Current GenBank Release Notes

GBREL.TXT          Genetic Sequence Data Bank
                         October 15 2021

               NCBI-GenBank Flat File Release 246.0

                    Distribution Release Notes

  233642893 sequences,  1014763752113 bases, for traditional GenBank records
 2336953427 sequences, 15089161465959 bases, for set-based (WGS/TSA/TLS) records

  This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://www.ncbi.nlm.nih.gov/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 246.0
1.2 Cutoff Date
1.3 Important Changes in Release 246.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 246.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://www.ncbi.nlm.nih.gov/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 246.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

  GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:

        ftp://ftp.ncbi.nih.gov/genbank/wgs
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	
        ftp://ftp.ncbi.nih.gov/genbank/tsa
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	
        ftp://ftp.ncbi.nih.gov/genbank/tls
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls

See the README files in those areas for more information.

  Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:

	ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/

  Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.

1.2 Cutoff Date

  This full release, 246.0, incorporates data processed by the INSDC databases
as of Friday October 29 2021 at 5:43AM EDT. For more recent data, users are
advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotide' database (see Section 6.4 of this document).

1.3 Important Changes in Release 246.0

1.3.1 Delivery date for GenBank 246.0 delayed by two weeks

  Due to scheduling issues in early October 2021, followed by a hardware
failure on October 21 2021, delivery of GenBank 246.0 was delayed by
about two weeks. Close-of-data did not occur until Friday October 29th,
and the release files were made available on Tuesday November 2nd 2021.

1.3.2 Organizational changes

  The total number of sequence data files increased by 268 with this release:
  
  - the BCT division is now composed of 663 files (+24)
  - the ENV division is now composed of  70 files (+3)
  - the INV division is now composed of 461 files (+96)
  - the PAT division is now composed of 246 files (+1)
  - the PLN division is now composed of 723 files (+15)
  - the VRL division is now composed of 297 files (+124)
  - the VRT division is now composed of 277 files (+5)

1.3.3 New /regulatory_class values for the regulatory feature

  As of this October 2021 GenBank Release 246.0, new values are
supported for the /regulatory_class qualifier:

  recombination_enhancer    : A regulatory region that promotes
    or induces the process of recombination.

  uORF : A short open reading frame that is
    found in the 5' untranslated region of an mRNA and plays a role
    in translational regulation.

For the first new class, one of the features of GenBank record BK006937
illustrates how it can be used:

Current:

     regulatory      29108..29809
                     /regulatory_class="other"
                     /note="RE (recombination enhancer);
                     Orientation-independent, cis-acting region that controls
                     mating-type dependent recombination along entire left arm
                     of ChrIII"
                     /db_xref="SGD:S000303804"

Allowed as of GB 246.0 :

     regulatory      29108..29809
                     /regulatory_class="recombination_enhancer"
                     /note="Orientation-independent, cis-acting region that controls
                     mating-type dependent recombination along entire left arm
                     of ChrIII"
                     /db_xref="SGD:S000303804"

And for the second of the new classes, here's a mocked-up example of how an
impacted regulatory feature will change:

Current:

     regulatory      30..455
                     /regulatory_class="other"
                     /gene="MTR"
                     /gene_synonym="cblG; HMAG; MS"
                     /experiment="DESCRIPTION:regulatory uORF[PMID:17683808]"
                     /note="regulatory uORF; this uORF is predicted to encode a
                     141 aa peptide (PMID:17683808)"

Allowed as of GB 246.0 :

     regulatory      30..455
                     /regulatory_class="uORF"
                     /gene="MTR"
                     /gene_synonym="cblG; HMAG; MS"
                     /experiment="DESCRIPTION:regulatory uORF[PMID:17683808]"
                     /note="this uORF is predicted to encode a
                     141 aa peptide (PMID:17683808)"

1.4 Upcoming Changes

  No changes to the GenBank flatfile format are planned at this time.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the ENA and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the ENA and DDBJ databases.
BankIt may be used with any modern web browser. You can access BankIt
from GenBank's home page:   

	http://www.ncbi.nlm.nih.gov/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov .

