720
PLN220 98 1180021914
PLN220 2 1124875221
PLN220 2 1080278328
PLN220 2 1030001839
PLN220 2 872835706
PLN220 11 1053089336
PLN220 5 1041729698
PLN220 13 1141735497
PLN220 14 1097636806
PLN220 4 983153695
PLN220 17 1145078255
PLN221 115 1172773378
PLN221 78 1165277206
PLN221 25 1133914880
PLN221 12 1047153246
PLN221 9 1091564069
PLN221 12 1181084579
PLN221 7 1021604808
PLN221 5 1160848550
PLN221 6 1096603711
PLN221 48 1142628787
PLN221 11 966321908
PLN222 53 1171078882
PLN222 5 1113602892
PLN222 18 1152924908
PLN222 54 1142332585
PLN222 17 1015334614
PLN222 7 1119240361
PLN222 10 1124249086
PLN222 18 1061897083
PLN222 2 834923568
PLN222 3 1154803579
PLN222 10 1132248132
PLN223 68 1167927822
PLN223 10 1157631108
PLN223 12 1151523600
PLN223 35 1173321892
PLN223 52 1119584784
PLN223 27 1116817583
PLN223 18 926024497
PLN223 5 1048475623
PLN223 8 1172751465
PLN223 6 989966364
PLN223 6 1114152599
PLN224 45 1177695656
PLN224 18 1177330767
PLN224 25 1154406234
PLN224 20 1158069461
PLN224 21 1140985184
PLN224 22 1163455393
PLN224 32 1151364786
PLN224 12 989635656
PLN224 4 1006862307
PLN224 5 949196134
PLN224 4 993580938
PLN225 46 1174802772
PLN225 8 1135303813
PLN225 10 1135985233
PLN225 13 1075212552
PLN225 11 1103402721
PLN225 14 1182348950
PLN225 81 1183551308
PLN225 38 1178395676
PLN225 85 1161517144
PLN225 41 647535901
PLN225 1 594710261
PLN226 46 1183822395
PLN226 1 697014171
PLN226 1 502462700
PLN226 1 806336100
PLN226 1 811117298
PLN226 1 670536327
PLN226 1 758903171
PLN226 1 849591089
PLN226 1 631961089
PLN226 1 766934839
PLN226 1 691366293
PLN227 46 1182727864
PLN227 1 524389427
PLN227 1 723986579
PLN227 1 741326512
PLN227 1 577757604
PLN227 1 624914147
PLN227 1 728224511
PLN227 1 501068942
PLN227 1 744560595
PLN227 1 740601171
PLN227 25 1176967435
PLN228 45 1172121273
PLN228 48 1181593803
PLN228 34 1169619694
PLN228 29 1166942441
PLN228 26 1131925608
PLN228 40 1181283842
PLN228 46 1137790003
PLN228 17 1177050011
PLN228 51 920559018
PLN228 1 591862964
PLN228 1 671280887
PLN229 46 1174888727
PLN229 1 797885371
PLN229 1 810727183
PLN229 1 757079690
PLN229 1 838911320
PLN229 1 760432648
PLN229 1 694322583
PLN229 1 713809180
PLN229 1 739562375
PLN229 1 618044106
PLN229 1 725502821
PLN23 4 930101566
PLN230 46 1180957780
PLN230 1 743832821
PLN230 37 1181634349
PLN230 102 1181542175
PLN230 48 1152811513
PLN230 26 1158979747
PLN230 14 1035010580
PLN230 23 1165328158
PLN230 13 954363693
PLN230 3 1053546770
PLN230 4 1175946526
PLN231 60 1161691315
PLN231 5 1157190648
PLN231 5 1031384316
PLN231 4 1003485696
PLN231 5 893323335
PLN231 4 1073030036
PLN231 6 1113196064
PLN231 4 1090650523
PLN231 6 1136102235
PLN231 4 1041876829
PLN231 6 1043659142
PLN232 86 1155011168
PLN232 4 1066154679
PLN232 6 1103201064
PLN232 4 1083220841
PLN232 201 1129341654
PLN232 40 1156534221
PLN232 40 1167357938
PLN232 37 1169719235
PLN232 37 1174367452
PLN232 35 1180681429
PLN232 35 1164167480
PLN233 39 1182946639
PLN233 26 1106163656
PLN233 58 1174770723
PLN233 59 1170087745
PLN233 49 1168825712
PLN233 43 1026794045
PLN233 6 1113995029
PLN233 17 1139152472
PLN233 34 1170769744
PLN233 32 1176233295
PLN233 27 1073896212
PLN234 101 1109690543
PLN234 20 1103986694
PLN234 14 1060079705
PLN234 13 1057839276
PLN234 5 964213101
PLN234 8 1058854893
PLN234 12 1085293952
PLN234 5 1032446614
PLN234 9 1060901548
PLN234 59 1100332300
PLN234 40 1069431960
PLN235 202117 801112978
PLN235 36 1090922833
PLN235 10 950757506
PLN235 13 995479736
PLN235 14 1031895263
PLN235 13 1054243368
PLN235 23 1174227250
PLN235 27 1178312526
PLN235 46 1183319805
PLN235 20 1089419876
PLN235 3 1007783466
PLN236 517955 404271883
PLN236 4 1067366658
PLN236 61 1122944689
PLN236 28 1149195933
PLN236 24 1162983413
PLN236 19 1159516002
PLN236 22 1054227318
PLN236 7 1072184824
PLN236 40 1183524552
PLN236 26 1168047558
PLN236 28 1176648412
PLN237 230290 713291475
PLN237 32 1178593993
PLN237 33 1124465200
PLN237 12 1152204612
PLN237 4 678949347
PLN237 1 657756917
PLN237 1 627222211
PLN237 1 607000545
PLN237 2 1139805473
PLN237 9 1122252425
PLN237 30 1114385234
PLN238 212504 377195174
PLN238 46 1167997568
PLN238 47 1177658539
PLN238 32 1064160331
PLN238 30 943996975
PLN238 7 1091071095
PLN238 2 1139026097
PLN238 2 1017655985
PLN238 2 947053856
PLN238 2 848130640
PLN238 3 1173504592
PLN239 10165 1087115901
PLN239 24 1008229949
PLN239 1 775559507
PLN239 1 1011422590
PLN239 1 1128390902
PLN239 1 973439859
PLN239 1 924458964
PLN239 1 943691929
PLN239 3 1130053098
PLN239 17 1126632438
PLN239 21 957413489
PLN24 4 938997910
PLN240 17 1127522877
PLN240 3 987619947
PLN240 5 1101444971
PLN240 29 1106288228
PLN240 14 1177657303
PLN240 27 1162388876
PLN240 55 1180609710
PLN240 117 1128125322
PLN240 32 1167704225
PLN240 33 1040570226
PLN240 6 1089739161
PLN241 513 1081243566
PLN241 7 1117322923
PLN241 8 1107980742
PLN241 6 1132323584
PLN241 7 1122067498
PLN241 60 1162672910
PLN241 64 1147094858
PLN241 12 1117992951
PLN241 10 1175239723
PLN241 11 1167601666
PLN241 9 1152304468
PLN242 4 638455445
PLN242 10 1152563723
PLN242 11 1040594205
PLN242 1 855200634
PLN242 1 820202995
PLN242 1 805441917
PLN242 1 771724241
PLN242 1 762070625
PLN242 1 751169182
PLN242 1 750359204
PLN242 1 744247545
PLN243 1 612216829
PLN243 1 734040163
PLN243 1 727768223
PLN243 1 706380543
PLN243 1 697440629
PLN243 1 657106680
PLN243 1 652311491
PLN243 1 644076382
PLN243 1 626530690
PLN243 2 1181567311
PLN243 2 1048701616
PLN244 2 1145038356
PLN244 32 1180535226
PLN244 59 1154285521
PLN244 31 1154120145
PLN244 104 1055365244
PLN244 15 1048106591
PLN244 9 1012333527
PLN244 3 954912184
PLN244 4 964508173
PLN244 3 943820987
PLN244 4 1116063982
PLN245 2 1052833268
PLN245 19 1084924945
PLN245 20 1041361886
PLN245 18 1080222971
PLN245 52391 950955621
PLN245 162238 769797050
PLN245 181760 744892166
PLN245 125067 296231059
PLN246 869 1141292333
PLN247 456815 457791779
PLN248 466042 397328843
PLN249 445872 415263911
PLN25 4 1090601783
PLN250 407973 445988918
PLN251 383917 476697686
PLN252 339195 529833471
PLN253 271308 606010337
PLN254 49314 1054188928
PLN255 4974 1091792912
PLN256 1300 1151955439
PLN257 1 675310294
PLN258 1 628753756
PLN259 1 624247919
PLN26 5 1111969474
PLN260 2 1172266179
PLN261 8558 784305539
PLN262 1 727344967
PLN263 1 946003158
PLN264 1 965754312
PLN265 1 906459801
PLN266 1 876148008
PLN267 1 885153844
PLN268 1 899925126
PLN269 4283 1114988573
PLN27 3837 1121073683
PLN270 790 778357973
PLN271 1 541700351
PLN272 1 696809892
PLN273 1 655542733
PLN274 1 648987779
PLN275 1 622068216
PLN276 1 583456046
PLN277 132 1176770373
PLN278 1 675310294
PLN279 1 628753756
PLN28 69 1178437763
PLN280 1 624247919
PLN281 2 1172266179
PLN282 345 729691402
PLN283 1 521073757
PLN284 1 672273650
PLN285 1 634137895
PLN286 1 624121443
PLN287 2 1171800569
PLN288 2 1153005584
PLN289 1 661076038
PLN29 11 1158106027
PLN290 1 626572591
PLN291 1 612852138
PLN292 2 1169525711
PLN293 2 1136827172
PLN294 1 653624577
PLN295 1 616219606
PLN296 1 610044819
PLN297 2 1134152592
PLN298 2 1156707404
PLN299 1 685423969
PLN3 139609 750879739
PLN30 4 1019989148
PLN300 1 640667275
PLN301 1 639123876
PLN302 1 612949391
PLN303 1 577192767
PLN304 2 1141642242
PLN305 1 648922534
PLN306 1 604770208
PLN307 2 1173859433
PLN308 2 1159392798
PLN309 2 1164574848
PLN31 452 1172100458
PLN310 1 615767531
PLN311 1 605571303
PLN312 2 1142007082
PLN313 4 1166534982
PLN314 1 710194481
PLN315 1 661081403
PLN316 1 659460550
PLN317 1 630572514
PLN318 1 598618390
PLN319 1 658974642
PLN32 312283 580554794
PLN320 1 559656399
PLN321 1 717517502
PLN322 1 672450454
PLN323 1 665297378
PLN324 1 636785599
PLN325 1 599706080
PLN326 1 675658265
PLN327 1 523168208
PLN328 1 671211297
PLN329 1 630677708
PLN33 7044 719520391
PLN330 1 623428415
PLN331 2 1162824663
PLN332 2 1124081839
PLN333 1 640830439
PLN334 1 597781253
PLN335 2 1170541913
PLN336 2 1151597807
PLN337 1 537457279
PLN338 1 685947972
PLN339 1 649921694
PLN34 972 795955792
PLN340 1 641099225
PLN341 1 611845738
PLN342 1 581041262
PLN343 2 1176958498
PLN344 1 667717957
PLN345 1 631819663
PLN346 1 624692602
PLN347 2 1159089013
PLN348 2 1154165677
PLN349 1 670202054
PLN35 1053 1142470460
PLN350 1 631946783
PLN351 1 626743494
PLN352 2 1167772850
PLN353 2 1151941538
PLN354 1 671530377
PLN355 1 631910401
PLN356 1 622474059
PLN357 2 1160377439
PLN358 2 1159528938
PLN359 1 684336246
PLN36 253 1097918327
PLN360 1 636053469
PLN361 1 629969872
PLN362 2 1172688001
PLN363 2 1160045407
PLN364 1 665715246
PLN365 1 624683667
PLN366 1 621078253
PLN367 2 1159864294
PLN368 2 1170185454
PLN369 1 697540743
PLN37 455 1108366343
PLN370 1 655862368
PLN371 1 646765634
PLN372 1 618540729
PLN373 1 587963859
PLN374 455 1147653963
PLN375 31 909553549
PLN376 1 705338699
PLN377 1 493450010
PLN378 1 804285258
PLN379 1 810734643
PLN38 39 1147866491
PLN380 1 673981989
PLN381 1 754496630
PLN382 1 855759449
PLN383 1 614042580
PLN384 1 743847818
PLN385 1 673340788
PLN386 1 515668560
PLN387 1 713320806
PLN388 1 703598484
PLN389 1 570159854
PLN39 140 1171498404
PLN390 1 625793224
PLN391 1 721110502
PLN392 1 459355444
PLN393 1 745201001
PLN394 1 749284433
PLN395 1 643344672
PLN396 1 595297365
PLN397 1 688905267
PLN398 1 491807393
PLN399 1 769338634
PLN4 30449 958027815
PLN40 132 1068104944
PLN400 1 671568023
PLN401 1 635285330
PLN402 1 745618965
PLN403 1 839470345
PLN404 1 646400022
PLN405 1 747589525
PLN406 2 1171764895
PLN407 1 703962928
PLN408 1 702438406
PLN409 2 1178978634
PLN41 9 1037361599
PLN410 2 1173154747
PLN411 1 734536914
PLN412 1 738743901
PLN413 1 636778132
PLN414 1 602900890
PLN415 1 697493198
PLN416 1 490518203
PLN417 1 784661008
PLN418 1 810500911
PLN419 1 655314739
PLN42 70 1132281677
PLN420 1 752710991
PLN421 1 890847171
PLN422 1 621781073
PLN423 1 743084022
PLN424 1 676741658
PLN425 1 509452426
PLN426 1 710124532
PLN427 2 1058788934
PLN428 1 620140791
PLN429 1 716573881
PLN43 22 1134713042
PLN430 1 476726550
PLN431 1 756324664
PLN432 1 977471539
PLN433 2 1144819353
PLN434 1 646234737
PLN435 1 605172934
PLN436 2 1165717241
PLN437 2 1153140076
PLN438 1 590561804
PLN439 2 1176631761
PLN44 253 1146893256
PLN440 1 782694893
PLN441 1 796420183
PLN442 1 650274702
PLN443 1 739889549
PLN444 1 848590828
PLN445 1 610626473
PLN446 1 738023571
PLN447 2 1173882462
PLN448 1 701434008
PLN449 1 690770133
PLN45 82 1049620372
PLN450 1 567265955
PLN451 1 612987783
PLN452 1 704156067
PLN453 1 475327881
PLN454 1 732118298
PLN455 1 733931846
PLN456 1 636796232
PLN457 1 599764323
PLN458 1 691313424
PLN459 1 493357854
PLN46 280 1003915493
PLN460 1 782685093
PLN461 1 786410271
PLN462 1 648139033
PLN463 1 744407562
PLN464 1 835583350
PLN465 1 623221719
PLN466 1 741299132
PLN467 1 669032550
PLN468 1 517040482
PLN469 1 711661679
PLN47 17 1015072820
PLN470 1 708205786
PLN471 2 1156892395
PLN472 2 1178356817
PLN473 1 737453356
PLN474 1 736349413
PLN475 1 639162162
PLN476 1 586755746
PLN477 1 704478343
PLN478 1 492109999
PLN479 1 791475352
PLN48 31 953476271
PLN480 1 785940626
PLN481 1 661246824
PLN482 1 756990402
PLN483 1 858776195
PLN484 1 621195942
PLN485 1 754256086
PLN486 1 670301833
PLN487 1 509263899
PLN488 1 708234589
PLN489 1 725120110
PLN49 69 921693787
PLN490 1 575129590
PLN491 1 620883766
PLN492 1 727285804
PLN493 1 479660269
PLN494 1 745978486
PLN495 1 750160716
PLN496 1 642428577
PLN497 1 591313643
PLN498 1 705330581
PLN499 1 495656580
PLN5 4402 1036283513
PLN50 4 1109791911
PLN500 1 803232604
PLN501 1 790745243
PLN502 1 657494025
PLN503 1 759305888
PLN504 1 856542542
PLN505 1 628321883
PLN506 1 754364263
PLN507 1 697113365
PLN508 1 504254270
PLN509 1 715354979
PLN51 73 1067150263
PLN510 1 713929667
PLN511 1 572943128
PLN512 1 626959190
PLN513 1 715714221
PLN514 1 483823121
PLN515 1 742917797
PLN516 1 748536659
PLN517 1 643784981
PLN518 1 600654286
PLN519 2 1171400808
PLN52 8 1141528275
PLN520 1 794150360
PLN521 1 799857935
PLN522 1 655329108
PLN523 1 749763888
PLN524 1 838116175
PLN525 1 610468321
PLN526 1 736551279
PLN527 2 1171154657
PLN528 2 1170482349
PLN529 1 566465558
PLN53 184 1170332002
PLN530 1 614421429
PLN531 2 1179310235
PLN532 1 735408736
PLN533 1 969998116
PLN534 11 635028102
PLN535 1 595339094
PLN536 1 698605642
PLN537 1 499102108
PLN538 1 791748890
PLN539 1 797311483
PLN54 57 1143524148
PLN540 1 656817438
PLN541 1 753360318
PLN542 1 845838138
PLN543 1 619661694
PLN544 1 752772853
PLN545 1 689709469
PLN546 1 509595892
PLN547 1 712797596
PLN548 1 710493282
PLN549 1 570643040
PLN55 46 1080435469
PLN550 1 619886155
PLN551 1 705533140
PLN552 1 484551304
PLN553 1 740148362
PLN554 1 757233630
PLN555 1 642499559
PLN556 1 594006513
PLN557 1 693261537
PLN558 1 492948387
PLN559 1 781462734
PLN56 79 1110750483
PLN560 1 802944975
PLN561 1 650275864
PLN562 1 756841830
PLN563 1 850623622
PLN564 1 614136911
PLN565 1 723255126
PLN566 2 1177410070
PLN567 1 712168462
PLN568 1 712339524
PLN569 1 564869106
PLN57 98 1116925162
PLN570 1 619418949
PLN571 1 715454519
PLN572 1 478264344
PLN573 1 734693445
PLN574 1 749685439
PLN575 1 633598967
PLN576 1 782818162
PLN577 1 1022071454
PLN578 1 971920087
PLN579 1 827198496
PLN58 448 1055011679
PLN580 1 867619200
PLN581 1 806566123
PLN582 1 1015700474
PLN583 1 742303966
PLN584 1 956173857
PLN585 1 916702776
PLN586 1 874517040
PLN587 1 816294110
PLN588 1 750216944
PLN589 196 1003376355
PLN59 398 1027151193
PLN590 2 1182091663
PLN591 1 621516506
PLN592 1 610333535
PLN593 2 1150013201
PLN594 120 946417647
PLN595 5 1140594043
PLN596 773 1136041142
PLN597 18 958385885
PLN598 3 1008669690
PLN599 27314 1072986454
PLN6 84 1095629617
PLN60 279 1133340304
PLN600 2028 954547119
PLN601 1 594102056
PLN602 1 689851870
PLN603 1 495453186
PLN604 1 780798557
PLN605 1 801256715
PLN606 1 651852609
PLN607 1 750843639
PLN608 1 830829764
PLN609 1 615552423
PLN61 345 1165897957
PLN610 1 744588157
PLN611 1 673617499
PLN612 1 509857067
PLN613 1 709773743
PLN614 1 713149757
PLN615 1 566080677
PLN616 1 618079260
PLN617 1 720988478
PLN618 1 473592718
PLN619 1 736706236
PLN62 133 1123952384
PLN620 1 750620385
PLN621 2571 1146358435
PLN622 19714 976433542
PLN623 1 585266722
PLN624 1 681112512
PLN625 1 775448786
PLN626 1 790338525
PLN627 1 746673839
PLN628 1 836514780
PLN629 1 736872137
PLN63 367 1066684529
PLN630 1 676292951
PLN631 1 669155517
PLN632 1 701372996
PLN633 1 615672275
PLN634 1 698614761
PLN635 1 728031845
PLN636 134535 917923381
PLN637 273369 596339502
PLN638 305681 565498155
PLN639 244257 638925716
PLN64 394 1138083355
PLN640 208968 670840982
PLN641 167804 730356723
PLN642 173508 724953473
PLN643 155132 757172460
PLN644 176309 720745542
PLN645 164397 737613028
PLN646 120485 802846158
PLN647 181996 752903025
PLN648 157730 756503806
PLN649 132764 808543605
PLN65 174 1106553450
PLN650 9 973057508
PLN651 1 678170541
PLN652 1 639558213
PLN653 1 629672760
PLN654 2 1174163216
PLN655 2 1166970321
PLN656 1 684376481
PLN657 1 642597466
PLN658 1 631979072
PLN659 1 607115911
PLN66 120 1133796571
PLN660 1 582960187
PLN661 1 640026769
PLN662 1 608979116
PLN663 1 720972993
PLN664 1 501257520
PLN665 1 804602427
PLN666 1 808121247
PLN667 1 649118519
PLN668 1 758906661
PLN669 1 861141126
PLN67 144 1139681800
PLN670 1 642382296
PLN671 1 759893476
PLN672 1 689766370
PLN673 1 531462149
PLN674 1 714517032
PLN675 1 717288350
PLN676 1 586345039
PLN677 1 626266972
PLN678 1 738085275
PLN679 1 505809789
PLN68 124 1050309774
PLN680 1 759124079
PLN681 1 751612808
PLN682 12 1160338339
PLN683 685 1037884752
PLN684 2 1145861525
PLN685 2 1112884977
PLN686 2 941790226