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 4300 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct413.seq - Bacterial sequence entries, part 413.
351. gbbct414.seq - Bacterial sequence entries, part 414.
352. gbbct415.seq - Bacterial sequence entries, part 415.
353. gbbct416.seq - Bacterial sequence entries, part 416.
354. gbbct417.seq - Bacterial sequence entries, part 417.
355. gbbct418.seq - Bacterial sequence entries, part 418.
356. gbbct419.seq - Bacterial sequence entries, part 419.
357. gbbct42.seq - Bacterial sequence entries, part 42.
358. gbbct420.seq - Bacterial sequence entries, part 420.
359. gbbct421.seq - Bacterial sequence entries, part 421.
360. gbbct422.seq - Bacterial sequence entries, part 422.
361. gbbct423.seq - Bacterial sequence entries, part 423.
362. gbbct424.seq - Bacterial sequence entries, part 424.
363. gbbct425.seq - Bacterial sequence entries, part 425.
364. gbbct426.seq - Bacterial sequence entries, part 426.
365. gbbct427.seq - Bacterial sequence entries, part 427.
366. gbbct428.seq - Bacterial sequence entries, part 428.
367. gbbct429.seq - Bacterial sequence entries, part 429.
368. gbbct43.seq - Bacterial sequence entries, part 43.
369. gbbct430.seq - Bacterial sequence entries, part 430.
370. gbbct431.seq - Bacterial sequence entries, part 431.
371. gbbct432.seq - Bacterial sequence entries, part 432.
372. gbbct433.seq - Bacterial sequence entries, part 433.
373. gbbct434.seq - Bacterial sequence entries, part 434.
374. gbbct435.seq - Bacterial sequence entries, part 435.
375. gbbct436.seq - Bacterial sequence entries, part 436.
376. gbbct437.seq - Bacterial sequence entries, part 437.
377. gbbct438.seq - Bacterial sequence entries, part 438.
378. gbbct439.seq - Bacterial sequence entries, part 439.
379. gbbct44.seq - Bacterial sequence entries, part 44.
380. gbbct440.seq - Bacterial sequence entries, part 440.
381. gbbct441.seq - Bacterial sequence entries, part 441.
382. gbbct442.seq - Bacterial sequence entries, part 442.
383. gbbct443.seq - Bacterial sequence entries, part 443.
384. gbbct444.seq - Bacterial sequence entries, part 444.
385. gbbct445.seq - Bacterial sequence entries, part 445.
386. gbbct446.seq - Bacterial sequence entries, part 446.
387. gbbct447.seq - Bacterial sequence entries, part 447.
388. gbbct448.seq - Bacterial sequence entries, part 448.
389. gbbct449.seq - Bacterial sequence entries, part 449.
390. gbbct45.seq - Bacterial sequence entries, part 45.
391. gbbct450.seq - Bacterial sequence entries, part 450.
392. gbbct451.seq - Bacterial sequence entries, part 451.
393. gbbct452.seq - Bacterial sequence entries, part 452.
394. gbbct453.seq - Bacterial sequence entries, part 453.
395. gbbct454.seq - Bacterial sequence entries, part 454.
396. gbbct455.seq - Bacterial sequence entries, part 455.
397. gbbct456.seq - Bacterial sequence entries, part 456.
398. gbbct457.seq - Bacterial sequence entries, part 457.
399. gbbct458.seq - Bacterial sequence entries, part 458.
400. gbbct459.seq - Bacterial sequence entries, part 459.
401. gbbct46.seq - Bacterial sequence entries, part 46.
402. gbbct460.seq - Bacterial sequence entries, part 460.
403. gbbct461.seq - Bacterial sequence entries, part 461.
404. gbbct462.seq - Bacterial sequence entries, part 462.
405. gbbct463.seq - Bacterial sequence entries, part 463.
406. gbbct464.seq - Bacterial sequence entries, part 464.
407. gbbct465.seq - Bacterial sequence entries, part 465.
408. gbbct466.seq - Bacterial sequence entries, part 466.
409. gbbct467.seq - Bacterial sequence entries, part 467.
410. gbbct468.seq - Bacterial sequence entries, part 468.
411. gbbct469.seq - Bacterial sequence entries, part 469.
412. gbbct47.seq - Bacterial sequence entries, part 47.
413. gbbct470.seq - Bacterial sequence entries, part 470.
414. gbbct471.seq - Bacterial sequence entries, part 471.
415. gbbct472.seq - Bacterial sequence entries, part 472.
416. gbbct473.seq - Bacterial sequence entries, part 473.
417. gbbct474.seq - Bacterial sequence entries, part 474.
418. gbbct475.seq - Bacterial sequence entries, part 475.
419. gbbct476.seq - Bacterial sequence entries, part 476.
420. gbbct477.seq - Bacterial sequence entries, part 477.
421. gbbct478.seq - Bacterial sequence entries, part 478.
422. gbbct479.seq - Bacterial sequence entries, part 479.
423. gbbct48.seq - Bacterial sequence entries, part 48.
424. gbbct480.seq - Bacterial sequence entries, part 480.
425. gbbct481.seq - Bacterial sequence entries, part 481.
426. gbbct482.seq - Bacterial sequence entries, part 482.
427. gbbct483.seq - Bacterial sequence entries, part 483.
428. gbbct484.seq - Bacterial sequence entries, part 484.
429. gbbct485.seq - Bacterial sequence entries, part 485.
430. gbbct486.seq - Bacterial sequence entries, part 486.
431. gbbct487.seq - Bacterial sequence entries, part 487.
432. gbbct488.seq - Bacterial sequence entries, part 488.
433. gbbct489.seq - Bacterial sequence entries, part 489.
434. gbbct49.seq - Bacterial sequence entries, part 49.
435. gbbct490.seq - Bacterial sequence entries, part 490.
436. gbbct491.seq - Bacterial sequence entries, part 491.
437. gbbct492.seq - Bacterial sequence entries, part 492.
438. gbbct493.seq - Bacterial sequence entries, part 493.
439. gbbct494.seq - Bacterial sequence entries, part 494.
440. gbbct495.seq - Bacterial sequence entries, part 495.
441. gbbct496.seq - Bacterial sequence entries, part 496.
442. gbbct497.seq - Bacterial sequence entries, part 497.
443. gbbct498.seq - Bacterial sequence entries, part 498.
444. gbbct499.seq - Bacterial sequence entries, part 499.
445. gbbct5.seq - Bacterial sequence entries, part 5.
446. gbbct50.seq - Bacterial sequence entries, part 50.
447. gbbct500.seq - Bacterial sequence entries, part 500.
448. gbbct501.seq - Bacterial sequence entries, part 501.
449. gbbct502.seq - Bacterial sequence entries, part 502.
450. gbbct503.seq - Bacterial sequence entries, part 503.
451. gbbct504.seq - Bacterial sequence entries, part 504.
452. gbbct505.seq - Bacterial sequence entries, part 505.
453. gbbct506.seq - Bacterial sequence entries, part 506.
454. gbbct507.seq - Bacterial sequence entries, part 507.
455. gbbct508.seq - Bacterial sequence entries, part 508.
456. gbbct509.seq - Bacterial sequence entries, part 509.
457. gbbct51.seq - Bacterial sequence entries, part 51.
458. gbbct510.seq - Bacterial sequence entries, part 510.
459. gbbct511.seq - Bacterial sequence entries, part 511.
460. gbbct512.seq - Bacterial sequence entries, part 512.
461. gbbct513.seq - Bacterial sequence entries, part 513.
462. gbbct514.seq - Bacterial sequence entries, part 514.
463. gbbct515.seq - Bacterial sequence entries, part 515.
464. gbbct516.seq - Bacterial sequence entries, part 516.
465. gbbct517.seq - Bacterial sequence entries, part 517.
466. gbbct518.seq - Bacterial sequence entries, part 518.
467. gbbct519.seq - Bacterial sequence entries, part 519.