PLN687 2 872653306
PLN688 2 944711370
PLN689 2 896921305
PLN69 9 1125786477
PLN690 2 1009490414
PLN691 2 973761421
PLN692 2 1028906041
PLN693 2 1128101800
PLN694 1 596326505
PLN695 1 634542603
PLN696 1 739379263
PLN697 1 641549888
PLN698 1 641159025
PLN699 2 1084467808
PLN7 175 1160007531
PLN70 10 1132483282
PLN700 2 1066659823
PLN701 2 1003274506
PLN702 2 851716800
PLN703 2 995026189
PLN704 2 869378871
PLN705 2 922541915
PLN706 2 917029648
PLN707 2 1113527553
PLN708 1 667652801
PLN709 2 1153333809
PLN71 10 1166678141
PLN710 2 976557482
PLN711 2 971318115
PLN712 2 905021021
PLN713 2 779060037
PLN714 2 1026993414
PLN715 2 1040398764
PLN716 2 906287378
PLN717 2 1107801300
PLN718 2 1085890887
PLN719 2 1048094875
PLN72 10 1167983468
PLN720 2 1011185181
PLN721 2 1092181461
PLN722 2 1026383973
PLN723 2 1018992133
PLN724 21 1150858229
PLN725 1 794474755
PLN726 1 760111594
PLN727 1 769810128
PLN728 1 715684684
PLN729 1 623890083
PLN73 6 1041755176
PLN730 1 755457679
PLN731 1 717109572
PLN732 1 817712742
PLN733 1 864624966
PLN734 1 701857263
PLN735 1 726425509
PLN736 1 738041677
PLN737 1 767912069
PLN738 2 1167186906
PLN739 2 1167934623
PLN74 6 1019781615
PLN740 2 1091547167
PLN741 3 1082389428
PLN742 4 1174948639
PLN743 3 1022191755
PLN744 320 1104176749
PLN745 142 1040534860
PLN746 403 1143989685
PLN747 25 965865578
PLN748 2 1083817966
PLN749 2 1135086767
PLN75 127 1089315331
PLN750 2 1031765593
PLN751 149 1154467731
PLN752 31 1157770692
PLN753 1045 845678948
PLN754 1 703076930
PLN755 1 495911329
PLN756 1 796169439
PLN757 1 779372321
PLN758 1 665561653
PLN759 1 757165295
PLN76 226 1167288149
PLN760 1 852704148
PLN761 1 623698249
PLN762 1 745048881
PLN763 1 677947850
PLN764 1 524289323
PLN765 1 726838826
PLN766 1 701430346
PLN767 1 584133940
PLN768 1 622677745
PLN769 1 745712656
PLN77 24 1016258271
PLN770 1 490622797
PLN771 1 748850018
PLN772 1 753856519
PLN773 700 674126380
PLN774 1 593930347
PLN775 1 702775664
PLN776 1 494594617
PLN777 1 792837209
PLN778 1 812232696
PLN779 1 661835603
PLN78 4 1037436174
PLN780 1 750337041
PLN781 1 854463248
PLN782 1 623248023
PLN783 1 749950614
PLN784 1 673746810
PLN785 1 520815567
PLN786 1 712547961
PLN787 1 703299309
PLN788 1 569771178
PLN789 1 620176429
PLN79 45 1166491229
PLN790 1 717542863
PLN791 1 493761083
PLN792 1 746502734
PLN793 1 752612656
PLN794 573 686952725
PLN795 2 990024350
PLN796 2 888868060
PLN797 2 933784370
PLN798 2 956308001
PLN799 1 589118817
PLN8 11 1122979570
PLN80 334 970680337
PLN800 1 638425132
PLN801 1 716105986
PLN802 1 613160974
PLN803 2 1177939381
PLN804 2 1016319037
PLN805 2 936303591
PLN806 2 797242864
PLN807 242 1168816031
PLN808 442 902950534
PLN809 1 593930347
PLN81 39 1128799885
PLN810 1 702775664
PLN811 1 494594617
PLN812 1 792837209
PLN813 1 812232696
PLN814 1 661835603
PLN815 1 750337041
PLN816 1 854463248
PLN817 1 623248023
PLN818 1 749950614
PLN819 1 673746810
PLN82 8 1109447019
PLN820 1 520815567
PLN821 1 712547961
PLN822 1 703299309
PLN823 1 569771178
PLN824 1 620176429
PLN825 1 717542863
PLN826 1 493761083
PLN827 1 746502734
PLN828 1 752612656
PLN829 233 1180834457
PLN83 5 1059002120
PLN830 6503 509584943
PLN831 1 657893865
PLN832 2 1156686622
PLN833 2 1150914040
PLN834 380 1155145851
PLN835 59 1166081052
PLN836 42 1159685336
PLN837 64 1170728010
PLN838 42 1168248595
PLN839 43 1182686463
PLN84 4 997915160
PLN840 34 1160973286
PLN841 40 1141073775
PLN842 22 1158196445
PLN843 39 1163413684
PLN844 1539 1070673887
PLN845 29 1141110474
PLN846 102 1109427475
PLN847 18 1136907998
PLN848 18 1120554374
PLN849 120 900994766
PLN85 4 976386315
PLN850 2 895169075
PLN851 2 1012559730
PLN852 2 915935029
PLN853 2 1012504980
PLN854 2 823545556
PLN855 2 1146950722
PLN856 2 954078143
PLN857 2 957803942
PLN858 2 1011653754
PLN859 2 969500392
PLN86 264 1176839642
PLN860 2 974599152
PLN861 2 820732428
PLN862 2 1117417627
PLN863 2 1084200567
PLN864 2 1011769306
PLN865 2 994627948
PLN866 2 1037544407
PLN867 1 645353941
PLN868 1 566030753
PLN869 1 701140916
PLN87 27 1085446047
PLN870 2 1155844490
PLN871 2 1088364007
PLN872 2 971070292
PLN873 2 1050853591
PLN874 2 948015595
PLN875 2 1031994025
PLN876 2 894692277
PLN877 2 956934777
PLN878 2 893104175
PLN879 1 591388374
PLN88 9 958724654
PLN880 1 642829877
PLN881 1 720427542
PLN882 1 619021063
PLN883 2 1169278607
PLN884 2 1025891263
PLN885 2 923969239
PLN886 2 807416841
PLN887 2 1033377508
PLN888 2 887724107
PLN889 2 999522382
PLN89 2 1174734371
PLN890 2 849465503
PLN891 2 1041854786
PLN892 1 636463470
PLN893 1 714328599
PLN894 1 612958257
PLN895 2 1178299787
PLN896 2 1007094188
PLN897 2 866165270
PLN898 2 777175039
PLN899 2 802708210
PLN9 4 948160392
PLN90 2 1111268940
PLN900 2 890769199
PLN901 2 982975491
PLN902 2 915035289
PLN903 1 707005220
PLN904 1 578675767
PLN905 1 630106688
PLN906 1 727725115
PLN907 1 613808757
PLN908 2 1179609774
PLN909 2 1009854848
PLN91 28 1135832320
PLN910 2 917808850
PLN911 2 790148711
PLN912 2 1032220636
PLN913 2 894501712
PLN914 2 985888097
PLN915 2 926569722
PLN916 2 1063086128
PLN917 1 637454632
PLN918 1 724254532
PLN919 1 613944685
PLN92 61 1175125979
PLN920 2 1170940412
PLN921 299 1156964349
PLN922 4 1080552710
PLN923 37 1137925102
PLN924 16 1169275918
PLN925 136 1137571571
PLN926 17 1105635108
PLN927 24 1171571936
PLN928 189 1083652115
PLN929 1 709345803
PLN93 35 1174553304
PLN930 1 499575344
PLN931 1 795989443
PLN932 1 809120074
PLN933 1 670531570
PLN934 1 759055895
PLN935 1 872909281
PLN936 1 637083831
PLN937 1 765902670
PLN938 1 688536368
PLN939 1 533804092
PLN94 55 1140220569
PLN940 1 714878730
PLN941 1 728610199
PLN942 1 586077705
PLN943 1 622419581
PLN944 1 733835468
PLN945 1 506756789
PLN946 1 759450946
PLN947 1 768174826
PLN948 3 659068422
PLN949 1 865431811
PLN95 69 1174500154
PLN950 1 841368522
PLN951 1 772393794
PLN952 1 766078222
PLN953 1 735900830
PLN954 1 693266847
PLN955 1 690056233
PLN956 1 654671025
PLN957 1 681539918
PLN958 1 650134427
PLN959 1 643737533
PLN96 84 1092061528
PLN960 2 1092839925
PLN961 2 1066926645
PLN962 2 971611548
PLN963 13 427663120
PLN964 1 1574527093
PLN965 1 1805244829
PLN966 1 1716769615
PLN967 1 1637815978
PLN968 1 1645877737
PLN969 1 1365994436
PLN97 17 1179161386
PLN970 1 1520236431
PLN971 21 825294730
PLN972 1 660114068
PLN973 1 623862790
PLN974 1 606413785
PLN975 2 1155915948
PLN976 2 1148187217
PLN977 1 662966845
PLN978 1 626943711
PLN979 1 613583204
PLN98 71 1127055465
PLN980 2 1152592070
PLN981 2 1147808788
PLN982 1 656479363
PLN983 1 621609376
PLN984 1 611088072
PLN985 2 1140013277
PLN986 2 1154214120
PLN987 1 661498744
PLN988 1 626053568
PLN989 1 608346219
PLN99 34 1182869104
PLN990 2 1151823422
PLN991 2 1162621306
PLN992 1 661546608
PLN993 1 633922074
PLN994 1 612932250
PLN995 2 1146351859
PLN996 2 1158675416
PLN997 1 664715623
PLN998 1 631770265
PLN999 1 613234972
PRI1 51161 1002824769
PRI10 13 1100500214
PRI11 7 1032781085
PRI12 5 1067810412
PRI13 9 1180671468
PRI14 8 1107000153
PRI15 11 1174619811
PRI16 6 1064076226
PRI17 11 1177365167
PRI18 11 1103395128
PRI19 8 1081303381
PRI2 7910 1072145329
PRI20 6 1136611601
PRI21 225206 749806845
PRI22 177394 651439302
PRI23 113276 848073209
PRI24 160100 708047587
PRI25 79541 975115781
PRI26 739 1177886289
PRI27 35397 1095075758
PRI28 58476 113761111
PRI3 7901 1132972500
PRI4 10360 1160614863
PRI5 152425 840442381
PRI6 19989 1008567045
PRI7 6 1137401032
PRI8 10 1163372937
PRI9 114467 822454647
ROD1 42165 1008846213
ROD10 163 1166541022
ROD100 8 1139757719
ROD101 9 1174668373
ROD102 7 1067359328
ROD103 10 1182029473
ROD104 4 959918585
ROD105 6 1044932681
ROD106 68 1124872912
ROD107 10 1133876088
ROD108 19 1182564383
ROD109 10 1092721418
ROD11 7 1078339014
ROD110 16 1182453566
ROD111 12 1081345329
ROD112 9 1086039483
ROD113 7 934030466
ROD114 3 957465392
ROD115 44437 1090572579
ROD12 90 1160576642
ROD13 9 1118724328
ROD14 15 1161179778
ROD15 16 1135825973
ROD16 72444 1036110088
ROD17 27359 1037469017
ROD18 12 1120355466
ROD19 8 1163882538
ROD2 5909 1093927363
ROD20 12 1101462594
ROD21 7 1065740602
ROD22 110 1130872454
ROD23 10 1095487923
ROD24 8 1173337133
ROD25 8 1063713588
ROD26 9 1146396098
ROD27 10 1068290457
ROD28 8 1081733625
ROD29 11 1082140969
ROD3 6339 1107756976
ROD30 10 1147232155
ROD31 10 1171959357
ROD32 7 1110074623
ROD33 10 1164218519
ROD34 9 1108644203
ROD35 8 1072581452
ROD36 10 1046751576
ROD37 8 1141423843
ROD38 11 1027724205
ROD39 10 1152345994
ROD4 110072 874896894
ROD40 8 1082920857
ROD41 8 1089063230
ROD42 9 1143097394
ROD43 10 1072150743
ROD44 8 1099764473
ROD45 11 1087836125
ROD46 8 1171715672
ROD47 12 1136130400
ROD48 7 1113098900
ROD49 10 1162104909
ROD5 369178 428483379
ROD50 9 1083630069
ROD51 9 1170482326
ROD52 11 1099809287
ROD53 10 1145640092
ROD54 9 1132503232
ROD55 10 1140056814
ROD56 19 1075143845
ROD57 10 1147351773
ROD58 19 1151436343
ROD59 10 1088581837
ROD6 6 1107651413
ROD60 16 1164391722
ROD61 12 1073032075
ROD62 9 1157194591
ROD63 14 1023016171
ROD64 7 1166266691
ROD65 9 1087901740
ROD66 9 1097713367
ROD67 9 1154691504
ROD68 9 1025612394
ROD69 7 1082392531
ROD7 9 1154552993
ROD70 10 1140331137
ROD71 9 1166871002
ROD72 14 1168528777
ROD73 8 1126440038
ROD74 12 1149086196
ROD75 10 1051885153
ROD76 12 1161926762
ROD77 11 1086828534
ROD78 10 1148564844
ROD79 12 1022809212
ROD8 10 1090080857
ROD80 8 1104739191
ROD81 14 1038854127
ROD82 7 1113949024
ROD83 14 1147316566
ROD84 9 1098255843
ROD85 13 1183189045
ROD86 11 1140514852
ROD87 14 1175080086
ROD88 13 1051083644
ROD89 9 1156825032
ROD9 7 1101532017
ROD90 52 1118266047
ROD91 12 1173398982
ROD92 18 1154143271
ROD93 11 1123323681
ROD94 18 1080123782
ROD95 11 1146173548
ROD96 148 1098231299
ROD97 7 1166537123
ROD98 12 1154027383
ROD99 11 1029292292
STS1 422715 213740430
STS2 348961 243834771
STS3 575312 183347936
SYN1 54450 995654191
SYN10 16814 72954260
SYN2 10 1040305979
SYN3 6 1076407027
SYN4 9 1128400530
SYN5 10 1040305979
SYN6 6 1076407027
SYN7 306 907550246
SYN8 78215 861759977
SYN9 170856 756031720
TSA1 675528 274465015
TSA10 490557 443696066
TSA11 464038 476054838
TSA12 540522 380920868
TSA13 536315 386041015
TSA14 551182 397121579
TSA15 499957 392795414
TSA16 461015 345763231
TSA17 529148 429197722
TSA18 456565 493600807
TSA19 549328 446579772
TSA2 551981 321350516
TSA20 478813 355350839
TSA21 423273 349460990
TSA22 491900 420531881
TSA23 488985 427051188
TSA24 503291 446243037
TSA25 550253 413998181
TSA26 322810 596637796
TSA27 321543 520576849
TSA28 213137 240221849
TSA29 247819 86381490
TSA3 516598 398806258
TSA30 253077 64302897
TSA31 493260 400589877
TSA32 393085 542289153
TSA33 368283 575253856
TSA34 422089 475730205
TSA35 419491 477677685
TSA36 452632 413378965
TSA37 58043 36081157
TSA4 505639 416283092
TSA5 500719 360221562
TSA6 584777 316627491
TSA7 573576 366084519
TSA8 592884 269894473
TSA9 536695 422308188
UNA1 775 4564014
VRL1 351063 454367605
VRL10 181737 680789172
VRL100 35605 648621481
VRL101 23530 659359534
VRL102 25859 662358243
VRL103 24652 666296505
VRL104 22694 658868377
VRL105 22879 664068157
VRL106 22548 662415289
VRL107 22608 664106657
VRL108 22881 662454104
VRL109 25128 658624076
VRL11 225528 542309635
VRL110 22677 664352427
VRL111 22791 661882818
VRL112 25370 662512190
VRL113 23469 663944776
VRL114 23929 663969108
VRL115 24690 662909683
VRL116 25348 662786300
VRL117 24549 669588544
VRL118 24554 665925328
VRL119 24211 667039273
VRL12 242143 531316864
VRL120 24351 666602461
VRL121 23928 667154780
VRL122 23545 665780716
VRL123 23285 669411631
VRL124 24201 665518938
VRL125 23558 664487461
VRL126 27296 660837949
VRL127 24833 664691361
VRL128 23299 665212166
VRL129 22609 661227926
VRL13 174775 563787252
VRL130 27194 660481997
VRL131 24274 665441251
VRL132 23523 666026936
VRL133 23482 666602114
VRL134 26929 665569522
VRL135 23208 662980535
VRL136 24715 665127440
VRL137 25904 661920682
VRL138 25797 667327553
VRL139 26257 670355799
VRL14 69663 654187790
VRL140 25879 661470930
VRL141 23871 667719895
VRL142 26326 660785805
VRL143 25682 664590679
VRL144 30287 655458081
VRL145 23741 664357979
VRL146 25105 662597633
VRL147 25501 664721686
VRL148 23117 665866070
VRL149 29048 665997146
VRL15 74184 633388177
VRL150 24800 662431040
VRL151 23971 665924816
VRL152 23230 672848747
VRL153 24341 666480605
VRL154 24681 668977779
VRL155 23849 671450601
VRL156 23105 673405590
VRL157 30606 658454922
VRL158 30413 661640709
VRL159 26131 667446245
VRL16 46439 655529064
VRL160 31785 659341793
VRL161 25498 669474370
VRL162 27934 663284739
VRL163 29553 661929614
VRL164 25880 659677666
VRL165 24951 666034530
VRL166 28170 663750043
VRL167 33066 654564111
VRL168 32078 656702061
VRL169 28088 663918114
VRL17 28263 664156480
VRL170 24061 672070789
VRL171 25754 680054405
VRL172 24803 674746668
VRL173 27012 663120833
VRL174 36720 654486028
VRL175 32555 671458600
VRL176 39941 659883073
VRL177 26564 667037773
VRL178 43202 660258738
VRL179 40427 657920670
VRL18 28594 664374561
VRL180 32958 669916009
VRL181 31348 670523026
VRL182 24656 666408823
VRL183 31971 665686639
VRL184 36020 664545299
VRL185 31359 662744473
VRL186 45469 655169204
VRL187 36442 666769216
VRL188 28100 667271451
VRL189 35838 936556580
VRL19 32558 658842941
VRL190 37246 1112793037
VRL191 37962 1132394579
VRL192 38075 1134904014
VRL193 37770 1126814471
VRL194 37598 1121802164
VRL195 37303 1114261870
VRL196 37222 1112071993
VRL197 37265 1113177354
VRL198 37152 1112774126
VRL199 36889 1101672825
VRL2 131238 578205724
VRL20 27304 659811054
VRL200 36951 1104300618
VRL201 37106 1107449086
VRL202 37119 1108244934
VRL203 37109 1108527275
VRL204 37139 1109371397
VRL205 37176 1110792821
VRL206 37062 1107442589
VRL207 37116 1109251736
VRL208 37063 1107604297
VRL209 37005 1105985409
VRL21 35742 653383054
VRL210 36300 1084919871
VRL211 37010 1105705777
VRL212 36996 1105376695
VRL213 37499 1119167214
VRL214 37238 1112217938
VRL215 37089 1107855459
VRL216 37130 1108551835
VRL217 37000 1106105886
VRL218 37324 1114639345
VRL219 37127 1109555426
VRL22 24074 660575529
VRL220 37449 1117086035
VRL221 37465 1118339077
VRL222 37124 1109150249
VRL223 37023 1105688000
VRL224 37440 1117191021
VRL225 37278 1112889130
VRL226 37129 1108834647
VRL227 37089 1107827786
VRL228 37282 1112916913
VRL229 36982 1104790362
VRL23 24159 662763323
VRL230 36901 1102366179
VRL231 37034 1105780822
VRL232 37298 1112670090
VRL233 37074 1107137742
VRL234 36999 1105211114
VRL235 37038 1106350638
VRL236 37129 1109145061
VRL237 37569 1117686417
VRL238 37232 1112232588
VRL239 37284 1113794954
VRL24 29447 658539304
VRL240 37058 1106787268
VRL241 37106 1108155173
VRL242 37163 1109692045
VRL243 36965 1103873806
VRL244 36731 1096891340
VRL245 37120 1108212483
VRL246 37120 1108131005
VRL247 37139 1108651877
VRL248 37212 1110953686
VRL249 37576 1119715257
VRL25 24831 661912004
VRL250 37473 1119275541
VRL251 37459 1118826560
VRL252 37141 1109008291
VRL253 36895 1101649186
VRL254 36389 1086128308
VRL255 36797 1097965430
VRL256 37882 1128822505
VRL257 37736 1124793765
VRL258 37993 1130138319
VRL259 37781 1124999515
VRL26 23831 665322215
VRL260 37885 1127671671
VRL261 37883 1129151189
VRL262 37469 1116648247
VRL263 38039 1131967137
VRL264 37543 1120532796
VRL265 37632 1125978058
VRL266 36678 1095202537
VRL267 37515 1115514671
VRL268 37571 1122089491
VRL269 37640 1124352461
VRL27 23217 664843130
VRL270 37620 1123625493
VRL271 37178 1110313851
VRL272 37351 1117094983
VRL273 37050 1110081765
VRL274 37453 1101618617
VRL275 38046 1095553037
VRL276 36376 1081681835
VRL277 35971 1074713342