468. gbbct52.seq - Bacterial sequence entries, part 52.
469. gbbct520.seq - Bacterial sequence entries, part 520.
470. gbbct521.seq - Bacterial sequence entries, part 521.
471. gbbct522.seq - Bacterial sequence entries, part 522.
472. gbbct523.seq - Bacterial sequence entries, part 523.
473. gbbct524.seq - Bacterial sequence entries, part 524.
474. gbbct525.seq - Bacterial sequence entries, part 525.
475. gbbct526.seq - Bacterial sequence entries, part 526.
476. gbbct527.seq - Bacterial sequence entries, part 527.
477. gbbct528.seq - Bacterial sequence entries, part 528.
478. gbbct529.seq - Bacterial sequence entries, part 529.
479. gbbct53.seq - Bacterial sequence entries, part 53.
480. gbbct530.seq - Bacterial sequence entries, part 530.
481. gbbct531.seq - Bacterial sequence entries, part 531.
482. gbbct532.seq - Bacterial sequence entries, part 532.
483. gbbct533.seq - Bacterial sequence entries, part 533.
484. gbbct534.seq - Bacterial sequence entries, part 534.
485. gbbct535.seq - Bacterial sequence entries, part 535.
486. gbbct536.seq - Bacterial sequence entries, part 536.
487. gbbct537.seq - Bacterial sequence entries, part 537.
488. gbbct538.seq - Bacterial sequence entries, part 538.
489. gbbct539.seq - Bacterial sequence entries, part 539.
490. gbbct54.seq - Bacterial sequence entries, part 54.
491. gbbct540.seq - Bacterial sequence entries, part 540.
492. gbbct541.seq - Bacterial sequence entries, part 541.
493. gbbct542.seq - Bacterial sequence entries, part 542.
494. gbbct543.seq - Bacterial sequence entries, part 543.
495. gbbct544.seq - Bacterial sequence entries, part 544.
496. gbbct545.seq - Bacterial sequence entries, part 545.
497. gbbct546.seq - Bacterial sequence entries, part 546.
498. gbbct547.seq - Bacterial sequence entries, part 547.
499. gbbct548.seq - Bacterial sequence entries, part 548.
500. gbbct549.seq - Bacterial sequence entries, part 549.
501. gbbct55.seq - Bacterial sequence entries, part 55.
502. gbbct550.seq - Bacterial sequence entries, part 550.
503. gbbct551.seq - Bacterial sequence entries, part 551.
504. gbbct552.seq - Bacterial sequence entries, part 552.
505. gbbct553.seq - Bacterial sequence entries, part 553.
506. gbbct554.seq - Bacterial sequence entries, part 554.
507. gbbct555.seq - Bacterial sequence entries, part 555.
508. gbbct556.seq - Bacterial sequence entries, part 556.
509. gbbct557.seq - Bacterial sequence entries, part 557.
510. gbbct558.seq - Bacterial sequence entries, part 558.
511. gbbct559.seq - Bacterial sequence entries, part 559.
512. gbbct56.seq - Bacterial sequence entries, part 56.
513. gbbct560.seq - Bacterial sequence entries, part 560.
514. gbbct561.seq - Bacterial sequence entries, part 561.
515. gbbct562.seq - Bacterial sequence entries, part 562.
516. gbbct563.seq - Bacterial sequence entries, part 563.
517. gbbct564.seq - Bacterial sequence entries, part 564.
518. gbbct565.seq - Bacterial sequence entries, part 565.
519. gbbct566.seq - Bacterial sequence entries, part 566.
520. gbbct567.seq - Bacterial sequence entries, part 567.
521. gbbct568.seq - Bacterial sequence entries, part 568.
522. gbbct569.seq - Bacterial sequence entries, part 569.
523. gbbct57.seq - Bacterial sequence entries, part 57.
524. gbbct570.seq - Bacterial sequence entries, part 570.
525. gbbct571.seq - Bacterial sequence entries, part 571.
526. gbbct572.seq - Bacterial sequence entries, part 572.
527. gbbct573.seq - Bacterial sequence entries, part 573.
528. gbbct574.seq - Bacterial sequence entries, part 574.
529. gbbct575.seq - Bacterial sequence entries, part 575.
530. gbbct576.seq - Bacterial sequence entries, part 576.
531. gbbct577.seq - Bacterial sequence entries, part 577.
532. gbbct578.seq - Bacterial sequence entries, part 578.
533. gbbct579.seq - Bacterial sequence entries, part 579.
534. gbbct58.seq - Bacterial sequence entries, part 58.
535. gbbct580.seq - Bacterial sequence entries, part 580.
536. gbbct581.seq - Bacterial sequence entries, part 581.
537. gbbct582.seq - Bacterial sequence entries, part 582.
538. gbbct583.seq - Bacterial sequence entries, part 583.
539. gbbct584.seq - Bacterial sequence entries, part 584.
540. gbbct585.seq - Bacterial sequence entries, part 585.
541. gbbct586.seq - Bacterial sequence entries, part 586.
542. gbbct587.seq - Bacterial sequence entries, part 587.
543. gbbct588.seq - Bacterial sequence entries, part 588.
544. gbbct589.seq - Bacterial sequence entries, part 589.
545. gbbct59.seq - Bacterial sequence entries, part 59.
546. gbbct590.seq - Bacterial sequence entries, part 590.
547. gbbct591.seq - Bacterial sequence entries, part 591.
548. gbbct592.seq - Bacterial sequence entries, part 592.
549. gbbct593.seq - Bacterial sequence entries, part 593.
550. gbbct594.seq - Bacterial sequence entries, part 594.
551. gbbct595.seq - Bacterial sequence entries, part 595.
552. gbbct596.seq - Bacterial sequence entries, part 596.
553. gbbct597.seq - Bacterial sequence entries, part 597.
554. gbbct598.seq - Bacterial sequence entries, part 598.
555. gbbct599.seq - Bacterial sequence entries, part 599.
556. gbbct6.seq - Bacterial sequence entries, part 6.
557. gbbct60.seq - Bacterial sequence entries, part 60.
558. gbbct600.seq - Bacterial sequence entries, part 600.
559. gbbct601.seq - Bacterial sequence entries, part 601.
560. gbbct602.seq - Bacterial sequence entries, part 602.
561. gbbct603.seq - Bacterial sequence entries, part 603.
562. gbbct604.seq - Bacterial sequence entries, part 604.
563. gbbct605.seq - Bacterial sequence entries, part 605.
564. gbbct606.seq - Bacterial sequence entries, part 606.
565. gbbct607.seq - Bacterial sequence entries, part 607.
566. gbbct608.seq - Bacterial sequence entries, part 608.
567. gbbct609.seq - Bacterial sequence entries, part 609.
568. gbbct61.seq - Bacterial sequence entries, part 61.
569. gbbct610.seq - Bacterial sequence entries, part 610.
570. gbbct611.seq - Bacterial sequence entries, part 611.
571. gbbct612.seq - Bacterial sequence entries, part 612.
572. gbbct613.seq - Bacterial sequence entries, part 613.
573. gbbct614.seq - Bacterial sequence entries, part 614.
574. gbbct615.seq - Bacterial sequence entries, part 615.
575. gbbct616.seq - Bacterial sequence entries, part 616.
576. gbbct617.seq - Bacterial sequence entries, part 617.
577. gbbct618.seq - Bacterial sequence entries, part 618.
578. gbbct619.seq - Bacterial sequence entries, part 619.
579. gbbct62.seq - Bacterial sequence entries, part 62.
580. gbbct620.seq - Bacterial sequence entries, part 620.
581. gbbct621.seq - Bacterial sequence entries, part 621.
582. gbbct622.seq - Bacterial sequence entries, part 622.
583. gbbct623.seq - Bacterial sequence entries, part 623.
584. gbbct624.seq - Bacterial sequence entries, part 624.
585. gbbct625.seq - Bacterial sequence entries, part 625.
586. gbbct626.seq - Bacterial sequence entries, part 626.
587. gbbct627.seq - Bacterial sequence entries, part 627.
588. gbbct628.seq - Bacterial sequence entries, part 628.
589. gbbct629.seq - Bacterial sequence entries, part 629.
590. gbbct63.seq - Bacterial sequence entries, part 63.
591. gbbct630.seq - Bacterial sequence entries, part 630.
592. gbbct631.seq - Bacterial sequence entries, part 631.
593. gbbct632.seq - Bacterial sequence entries, part 632.
594. gbbct633.seq - Bacterial sequence entries, part 633.
595. gbbct634.seq - Bacterial sequence entries, part 634.
596. gbbct635.seq - Bacterial sequence entries, part 635.
597. gbbct636.seq - Bacterial sequence entries, part 636.
598. gbbct637.seq - Bacterial sequence entries, part 637.
599. gbbct638.seq - Bacterial sequence entries, part 638.
600. gbbct639.seq - Bacterial sequence entries, part 639.
601. gbbct64.seq - Bacterial sequence entries, part 64.
602. gbbct640.seq - Bacterial sequence entries, part 640.
603. gbbct641.seq - Bacterial sequence entries, part 641.
604. gbbct642.seq - Bacterial sequence entries, part 642.
605. gbbct643.seq - Bacterial sequence entries, part 643.
606. gbbct644.seq - Bacterial sequence entries, part 644.
607. gbbct645.seq - Bacterial sequence entries, part 645.
608. gbbct646.seq - Bacterial sequence entries, part 646.
609. gbbct647.seq - Bacterial sequence entries, part 647.
610. gbbct648.seq - Bacterial sequence entries, part 648.
611. gbbct649.seq - Bacterial sequence entries, part 649.
612. gbbct65.seq - Bacterial sequence entries, part 65.
613. gbbct650.seq - Bacterial sequence entries, part 650.
614. gbbct651.seq - Bacterial sequence entries, part 651.
615. gbbct652.seq - Bacterial sequence entries, part 652.
616. gbbct653.seq - Bacterial sequence entries, part 653.
617. gbbct654.seq - Bacterial sequence entries, part 654.
618. gbbct655.seq - Bacterial sequence entries, part 655.
619. gbbct656.seq - Bacterial sequence entries, part 656.
620. gbbct657.seq - Bacterial sequence entries, part 657.
621. gbbct658.seq - Bacterial sequence entries, part 658.
622. gbbct659.seq - Bacterial sequence entries, part 659.
623. gbbct66.seq - Bacterial sequence entries, part 66.
624. gbbct660.seq - Bacterial sequence entries, part 660.
625. gbbct661.seq - Bacterial sequence entries, part 661.
626. gbbct662.seq - Bacterial sequence entries, part 662.
627. gbbct663.seq - Bacterial sequence entries, part 663.
628. gbbct67.seq - Bacterial sequence entries, part 67.
629. gbbct68.seq - Bacterial sequence entries, part 68.
630. gbbct69.seq - Bacterial sequence entries, part 69.
631. gbbct7.seq - Bacterial sequence entries, part 7.
632. gbbct70.seq - Bacterial sequence entries, part 70.
633. gbbct71.seq - Bacterial sequence entries, part 71.
634. gbbct72.seq - Bacterial sequence entries, part 72.
635. gbbct73.seq - Bacterial sequence entries, part 73.
636. gbbct74.seq - Bacterial sequence entries, part 74.
637. gbbct75.seq - Bacterial sequence entries, part 75.
638. gbbct76.seq - Bacterial sequence entries, part 76.
639. gbbct77.seq - Bacterial sequence entries, part 77.
640. gbbct78.seq - Bacterial sequence entries, part 78.
641. gbbct79.seq - Bacterial sequence entries, part 79.
642. gbbct8.seq - Bacterial sequence entries, part 8.
643. gbbct80.seq - Bacterial sequence entries, part 80.
644. gbbct81.seq - Bacterial sequence entries, part 81.
645. gbbct82.seq - Bacterial sequence entries, part 82.
646. gbbct83.seq - Bacterial sequence entries, part 83.
647. gbbct84.seq - Bacterial sequence entries, part 84.
648. gbbct85.seq - Bacterial sequence entries, part 85.
649. gbbct86.seq - Bacterial sequence entries, part 86.
650. gbbct87.seq - Bacterial sequence entries, part 87.
651. gbbct88.seq - Bacterial sequence entries, part 88.
652. gbbct89.seq - Bacterial sequence entries, part 89.
653. gbbct9.seq - Bacterial sequence entries, part 9.
654. gbbct90.seq - Bacterial sequence entries, part 90.
655. gbbct91.seq - Bacterial sequence entries, part 91.
656. gbbct92.seq - Bacterial sequence entries, part 92.
657. gbbct93.seq - Bacterial sequence entries, part 93.
658. gbbct94.seq - Bacterial sequence entries, part 94.
659. gbbct95.seq - Bacterial sequence entries, part 95.
660. gbbct96.seq - Bacterial sequence entries, part 96.
661. gbbct97.seq - Bacterial sequence entries, part 97.
662. gbbct98.seq - Bacterial sequence entries, part 98.
663. gbbct99.seq - Bacterial sequence entries, part 99.
664. gbchg.txt - Accession numbers of entries updated since the previous release.
665. gbcon1.seq - Constructed sequence entries, part 1.
666. gbcon10.seq - Constructed sequence entries, part 10.
667. gbcon100.seq - Constructed sequence entries, part 100.
668. gbcon101.seq - Constructed sequence entries, part 101.
669. gbcon102.seq - Constructed sequence entries, part 102.
670. gbcon103.seq - Constructed sequence entries, part 103.
671. gbcon104.seq - Constructed sequence entries, part 104.
672. gbcon105.seq - Constructed sequence entries, part 105.
673. gbcon106.seq - Constructed sequence entries, part 106.
674. gbcon107.seq - Constructed sequence entries, part 107.
675. gbcon108.seq - Constructed sequence entries, part 108.
676. gbcon109.seq - Constructed sequence entries, part 109.
677. gbcon11.seq - Constructed sequence entries, part 11.
678. gbcon110.seq - Constructed sequence entries, part 110.
679. gbcon111.seq - Constructed sequence entries, part 111.
680. gbcon112.seq - Constructed sequence entries, part 112.
681. gbcon113.seq - Constructed sequence entries, part 113.
682. gbcon114.seq - Constructed sequence entries, part 114.
683. gbcon115.seq - Constructed sequence entries, part 115.
684. gbcon116.seq - Constructed sequence entries, part 116.
685. gbcon117.seq - Constructed sequence entries, part 117.
686. gbcon118.seq - Constructed sequence entries, part 118.
687. gbcon119.seq - Constructed sequence entries, part 119.
688. gbcon12.seq - Constructed sequence entries, part 12.
689. gbcon120.seq - Constructed sequence entries, part 120.
690. gbcon121.seq - Constructed sequence entries, part 121.
691. gbcon122.seq - Constructed sequence entries, part 122.
692. gbcon123.seq - Constructed sequence entries, part 123.
693. gbcon124.seq - Constructed sequence entries, part 124.
694. gbcon125.seq - Constructed sequence entries, part 125.
695. gbcon126.seq - Constructed sequence entries, part 126.
696. gbcon127.seq - Constructed sequence entries, part 127.
697. gbcon128.seq - Constructed sequence entries, part 128.
698. gbcon129.seq - Constructed sequence entries, part 129.
699. gbcon13.seq - Constructed sequence entries, part 13.
700. gbcon130.seq - Constructed sequence entries, part 130.
701. gbcon131.seq - Constructed sequence entries, part 131.
702. gbcon132.seq - Constructed sequence entries, part 132.
703. gbcon133.seq - Constructed sequence entries, part 133.
704. gbcon134.seq - Constructed sequence entries, part 134.
705. gbcon135.seq - Constructed sequence entries, part 135.
706. gbcon136.seq - Constructed sequence entries, part 136.