VRL278 36399 1087745837
VRL279 36307 1085163124
VRL28 25113 663836580
VRL280 36418 1087398797
VRL281 36222 1082187268
VRL282 36540 1091201302
VRL283 36509 1090009743
VRL284 36532 1090658334
VRL285 36520 1090359131
VRL286 36511 1090095321
VRL287 36536 1090836126
VRL288 36778 1096796783
VRL289 37129 1106031947
VRL29 26006 663348290
VRL290 36797 1097760266
VRL291 37705 1120868699
VRL292 38172 1133308332
VRL293 38187 1133779010
VRL294 38123 1132379168
VRL295 38143 1132573640
VRL296 38157 1133202101
VRL297 38205 1134220438
VRL298 38373 1095741692
VRL299 36465 1089033197
VRL3 314079 426120610
VRL30 29130 666663958
VRL300 36616 1094139924
VRL301 36677 1095626005
VRL302 36618 1093931996
VRL303 36623 1094068939
VRL304 36613 1093764471
VRL305 36627 1094198327
VRL306 36212 1082110788
VRL307 36084 1075941002
VRL308 36149 1076874499
VRL309 36030 1068814358
VRL31 29800 664913506
VRL310 37068 1096380276
VRL311 37589 1122198822
VRL312 37529 1120908268
VRL313 36280 1084118221
VRL314 35857 1071355784
VRL315 36139 1079904055
VRL316 39193 1090844448
VRL317 39320 1097376006
VRL318 39261 1098605632
VRL319 35216 1107830822
VRL32 27655 665110032
VRL320 31044 803815425
VRL321 29676 672833135
VRL322 29314 668347760
VRL323 30617 667606412
VRL324 45281 655712358
VRL325 52350 654650154
VRL326 36703 661225547
VRL327 70913 628841474
VRL328 60500 648384597
VRL329 36398 664519872
VRL33 25657 665122938
VRL330 37093 663173813
VRL331 46786 660450820
VRL332 30558 667242398
VRL333 44779 658846532
VRL334 70185 637647637
VRL335 32567 661908205
VRL336 23066 666481637
VRL337 95936 622038724
VRL338 122163 581287046
VRL339 92718 630813189
VRL34 23438 665930915
VRL340 55880 277336903
VRL35 26424 663745853
VRL36 22944 659468922
VRL37 23526 663533145
VRL38 23228 663134187
VRL39 24437 659667353
VRL4 277893 594238118
VRL40 31840 947678046
VRL41 37131 1110244210
VRL42 37145 1110264269
VRL43 37167 1110674696
VRL44 30273 902671699
VRL45 23869 665363421
VRL46 24115 664997535
VRL47 23017 658931156
VRL48 22781 658727572
VRL49 23052 663864644
VRL5 322041 471499595
VRL50 22809 660267075
VRL51 23165 663978385
VRL52 22803 663667650
VRL53 22597 660549173
VRL54 23336 665048635
VRL55 23318 667775389
VRL56 22828 661268561
VRL57 22811 665963284
VRL58 22875 664914440
VRL59 22381 661351337
VRL6 284226 464883287
VRL60 24699 666332271
VRL61 23360 660673368
VRL62 24688 669167930
VRL63 24331 666066550
VRL64 22241 660794345
VRL65 24329 668889584
VRL66 23143 664832217
VRL67 23586 663935703
VRL68 25517 663075010
VRL69 22412 661600165
VRL7 250434 510800353
VRL70 23072 665296681
VRL71 23358 665375388
VRL72 22344 662311142
VRL73 23287 667643661
VRL74 23797 665069437
VRL75 23240 664901957
VRL76 23224 665190638
VRL77 22682 661802977
VRL78 26132 664474416
VRL79 22337 664503800
VRL8 261684 492952365
VRL80 23266 665806265
VRL81 23204 665326002
VRL82 22833 666320996
VRL83 22978 664732806
VRL84 23308 664972110
VRL85 22426 662951933
VRL86 22389 666032417
VRL87 22788 668012778
VRL88 22620 661768128
VRL89 22704 673643342
VRL9 250918 523152366
VRL90 23182 665084760
VRL91 22417 664841282
VRL92 23216 665706941
VRL93 22776 668989920
VRL94 22855 661241109
VRL95 28279 671953384
VRL96 23569 665684186
VRL97 22919 663768388
VRL98 24746 664176765
VRL99 23655 661843814
VRT1 152000 879117734
VRT10 20 1009905601
VRT100 61 1180749347
VRT101 40 1180462495
VRT102 29 1171515081
VRT103 38 1169813989
VRT104 114 674068324
VRT105 2 806190538
VRT106 2 696540660
VRT107 4 904864528
VRT108 44 1019397561
VRT109 36 1178642032
VRT11 41 1100928095
VRT110 61 1042460441
VRT111 153 1133976286
VRT112 20 1151700990
VRT113 66 1177342711
VRT114 63 1011340213
VRT115 5 1114313003
VRT116 40 1121950258
VRT117 26 1165870027
VRT118 34 993803116
VRT119 10 863470745
VRT12 5 1148517812
VRT120 99 1055299498
VRT121 45 1173161375
VRT122 34 1154532236
VRT123 37 1165711270
VRT124 20 1174931749
VRT125 18 1153973849
VRT126 22 1182636590
VRT127 312 1171570949
VRT128 40 1165814453
VRT129 41 1170464824
VRT13 33 1176562922
VRT130 19 1155157253
VRT131 42 1177238185
VRT132 40 1181828030
VRT133 52 1166638748
VRT134 30 1154120422
VRT135 33 1094068098
VRT136 25 1160740832
VRT137 382 1158615012
VRT138 351 1031551398
VRT139 48 1177450183
VRT14 44 1150684922
VRT140 37 1168924425
VRT141 19 1164075103
VRT142 26 1182902339
VRT143 39 1133969144
VRT144 36 1168754407
VRT145 31 1163137436
VRT146 36 1170882423
VRT147 36 1152871582
VRT148 21 1177136033
VRT149 17 1131769706
VRT15 43 1165382492
VRT150 40 1099550703
VRT151 14 1151376722
VRT152 40 1181857143
VRT153 43 1118286302
VRT154 21 1172396618
VRT155 21 1159704045
VRT156 37 1180805679
VRT157 36 1074349268
VRT158 305 1147865056
VRT159 37 1155455580
VRT16 39 1179474257
VRT160 53 1170748576
VRT161 39 1042530955
VRT162 5 1145352964
VRT163 8 1166817677
VRT164 22 1099238862
VRT165 24 1181050320
VRT166 28 1128461858
VRT167 23 1179977145
VRT168 17 1140261904
VRT169 47 1162361489
VRT17 20 1176001776
VRT170 33 1082875689
VRT171 40 1151038532
VRT172 35 1168555234
VRT173 21 1052433236
VRT174 5 1056736991
VRT175 8 1141521528
VRT176 13 1130579885
VRT177 20 1160195610
VRT178 50 1171449262
VRT179 36 1181564440
VRT18 37 1176418066
VRT180 159 1113225433
VRT181 22 1003732213
VRT182 42 1170859841
VRT183 324 1076802826
VRT184 41 1138566252
VRT185 14 1179788972
VRT186 13 1137303478
VRT187 17 1162516663
VRT188 15 1104770266
VRT189 16 1019314169
VRT19 26 1135841754
VRT190 23 1178565343
VRT191 37 1182347574
VRT192 50 1134087574
VRT193 24 926554202
VRT194 4 1160654489
VRT195 6 1055180276
VRT196 11 1145381641
VRT197 18 1181285424
VRT198 15 1146666012
VRT199 27 1182848304
VRT2 30 1174650673
VRT20 75814 1036907939
VRT200 21 1151141727
VRT201 16 1122899890
VRT202 42 1156993143
VRT203 18 1168032833
VRT204 24 1179938402
VRT205 27 1158754540
VRT206 31 1171954388
VRT207 14 1058831880
VRT208 7 1098198485
VRT209 10 1112454070
VRT21 379546 420196998
VRT210 21 982002519
VRT211 10 1173938281
VRT212 104 1176086894
VRT213 41 1179233542
VRT214 101 1118100577
VRT215 88 1113750674
VRT216 81 1105801281
VRT217 39 1183798951
VRT218 67 1112995135
VRT219 35 905645556
VRT22 71244 1063768977
VRT220 1 1377224146
VRT221 1 1246042375
VRT222 1 1134302525
VRT223 1 1092803421
VRT224 1 995116563
VRT225 1 979649957
VRT226 3 1100551194
VRT227 3 511216884
VRT228 1 1415942608
VRT229 1 1279781030
VRT23 520214 355661851
VRT230 1 1144564707
VRT231 1 1114117749
VRT232 1 1027171557
VRT233 1 998592877
VRT234 3 1103810273
VRT235 4 510174135
VRT236 1 1950672471
VRT237 1 1882935974
VRT238 1 1702342136
VRT239 1 1361375652
VRT24 469201 352563205
VRT240 1 1317398316
VRT241 1 1293891082
VRT242 1 1269970046
VRT243 1 1248769876
VRT244 1 1238911699
VRT245 1 1201415365
VRT246 1 1199165587
VRT247 1 1184551933
VRT248 1 1183987023
VRT249 1 1134708421
VRT25 533044 346586603
VRT250 1 1024245046
VRT251 1 993383533
VRT252 3 1080922639
VRT253 39 1080538033
VRT254 42 1162049517
VRT255 43 1144321272
VRT256 19 1033892758
VRT257 8 1159899222
VRT258 12 1157225835
VRT259 19 1098867675
VRT26 173798 879363067
VRT260 15 1097791464
VRT261 18 1112130599
VRT262 34 1182680941
VRT263 17 1164381965
VRT264 34 1077194331
VRT265 34 1012246650
VRT266 33 1009704254
VRT267 8 201061856
VRT268 1 2146314909
VRT269 1 459926735
VRT27 329625 856181154
VRT270 1 2140055507
VRT271 1 526359502
VRT272 1 2132484007
VRT273 1 510744347
VRT274 1 2141402031
VRT275 1 154081089
VRT276 1 2143815925
VRT277 1 17068361
VRT278 1 2139332349
VRT279 1 1965638399
VRT28 598 1179863497
VRT280 1 1730884321
VRT281 1 1292683186
VRT282 1 1220333517
VRT283 1 1209226565
VRT284 7 1134997840
VRT285 26 1123273225
VRT286 25 1160795076
VRT287 6 147321427
VRT288 1 2144885605
VRT289 1 368539449
VRT29 13193 1144393824
VRT290 1 2136077662
VRT291 1 338547956
VRT292 1 2137795666
VRT293 1 330263317