707. gbcon137.seq - Constructed sequence entries, part 137.
708. gbcon138.seq - Constructed sequence entries, part 138.
709. gbcon139.seq - Constructed sequence entries, part 139.
710. gbcon14.seq - Constructed sequence entries, part 14.
711. gbcon140.seq - Constructed sequence entries, part 140.
712. gbcon141.seq - Constructed sequence entries, part 141.
713. gbcon142.seq - Constructed sequence entries, part 142.
714. gbcon143.seq - Constructed sequence entries, part 143.
715. gbcon144.seq - Constructed sequence entries, part 144.
716. gbcon145.seq - Constructed sequence entries, part 145.
717. gbcon146.seq - Constructed sequence entries, part 146.
718. gbcon147.seq - Constructed sequence entries, part 147.
719. gbcon148.seq - Constructed sequence entries, part 148.
720. gbcon149.seq - Constructed sequence entries, part 149.
721. gbcon15.seq - Constructed sequence entries, part 15.
722. gbcon150.seq - Constructed sequence entries, part 150.
723. gbcon151.seq - Constructed sequence entries, part 151.
724. gbcon152.seq - Constructed sequence entries, part 152.
725. gbcon153.seq - Constructed sequence entries, part 153.
726. gbcon154.seq - Constructed sequence entries, part 154.
727. gbcon155.seq - Constructed sequence entries, part 155.
728. gbcon156.seq - Constructed sequence entries, part 156.
729. gbcon157.seq - Constructed sequence entries, part 157.
730. gbcon158.seq - Constructed sequence entries, part 158.
731. gbcon159.seq - Constructed sequence entries, part 159.
732. gbcon16.seq - Constructed sequence entries, part 16.
733. gbcon160.seq - Constructed sequence entries, part 160.
734. gbcon161.seq - Constructed sequence entries, part 161.
735. gbcon162.seq - Constructed sequence entries, part 162.
736. gbcon163.seq - Constructed sequence entries, part 163.
737. gbcon164.seq - Constructed sequence entries, part 164.
738. gbcon165.seq - Constructed sequence entries, part 165.
739. gbcon166.seq - Constructed sequence entries, part 166.
740. gbcon167.seq - Constructed sequence entries, part 167.
741. gbcon168.seq - Constructed sequence entries, part 168.
742. gbcon169.seq - Constructed sequence entries, part 169.
743. gbcon17.seq - Constructed sequence entries, part 17.
744. gbcon170.seq - Constructed sequence entries, part 170.
745. gbcon171.seq - Constructed sequence entries, part 171.
746. gbcon172.seq - Constructed sequence entries, part 172.
747. gbcon173.seq - Constructed sequence entries, part 173.
748. gbcon174.seq - Constructed sequence entries, part 174.
749. gbcon175.seq - Constructed sequence entries, part 175.
750. gbcon176.seq - Constructed sequence entries, part 176.
751. gbcon177.seq - Constructed sequence entries, part 177.
752. gbcon178.seq - Constructed sequence entries, part 178.
753. gbcon179.seq - Constructed sequence entries, part 179.
754. gbcon18.seq - Constructed sequence entries, part 18.
755. gbcon180.seq - Constructed sequence entries, part 180.
756. gbcon181.seq - Constructed sequence entries, part 181.
757. gbcon182.seq - Constructed sequence entries, part 182.
758. gbcon183.seq - Constructed sequence entries, part 183.
759. gbcon184.seq - Constructed sequence entries, part 184.
760. gbcon185.seq - Constructed sequence entries, part 185.
761. gbcon186.seq - Constructed sequence entries, part 186.
762. gbcon187.seq - Constructed sequence entries, part 187.
763. gbcon188.seq - Constructed sequence entries, part 188.
764. gbcon189.seq - Constructed sequence entries, part 189.
765. gbcon19.seq - Constructed sequence entries, part 19.
766. gbcon190.seq - Constructed sequence entries, part 190.
767. gbcon191.seq - Constructed sequence entries, part 191.
768. gbcon192.seq - Constructed sequence entries, part 192.
769. gbcon193.seq - Constructed sequence entries, part 193.
770. gbcon194.seq - Constructed sequence entries, part 194.
771. gbcon195.seq - Constructed sequence entries, part 195.
772. gbcon196.seq - Constructed sequence entries, part 196.
773. gbcon197.seq - Constructed sequence entries, part 197.
774. gbcon198.seq - Constructed sequence entries, part 198.
775. gbcon199.seq - Constructed sequence entries, part 199.
776. gbcon2.seq - Constructed sequence entries, part 2.
777. gbcon20.seq - Constructed sequence entries, part 20.
778. gbcon200.seq - Constructed sequence entries, part 200.
779. gbcon201.seq - Constructed sequence entries, part 201.
780. gbcon202.seq - Constructed sequence entries, part 202.
781. gbcon203.seq - Constructed sequence entries, part 203.
782. gbcon204.seq - Constructed sequence entries, part 204.
783. gbcon205.seq - Constructed sequence entries, part 205.
784. gbcon206.seq - Constructed sequence entries, part 206.
785. gbcon207.seq - Constructed sequence entries, part 207.
786. gbcon208.seq - Constructed sequence entries, part 208.
787. gbcon209.seq - Constructed sequence entries, part 209.
788. gbcon21.seq - Constructed sequence entries, part 21.
789. gbcon210.seq - Constructed sequence entries, part 210.
790. gbcon211.seq - Constructed sequence entries, part 211.
791. gbcon212.seq - Constructed sequence entries, part 212.
792. gbcon213.seq - Constructed sequence entries, part 213.
793. gbcon214.seq - Constructed sequence entries, part 214.
794. gbcon215.seq - Constructed sequence entries, part 215.
795. gbcon216.seq - Constructed sequence entries, part 216.
796. gbcon217.seq - Constructed sequence entries, part 217.
797. gbcon218.seq - Constructed sequence entries, part 218.
798. gbcon219.seq - Constructed sequence entries, part 219.
799. gbcon22.seq - Constructed sequence entries, part 22.
800. gbcon220.seq - Constructed sequence entries, part 220.
801. gbcon221.seq - Constructed sequence entries, part 221.
802. gbcon222.seq - Constructed sequence entries, part 222.
803. gbcon23.seq - Constructed sequence entries, part 23.
804. gbcon24.seq - Constructed sequence entries, part 24.
805. gbcon25.seq - Constructed sequence entries, part 25.
806. gbcon26.seq - Constructed sequence entries, part 26.
807. gbcon27.seq - Constructed sequence entries, part 27.
808. gbcon28.seq - Constructed sequence entries, part 28.
809. gbcon29.seq - Constructed sequence entries, part 29.
810. gbcon3.seq - Constructed sequence entries, part 3.
811. gbcon30.seq - Constructed sequence entries, part 30.
812. gbcon31.seq - Constructed sequence entries, part 31.
813. gbcon32.seq - Constructed sequence entries, part 32.
814. gbcon33.seq - Constructed sequence entries, part 33.
815. gbcon34.seq - Constructed sequence entries, part 34.
816. gbcon35.seq - Constructed sequence entries, part 35.
817. gbcon36.seq - Constructed sequence entries, part 36.
818. gbcon37.seq - Constructed sequence entries, part 37.
819. gbcon38.seq - Constructed sequence entries, part 38.
820. gbcon39.seq - Constructed sequence entries, part 39.
821. gbcon4.seq - Constructed sequence entries, part 4.
822. gbcon40.seq - Constructed sequence entries, part 40.