VRT294 1 2145962954
VRT295 1 25971532
VRT296 1 2035433746
VRT297 1 1925992481
VRT298 1 1778043439
VRT299 1 1581089616
VRT3 123 1174179528
VRT30 39 1154682552
VRT300 1 1245844088
VRT301 1 1157923350
VRT302 1 1112128736
VRT303 5 1122801679
VRT304 11 1154196115
VRT305 44 1172047204
VRT306 24 1172348617
VRT307 18 1176756695
VRT308 32 1112452156
VRT309 33 1117361619
VRT31 48 1160014369
VRT310 7 1120783487
VRT311 41 1174844090
VRT312 42 1137008278
VRT313 51 1132171300
VRT314 46 1155289000
VRT315 9 1153913320
VRT316 42 1117841999
VRT317 33 1162682117
VRT318 33 1173485746
VRT319 19 1150367348
VRT32 265 1115191345
VRT320 25 1160050164
VRT321 22 1007118500
VRT322 10 1163577529
VRT323 32 1111204722
VRT324 15 1160809883
VRT325 27 1176666881
VRT326 26 1174144085
VRT327 12 1126721375
VRT328 14 1136589921
VRT329 15 846410575
VRT33 3 1023379555
VRT330 5 1101265415
VRT331 23 1021791390
VRT332 1 896647653
VRT333 1 751834319
VRT334 1 688568912
VRT335 1 677924506
VRT336 2 898565348
VRT337 4 1121318331
VRT338 6 1111589716
VRT339 41 1164732652
VRT34 4 1006655652
VRT340 7 1146761244
VRT341 21 1066338465
VRT342 7 1134566935
VRT343 21 1068252028
VRT344 7 1133695910
VRT345 21 1068641290
VRT346 7 1139083692
VRT347 22 1064139134
VRT348 7 1135127699
VRT349 21 1072078992
VRT35 7 1156267552
VRT350 7 1132643145
VRT351 22 1065553763
VRT352 41 1139882337
VRT353 41 1134645266
VRT354 7 1111229456
VRT355 21 1031013239
VRT356 7 1135497343
VRT357 22 1070839852
VRT358 7 1132117858
VRT359 21 1072202009
VRT36 26 1162615118
VRT360 7 1115661213
VRT361 25 1130603089
VRT362 34 1108251824
VRT363 33 1078433855
VRT364 32 1102576659
VRT365 33 1122931389
VRT366 36 1119127885
VRT367 26 1114623931
VRT368 14 1111480876
VRT369 35 1165025012
VRT37 43 1179641806
VRT370 54 1135586523
VRT371 41 1180899626
VRT372 42 991360019
VRT373 43 1168305613
VRT374 23 1153777016
VRT375 41 1175702880
VRT376 22 1158457681
VRT377 39 964103972
VRT378 16 1100230459
VRT379 13 1127415560
VRT38 30 561601148
VRT380 14 1098097097
VRT381 15 1058366566
VRT382 33 1019178663
VRT383 31 1121816640
VRT384 86 1112105249
VRT385 76 1040929698
VRT386 38 1170276073
VRT387 34 1162925051
VRT388 31 1172767250
VRT389 31 1156886919
VRT39 1 839681426
VRT390 38 1182720999
VRT391 53 1146393333
VRT392 24 1183729642
VRT393 50 1109423527
VRT394 514 1154100595
VRT395 45 1095525668
VRT396 40 1152560715
VRT397 39 1155092592
VRT398 39 1157832228
VRT399 52 1164142881
VRT4 106338 999203865
VRT40 1 825560060
VRT400 33 1171732718
VRT401 34 1175261758
VRT402 42 1176134268
VRT403 50 1177512077
VRT404 40 1161253321
VRT405 24 1077456323
VRT406 38 1157253319
VRT407 40 1131884615
VRT408 41 1150776728
VRT409 24 955812464
VRT41 2 1082779519
VRT410 6 1172175453
VRT411 36 1106805370
VRT412 24 1096230448
VRT413 27 1179187804
VRT414 41 1132655455
VRT415 37 1141444096
VRT416 42 1111985416
VRT417 42 1077784638
VRT418 42 1053903426
VRT419 41 1132655455
VRT42 3 1072075408
VRT420 65 1170505791
VRT421 36 1178590685
VRT422 33 1150096393
VRT423 25 1156665040
VRT424 10 1069508049
VRT425 16 1087774406
VRT426 30 983146377
VRT427 32 1083624474
VRT428 35 1090077145
VRT429 31 1026298488
VRT43 8 1112968075
VRT430 33 1102225181
VRT431 33 1116582366
VRT432 11 1133394429
VRT433 15 1155148012
VRT434 32 1142502069
VRT435 34 1150092631
VRT436 55 1171426936
VRT437 23 1117331251
VRT438 19 1178565618
VRT439 60 1170038027
VRT44 21 1180520471
VRT440 41 1157684825
VRT441 40 1165950019
VRT442 19 1171278651
VRT443 34 1165794644
VRT444 36 1146596068
VRT445 37 1141406513
VRT446 39 1121482755
VRT447 40 1042652510
VRT448 35 1021689521
VRT449 34 1162611498
VRT45 22 1158850226
VRT450 17 1182160221
VRT451 40 1179922904
VRT452 47 1179495297
VRT453 34 1152346517
VRT454 36 1097547927
VRT455 43 1079133454
VRT456 35 1071884895
VRT457 48184 1039981882
VRT458 88351 101818111
VRT46 353 1181688611
VRT47 28 1098865212
VRT48 1 662004353
VRT49 2 911653698
VRT5 72670 919270295
VRT50 3 1021932445
VRT51 490 1179856557
VRT52 30 1161799788
VRT53 24 1180126066
VRT54 24 1139184549
VRT55 40 1180636041
VRT56 72 1164816936
VRT57 7 1156606571
VRT58 3 1012738546
VRT59 6 1130561284
VRT6 38 1174624699
VRT60 468 1183012903
VRT61 10 1163204068
VRT62 618 1178963146
VRT63 13 971142702
VRT64 5 1115794738
VRT65 6 1049980901
VRT66 34 1152243713
VRT67 20 1141871979
VRT68 38 1132348904
VRT69 226 1180434283
VRT7 42 1157042340
VRT70 21 1114739427
VRT71 21 1172326162
VRT72 53 1183886833
VRT73 20 1122316722
VRT74 17 1136974292
VRT75 22 1140340918
VRT76 23 1161212858
VRT77 23 1154719176
VRT78 118 1148815869
VRT79 90 1178165508
VRT8 52 1150524292
VRT80 17 483388926
VRT81 1 843366180
VRT82 1 842558404
VRT83 1 707956555
VRT84 1 635713434
VRT85 2 1006930617
VRT86 6 953838719
VRT87 1 690654357
VRT88 2 1036857559
VRT89 3 1135937014
VRT9 35 1139739741
VRT90 37 1176417013
VRT91 4327 1133387875
VRT92 241640 732015841
VRT93 405275 402190894
VRT94 259197 601231205
VRT95 72 1183885388
VRT96 46 1159399889
VRT97 25 1169635560
VRT98 48 1172429944
VRT99 397 1151363890
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 268.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:
Entries Bases Species
1948166 390249590670 Triticum aestivum
9142853 271895923473 Severe acute respiratory syndrome coronavirus 2
113594 259318244771 Hordeum vulgare
753 212675690135 Hordeum bulbosum
1346950 125991526699 Hordeum vulgare subsp. vulgare
164 93011095388 Viscum album
29879 92980160549 Hordeum vulgare subsp. spontaneum
30114 56900846271 Avena sativa
10111023 46327845332 Mus musculus
28375519 37678773572 Homo sapiens
191025 36092990431 Escherichia coli
2641783 30536976412 Arabidopsis thaliana
4221579 24910210093 Zea mays
41782 24544807262 Klebsiella pneumoniae
507 22852582653 Lissotriton helveticus
1627 22052873125 Triturus cristatus
1343 21278745710 Lissotriton vulgaris
1571 20633318857 Chenopodium quinoa
553860 20142164839 Capra hircus
30887 17832545580 Humulus lupulus
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting. Also note that this table is limited
to 'traditional', non-set-based (WGS/TSA/TLS) GenBank records.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
189 Apr 2012 139266481398 151824421
190 Jun 2012 141343240755 154130210
191 Aug 2012 143081765233 156424033
192 Oct 2012 145430961262 157889737
193 Dec 2012 148390863904 161140325
194 Feb 2013 150141354858 162886727
195 Apr 2013 151178979155 164136731
196 Jun 2013 152599230112 165740164
197 Aug 2013 154192921011 167295840
198 Oct 2013 155176494699 168335396
199 Dec 2013 156230531562 169331407
200 Feb 2014 157943793171 171123749
201 Apr 2014 159813411760 171744486
202 Jun 2014 161822845643 173353076
203 Aug 2014 165722980375 174108750
204 Oct 2014 181563676918 178322253
205 Dec 2014 184938063614 179295769
206 Feb 2015 187893826750 181336445
207 Apr 2015 189739230107 182188746
208 Jun 2015 193921042946 185019352
209 Aug 2015 199823644287 187066846
210 Oct 2015 202237081559 188372017
211 Dec 2015 203939111071 189232925
212 Feb 2016 207018196067 190250235
213 Apr 2016 211423912047 193739511
214 Jun 2016 213200907819 194463572
215 Aug 2016 217971437647 196120831
216 Oct 2016 220731315250 197390691
217 Dec 2016 224973060433 198565475
218 Feb 2017 228719437638 199341377
219 Apr 2017 231824951552 200877884
220 Jun 2017 234997362623 201663568
221 Aug 2017 240343378258 203180606
222 Oct 2017 244914705468 203953682
223 Dec 2017 249722163594 206293625
224 Feb 2018 253630708098 207040555
225 Apr 2018 260189141631 208452303
226 Jun 2018 263957884539 209775348
227 Aug 2018 260806936411 208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
228 Oct 2018 279668290132 209656636
229 Dec 2018 285688542186 211281415
230 Feb 2019 303709510632 212260377
231 Apr 2019 321680566570 212775414
232 Jun 2019 329835282370 213383758