823. gbcon41.seq - Constructed sequence entries, part 41.
824. gbcon42.seq - Constructed sequence entries, part 42.
825. gbcon43.seq - Constructed sequence entries, part 43.
826. gbcon44.seq - Constructed sequence entries, part 44.
827. gbcon45.seq - Constructed sequence entries, part 45.
828. gbcon46.seq - Constructed sequence entries, part 46.
829. gbcon47.seq - Constructed sequence entries, part 47.
830. gbcon48.seq - Constructed sequence entries, part 48.
831. gbcon49.seq - Constructed sequence entries, part 49.
832. gbcon5.seq - Constructed sequence entries, part 5.
833. gbcon50.seq - Constructed sequence entries, part 50.
834. gbcon51.seq - Constructed sequence entries, part 51.
835. gbcon52.seq - Constructed sequence entries, part 52.
836. gbcon53.seq - Constructed sequence entries, part 53.
837. gbcon54.seq - Constructed sequence entries, part 54.
838. gbcon55.seq - Constructed sequence entries, part 55.
839. gbcon56.seq - Constructed sequence entries, part 56.
840. gbcon57.seq - Constructed sequence entries, part 57.
841. gbcon58.seq - Constructed sequence entries, part 58.
842. gbcon59.seq - Constructed sequence entries, part 59.
843. gbcon6.seq - Constructed sequence entries, part 6.
844. gbcon60.seq - Constructed sequence entries, part 60.
845. gbcon61.seq - Constructed sequence entries, part 61.
846. gbcon62.seq - Constructed sequence entries, part 62.
847. gbcon63.seq - Constructed sequence entries, part 63.
848. gbcon64.seq - Constructed sequence entries, part 64.
849. gbcon65.seq - Constructed sequence entries, part 65.
850. gbcon66.seq - Constructed sequence entries, part 66.
851. gbcon67.seq - Constructed sequence entries, part 67.
852. gbcon68.seq - Constructed sequence entries, part 68.
853. gbcon69.seq - Constructed sequence entries, part 69.
854. gbcon7.seq - Constructed sequence entries, part 7.
855. gbcon70.seq - Constructed sequence entries, part 70.
856. gbcon71.seq - Constructed sequence entries, part 71.
857. gbcon72.seq - Constructed sequence entries, part 72.
858. gbcon73.seq - Constructed sequence entries, part 73.
859. gbcon74.seq - Constructed sequence entries, part 74.
860. gbcon75.seq - Constructed sequence entries, part 75.
861. gbcon76.seq - Constructed sequence entries, part 76.
862. gbcon77.seq - Constructed sequence entries, part 77.
863. gbcon78.seq - Constructed sequence entries, part 78.
864. gbcon79.seq - Constructed sequence entries, part 79.
865. gbcon8.seq - Constructed sequence entries, part 8.
866. gbcon80.seq - Constructed sequence entries, part 80.
867. gbcon81.seq - Constructed sequence entries, part 81.
868. gbcon82.seq - Constructed sequence entries, part 82.
869. gbcon83.seq - Constructed sequence entries, part 83.
870. gbcon84.seq - Constructed sequence entries, part 84.
871. gbcon85.seq - Constructed sequence entries, part 85.
872. gbcon86.seq - Constructed sequence entries, part 86.
873. gbcon87.seq - Constructed sequence entries, part 87.
874. gbcon88.seq - Constructed sequence entries, part 88.
875. gbcon89.seq - Constructed sequence entries, part 89.
876. gbcon9.seq - Constructed sequence entries, part 9.
877. gbcon90.seq - Constructed sequence entries, part 90.
878. gbcon91.seq - Constructed sequence entries, part 91.
879. gbcon92.seq - Constructed sequence entries, part 92.
880. gbcon93.seq - Constructed sequence entries, part 93.
881. gbcon94.seq - Constructed sequence entries, part 94.
882. gbcon95.seq - Constructed sequence entries, part 95.
883. gbcon96.seq - Constructed sequence entries, part 96.
884. gbcon97.seq - Constructed sequence entries, part 97.
885. gbcon98.seq - Constructed sequence entries, part 98.
886. gbcon99.seq - Constructed sequence entries, part 99.
887. gbdel.txt - Accession numbers of entries deleted since the previous release.
888. gbenv1.seq - Environmental sampling sequence entries, part 1.
889. gbenv10.seq - Environmental sampling sequence entries, part 10.
890. gbenv11.seq - Environmental sampling sequence entries, part 11.
891. gbenv12.seq - Environmental sampling sequence entries, part 12.
892. gbenv13.seq - Environmental sampling sequence entries, part 13.
893. gbenv14.seq - Environmental sampling sequence entries, part 14.
894. gbenv15.seq - Environmental sampling sequence entries, part 15.
895. gbenv16.seq - Environmental sampling sequence entries, part 16.
896. gbenv17.seq - Environmental sampling sequence entries, part 17.
897. gbenv18.seq - Environmental sampling sequence entries, part 18.
898. gbenv19.seq - Environmental sampling sequence entries, part 19.
899. gbenv2.seq - Environmental sampling sequence entries, part 2.
900. gbenv20.seq - Environmental sampling sequence entries, part 20.
901. gbenv21.seq - Environmental sampling sequence entries, part 21.
902. gbenv22.seq - Environmental sampling sequence entries, part 22.
903. gbenv23.seq - Environmental sampling sequence entries, part 23.
904. gbenv24.seq - Environmental sampling sequence entries, part 24.
905. gbenv25.seq - Environmental sampling sequence entries, part 25.
906. gbenv26.seq - Environmental sampling sequence entries, part 26.
907. gbenv27.seq - Environmental sampling sequence entries, part 27.
908. gbenv28.seq - Environmental sampling sequence entries, part 28.
909. gbenv29.seq - Environmental sampling sequence entries, part 29.
910. gbenv3.seq - Environmental sampling sequence entries, part 3.
911. gbenv30.seq - Environmental sampling sequence entries, part 30.
912. gbenv31.seq - Environmental sampling sequence entries, part 31.
913. gbenv32.seq - Environmental sampling sequence entries, part 32.
914. gbenv33.seq - Environmental sampling sequence entries, part 33.
915. gbenv34.seq - Environmental sampling sequence entries, part 34.
916. gbenv35.seq - Environmental sampling sequence entries, part 35.
917. gbenv36.seq - Environmental sampling sequence entries, part 36.
918. gbenv37.seq - Environmental sampling sequence entries, part 37.
919. gbenv38.seq - Environmental sampling sequence entries, part 38.
920. gbenv39.seq - Environmental sampling sequence entries, part 39.
921. gbenv4.seq - Environmental sampling sequence entries, part 4.
922. gbenv40.seq - Environmental sampling sequence entries, part 40.
923. gbenv41.seq - Environmental sampling sequence entries, part 41.
924. gbenv42.seq - Environmental sampling sequence entries, part 42.
925. gbenv43.seq - Environmental sampling sequence entries, part 43.
926. gbenv44.seq - Environmental sampling sequence entries, part 44.
927. gbenv45.seq - Environmental sampling sequence entries, part 45.
928. gbenv46.seq - Environmental sampling sequence entries, part 46.
929. gbenv47.seq - Environmental sampling sequence entries, part 47.
930. gbenv48.seq - Environmental sampling sequence entries, part 48.
931. gbenv49.seq - Environmental sampling sequence entries, part 49.
932. gbenv5.seq - Environmental sampling sequence entries, part 5.
933. gbenv50.seq - Environmental sampling sequence entries, part 50.
934. gbenv51.seq - Environmental sampling sequence entries, part 51.
935. gbenv52.seq - Environmental sampling sequence entries, part 52.
936. gbenv53.seq - Environmental sampling sequence entries, part 53.
937. gbenv54.seq - Environmental sampling sequence entries, part 54.
938. gbenv55.seq - Environmental sampling sequence entries, part 55.
939. gbenv56.seq - Environmental sampling sequence entries, part 56.
940. gbenv57.seq - Environmental sampling sequence entries, part 57.
941. gbenv58.seq - Environmental sampling sequence entries, part 58.
942. gbenv59.seq - Environmental sampling sequence entries, part 59.
943. gbenv6.seq - Environmental sampling sequence entries, part 6.
944. gbenv60.seq - Environmental sampling sequence entries, part 60.
945. gbenv61.seq - Environmental sampling sequence entries, part 61.
946. gbenv62.seq - Environmental sampling sequence entries, part 62.
947. gbenv63.seq - Environmental sampling sequence entries, part 63.
948. gbenv64.seq - Environmental sampling sequence entries, part 64.
949. gbenv65.seq - Environmental sampling sequence entries, part 65.
950. gbenv66.seq - Environmental sampling sequence entries, part 66.
951. gbenv67.seq - Environmental sampling sequence entries, part 67.
952. gbenv68.seq - Environmental sampling sequence entries, part 68.
953. gbenv69.seq - Environmental sampling sequence entries, part 69.
954. gbenv7.seq - Environmental sampling sequence entries, part 7.
955. gbenv70.seq - Environmental sampling sequence entries, part 70.
956. gbenv8.seq - Environmental sampling sequence entries, part 8.
957. gbenv9.seq - Environmental sampling sequence entries, part 9.
958. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
959. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
960. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
961. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
962. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
963. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
964. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
965. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
966. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
967. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
968. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
969. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
970. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
971. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
972. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
973. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
974. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
975. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
976. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
977. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
978. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
979. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
980. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
981. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
982. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
983. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
984. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
985. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
986. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
987. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
988. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
989. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
990. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
991. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
992. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
993. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
994. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
995. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
996. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
997. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
998. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
999. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
1000. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
1001. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
1002. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
1003. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
1004. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
1005. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
1006. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
1007. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
1008. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
1009. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
1010. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
1011. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
1012. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
1013. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
1014. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
1015. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
1016. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
1017. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
1018. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
1019. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
1020. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
1021. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
1022. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
1023. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
1024. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
1025. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
1026. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
1027. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
1028. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
1029. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
1030. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
1031. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
1032. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
1033. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
1034. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
1035. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
1036. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
1037. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
1038. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
1039. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
1040. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
1041. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
1042. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
1043. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
1044. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
1045. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
1046. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
1047. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