233 Aug 2019 366733917629 213865349
234 Oct 2019 386197018538 216763706
235 Dec 2019 388417258009 215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
236 Feb 2020 399376854872 216214215
237 Apr 2020 415770027949 216531829
238 Jun 2020 427823258901 217122233
239 Aug 2020 654057069549 218642238
240 Oct 2020 698688094046 219055207
241 Dec 2020 723003822007 221467827
242 Feb 2021 776291211106 226241476
243 Apr 2021 832400799511 227123201
244 Jun 2021 866009790959 227888889
245 Aug 2021 940513260726 231982592
246 Oct 2021 1014763752113 233642893
247 Dec 2021 1053275115030 234557297
248 Feb 2022 1173984081721 236338284
249 Apr 2022 1266154890918 237520318
250 Jun 2022 1395628631187 239017893
251 Aug 2022 1492800704497 239915786
252 Oct 2022 1562963366851 240539282
253 Dec 2022 1635594138493 241015745
254 Feb 2023 1731302248418 241830635
255 Apr 2023 1826746318813 242554936
256 Jun 2023 1966479976146 243560863
257 Aug 2023 2112058517945 246119175
258 Oct 2023 2433391164875 247777761
259 Dec 2023 2570711588044 249060436
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 3213818003787 250803006
261 Jun 2024 3387240663231 251094334
262 Aug 2024 3675462701077 251998350
263 Oct 2024 4250942573681 252347664
264 Dec 2024 5085904976338 254365075
265 Feb 2025 5415448651743 255669865
266 Apr 2025 5794509308815 257038531
267 Jun 2025 5234752089196 258002002 (Section 1.3.1 of GB 267.0 release notes explains decrease)
268 Aug 2025 5676067778413 258320620
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
https://ftp.ncbi.nih.gov/ncbi-asn1/wgs
https://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
189 Apr 2012 272693351548 80905298
190 Jun 2012 287577367116 82076779
191 Aug 2012 308196411905 84020064
192 Oct 2012 333881846451 86480509
193 Dec 2012 356002922838 92767765
194 Feb 2013 390900990416 103101291
195 Apr 2013 418026593606 110509314
196 Jun 2013 453829752320 112488036
197 Aug 2013 500420412665 124812020
198 Oct 2013 535842167741 130203205
199 Dec 2013 556764321498 133818570
200 Feb 2014 591378698544 139725795
201 Apr 2014 621015432437 143446790
202 Jun 2014 719581958743 175779064
203 Aug 2014 774052098731 189080419
204 Oct 2014 805549167708 196049974
205 Dec 2014 848977922022 200301550
206 Feb 2015 873281414087 205465046
207 Apr 2015 969102906813 243779199
208 Jun 2015 1038937210221 258702138
209 Aug 2015 1163275601001 302955543
210 Oct 2015 1222635267498 309198943
211 Dec 2015 1297865618365 317122157
212 Feb 2016 1399865495608 333012760
213 Apr 2016 1452207704949 338922537
214 Jun 2016 1556175944648 350278081
215 Aug 2016 1637224970324 359796497
216 Oct 2016 1676238489250 363213315
217 Dec 2016 1817189565845 395301176
218 Feb 2017 1892966308635 409490397
219 Apr 2017 2035032639807 451840147
220 Jun 2017 2164683993369 487891767
221 Aug 2017 2242294609510 499965722
222 Oct 2017 2318156361999 508825331
223 Dec 2017 2466098053327 551063065
224 Feb 2018 2608532210351 564286852
225 Apr 2018 2784740996536 621379029
226 Jun 2018 2944617324086 639804105
227 Aug 2018 3204855013281 665309765
228 Oct 2018 3444172142207 722438528
229 Dec 2018 3656719423096 773773190
230 Feb 2019 4164513961679 945019312
231 Apr 2019 4421986382065 993732214
232 Jun 2019 4847677297950 1022913321
233 Aug 2019 5585922333160 1075272215
234 Oct 2019 5985250251028 1097629174
235 Dec 2019 6277551200690 1127023870
236 Feb 2020 6968991265752 1206720688
237 Apr 2020 7788133221338 1267547429
238 Jun 2020 8114046262158 1302852615
239 Aug 2020 8841649410652 1408122887
240 Oct 2020 9215815569509 1432874252
241 Dec 2020 11830842428018 1517995689
242 Feb 2021 12270717209612 1563938043
243 Apr 2021 12732048052023 1590670459
244 Jun 2021 13442974346437 1632796606
245 Aug 2021 13888187863722 1653427055
246 Oct 2021 14599101574547 1721064101
247 Dec 2021 14922033922302 1734664952
248 Feb 2022 15428122140820 1750505007
249 Apr 2022 16071520702170 1781374217
250 Jun 2022 16710373006600 1796349114
251 Aug 2022 17511809676629 2024099677
252 Oct 2022 18231960808828 2167900306
253 Dec 2022 19086596616569 2241439349
254 Feb 2023 20116642176263 2337838461
255 Apr 2023 20926504760221 2440470464
256 Jun 2023 21791125594114 2611654455
257 Aug 2023 22294446104543 2631493489
258 Oct 2023 23600199887231 2775205599
259 Dec 2023 24651580464335 2863228552
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 27225116587937 3333621823
261 Jun 2024 27900199328333 3380877515
262 Aug 2024 29643594176326 3569715357
263 Oct 2024 31362454467668 3745772758
264 Dec 2024 32983029087303 3957195833
265 Feb 2025 35643977584264 4152691448
266 Apr 2025 37294058110495 4234652334
267 Jun 2025 38384788365670 4294972923
268 Aug 2025 40390433406298 4441331387
The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.
TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).
Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.
Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:
https://ftp.ncbi.nih.gov/ncbi-asn1/tsa
https://ftp.ncbi.nih.gov/genbank/tsa
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.
Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.
Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.
Release Date Base Pairs Entries
201 Apr 2014 23632325832 29734989
202 Jun 2014 31707343431 38011942
203 Aug 2014 33676182560 40556905
204 Oct 2014 36279458440 43567759
205 Dec 2014 46056420903 62635617
206 Feb 2015 49765340047 66706014
207 Apr 2015 55796332435 71989588
208 Jun 2015 60697472570 76974601
209 Aug 2015 69360654413 87827013
210 Oct 2015 70917172944 81790031
211 Dec 2015 77583339176 87488539
212 Feb 2016 81932555094 92132318
213 Apr 2016 87811163676 98147566
214 Jun 2016 94413958919 104677061
215 Aug 2016 103399742586 113179607
216 Oct 2016 113209225762 124199597
217 Dec 2016 125328824508 142094337
218 Feb 2017 133517212104 151431485
219 Apr 2017 149038907599 165068542
220 Jun 2017 158112969073 176812130
221 Aug 2017 167045663417 186777106
222 Oct 2017 172909268535 192754804
223 Dec 2017 181394660188 201559502
224 Feb 2018 193940551226 214324264
225 Apr 2018 205232396043 227364990
226 Jun 2018 216556686631 238788334
227 Aug 2018 225520004678 249295386
228 Oct 2018 235875573598 259927414
229 Dec 2018 248592892188 274845473
230 Feb 2019 263936885705 294772430
231 Apr 2019 277118019688 311247136
232 Jun 2019 285390240861 319927264
233 Aug 2019 294727165179 331347807
234 Oct 2019 305371891408 342811151
235 Dec 2019 325433016129 367193844
236 Feb 2020 340994289065 386644871
237 Apr 2020 349692751528 396392280
238 Jun 2020 359947709062 409725050
239 Aug 2020 366968951160 417524567
240 Oct 2020 382996662270 435968379
241 Dec 2020 392206975386 446397378
242 Feb 2021 407605409948 463151000
243 Apr 2021 425076483459 481154920
244 Jun 2021 436594941165 494641358
245 Aug 2021 440578422611 498305045
246 Oct 2021 449891016597 508319391
247 Dec 2021 455870853358 514158576
248 Feb 2022 465013156502 524464601
249 Apr 2022 474421076448 534770586
250 Jun 2022 485056129761 546991572
251 Aug 2022 497501380386 560196830
252 Oct 2022 511476787957 574020080
253 Dec 2022 611850391049 649918843
254 Feb 2023 630615054587 672261981
255 Apr 2023 636291358227 678332682
256 Jun 2023 643127590034 683922756
257 Aug 2023 646176166908 686271945
258 Oct 2023 659924904311 701336089
259 Dec 2023 668807109326 715803123
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 689648317082 741066498
261 Jun 2024 695405769319 746753803
262 Aug 2024 706085554263 755907377
263 Oct 2024 812661461811 948733596
264 Dec 2024 820128973511 957403887
265 Feb 2025 824439978941 961491801
266 Apr 2025 852869986922 996759705
267 Jun 2025 859712036434 1006416037
268 Aug 2025 864483775194 1010159820
The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.
Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:
https://ftp.ncbi.nih.gov/ncbi-asn1/tls
https://ftp.ncbi.nih.gov/genbank/tls
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.
Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.
Release Date Base Pairs Entries
217 Dec 2016 584697919 1268690
218 Feb 2017 636923295 1438349
219 Apr 2017 636923295 1438349 (unchanged)
220 Jun 2017 824191338 1628475
221 Aug 2017 824191338 1628475 (unchanged)
222 Oct 2017 2993818315 9479460
223 Dec 2017 4458042616 12695198
224 Feb 2018 4531966831 12819978
225 Apr 2018 5612769448 14782654
226 Jun 2018 5896511468 15393041
227 Aug 2018 6077824493 15822538
228 Oct 2018 8435112913 20752288
229 Dec 2018 8511829281 20924588
230 Feb 2019 9146836085 23259929
231 Apr 2019 9623321565 24240761
232 Jun 2019 10182427815 25530139
233 Aug 2019 10531800829 26363945
234 Oct 2019 10848455369 27460978
235 Dec 2019 11280596614 28227180
236 Feb 2020 13669678196 34037371
237 Apr 2020 24615270313 65521132
238 Jun 2020 27500635128 75063181
239 Aug 2020 27825059498 75682157
240 Oct 2020 28814798868 78177358
241 Dec 2020 33036509446 88039152
242 Feb 2021 33634122995 90130561
243 Apr 2021 37998534461 102395753
244 Jun 2021 38198113354 102662929
245 Aug 2021 39930167315 106995218
246 Oct 2021 40168874815 107569935
247 Dec 2021 41143480750 109379021
248 Feb 2022 41321107981 109809966
249 Apr 2022 41324192343 109820387
250 Jun 2022 41999358847 111142107
251 Aug 2022 43852280645 115103527
252 Oct 2022 43860512749 115123306
253 Dec 2022 44009657455 115552377
254 Feb 2023 46465508548 121067644
255 Apr 2023 46567924833 121186672
256 Jun 2023 47302831210 122798571
257 Aug 2023 48289699026 124421006
258 Oct 2023 50868407906 130654568
259 Dec 2023 51568356978 132355132
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 53492243256 135115766
261 Jun 2024 54512778803 135446337
262 Aug 2024 77026446552 187321998 Spike caused by restoration of stats for the Aug 2021 KEQH TLS project : 48-mln records
263 Oct 2024 77037504468 187349395
264 Dec 2024 77038271475 187349466
265 Feb 2025 78062322564 189703939
266 Apr 2025 78390585331 190122348
267 Jun 2025 78505522921 190342492
268 Aug 2025 78568415110 190505830
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`month day year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
August 15 2025
NCBI-GenBank Flat File Release 268.0
Bacterial Sequences (Part 1)
179375 loci, 605524051 bases, from 179375 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.
NOTE : Presentation of GI sequence identifiers in the GenBank
flatfile format was discontinued as of March 2017.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, possibly 'LINEAGE'. But because changes like this can be
very disruptive for customers, implementation has not yet been scheduled.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
3.4.4.1 : Important notice about parsing the LOCUS line
Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.
Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.
Consider this LOCUS line for a typical complete bacterial genome:
LOCUS CP032762 5868661 bp DNA circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:
LOCUS AZZZAA02123456789 9999999999 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:
LOCUS AZZZAA0212345678910000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:
LOCUS AZZZAA02123456789 10000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.
3.4.4.2 : Data elements of the LOCUS line
The data elements of the LOCUS line format and their typical/historical
column positions are as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus Name (usually identical to the Accession Number)
29-29 space
30-40 Sequence Length, right-justified
41-41 space
42-43 'bp'
44-44 space
45-47 Strandedness : spaces (if not known), ss- (single-stranded),
ds- (double-stranded), or ms- (mixed-stranded)
48-53 Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), cRNA (viral cRNA)
Left justified.
54-55 space
56-63 Molecule Topology : 'linear' followed by two spaces,
or 'circular'
64-64 space
65-67 Division Code
68-68 space
69-79 Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.
The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :
LOCUS HUMPDNRC 273 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S125 polymorphic dinucleotide repeat.
ACCESSION L10620
LOCUS HUMPDNRG 169 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S114 polymorphic dinucleotide repeat.
ACCESSION L10624
But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:
LOCUS AF035771 1357 bp mRNA linear PRI 30-JUN-1998
DEFINITION Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
complete cds.
ACCESSION AF035771
The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :
PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags)
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites)
GSS - GSS sequences (Genome Survey Sequences)
HTG - HTGS sequences (High Throughput Genomic sequences)
HTC - HTC sequences (High Throughput cDNA sequences)
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences
The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1
^^^^^^^^^^
Compound
Accession.Version
Number
A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:
http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS ANHA01000001 503 bp DNA linear BCT 23-NOV-2012
DEFINITION Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION ANHA01000001 ANHA01000000
VERSION ANHA01000001.1
DBLINK BioProject: PRJNA177352
BioSample: SAMN01795900
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK BioProject:PRJNA174162,PRJNA999998,PRJNA999999
And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.
As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".
DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:
http://www.ncbi.nlm.nih.gov/bioproject
At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:
http://www.ncbi.nlm.nih.gov/books/NBK54016/
DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:
http://www.ncbi.nlm.nih.gov/assembly
At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:
http://www.ncbi.nlm.nih.gov/assembly/help/
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:
http://www.insdc.org/documents/feature-table
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.2
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
The list of valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.3
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, as of June 2022 the `/exception' qualifier has only four
allowed values: 'RNA editing', 'reasons given in citation', 'rearrangement
required for product', and 'annotated by transcript or proteomic data'.
These are known as controlled vocabulary qualifier values. Controlled
qualifier values are case sensitive.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS KZ271580 141308 bp DNA linear CON 17-AUG-2017
DEFINITION Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION KZ271580 LQNL01000000
VERSION KZ271580.1
DBLINK BioProject: PRJNA230512
BioSample: SAMN04226856
KEYWORDS WGS; HIGH_QUALITY_DRAFT.
...
mRNA complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/product="hypothetical protein"
CDS complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/codon_start=1
/product="hypothetical protein"
/protein_id="OZC04795.1"
/db_xref="GI:1233056989"
/translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Scaffold/CON-division join() sequence
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
info@ncbi.nlm.nih.gov
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.
The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov .
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to provide the
primary accession number for a sequence and the publication in which
the sequence first appeared. If the data are unpublished, we urge you
to contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Sayers EW, Cavanaugh M, Frisse L, Pruitt KD, Schneider VA, Underwood BA, Yankie L,
Karsch-Mizrachi I, "GenBank 2025 update", Nucleic Acids Research,
Volume 53, Issue D1, January 2025, pp. D56-D61.
PMID: 39558184
PMCID: PMC11701615
DOI: 10.1093/nar/gkae1114
The following statement is an example of how one might cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity to...'
(1) Sayers, EW. et al, Nucleic Acids Res. 53(D1):D56-D612 (2025)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
https://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: Simply direct your web browser of choice to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
https://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Genome Workbench can be used to submit revisions to
previous submissions. In addition, suggestions and corrections can
be sent by electronic mail to: update@ncbi.nlm.nih.gov. Please be
certain to indicate the primary accession number of the entry to which
your comments apply; it is helpful if you also give the entry name and
the current contents of any data field for which you are recommending
a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Shelby Bidwell, Larissa Brown,
Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky,
Scott Durkin, Michel Eschenbrenner, Michael Fetchko, Linda Frisse,
Andrea Gocke, Anjanette Johnston, Erica Lam,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Susan Schafer, Augustus Tilley,
Beverly Underwood, and Linda Yankie
GenBank Release Coordination
Mark Cavanaugh
Data Management and Preparation
Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
Sergiy Gotvyanskyy, Eugene Gribov, Sergei Kalashnikov, Jonathan Kans,
Leonid Khotomliansky, Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh,
Alex Kotliarov, Frank Ludwig, Vasuki Palanigobu, Anton Perkov,
Andriy Petrow, Sergey Petrunin, Dmitrii Saprykin, Wenyao Shi, Denis Sinyakov,
Thomas Smith, Vladimir Soussov, Vitaly Stakhovsky, Elena Starchenko,
Hanzhen Sun, Andrei Vereshchagin, Jewen Xiao, Liwei Zhou
Database Administration
Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
Benjamin Slade, Constantin Vasilyev
Customer Support
David Brodsky, Hanguan Liu, Cooper Park, Monica Romiti, Eric Sayers,
Majda Valjavec-Gratian
Project Direction/Leadership
Steve Sherry : Acting Director, NLM
Kim Pruitt : Acting Director, NCBI
Valerie Schneider : Acting Branch Chief, NCBI/IEB
Eugene Yaschenko : Chief Technology Officer, NCBI/IRB
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