1048. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
1049. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
1050. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
1051. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
1052. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
1053. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
1054. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
1055. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
1056. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
1057. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
1058. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
1059. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
1060. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
1061. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
1062. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
1063. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
1064. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
1065. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
1066. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
1067. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
1068. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
1069. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
1070. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
1071. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
1072. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
1073. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
1074. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
1075. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
1076. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
1077. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
1078. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
1079. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
1080. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
1081. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
1082. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
1083. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
1084. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
1085. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
1086. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
1087. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
1088. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
1089. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
1090. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
1091. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
1092. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
1093. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
1094. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
1095. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
1096. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
1097. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
1098. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
1099. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
1100. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
1101. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
1102. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
1103. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
1104. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
1105. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
1106. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
1107. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
1108. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
1109. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
1110. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
1111. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
1112. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
1113. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
1114. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
1115. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
1116. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
1117. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
1118. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
1119. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
1120. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
1121. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
1122. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
1123. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
1124. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
1125. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
1126. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
1127. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
1128. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
1129. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
1130. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
1131. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
1132. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
1133. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
1134. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
1135. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
1136. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
1137. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
1138. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
1139. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
1140. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
1141. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
1142. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
1143. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
1144. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
1145. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
1146. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
1147. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
1148. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
1149. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
1150. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
1151. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
1152. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
1153. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
1154. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
1155. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
1156. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
1157. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
1158. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
1159. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
1160. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
1161. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
1162. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1163. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1164. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1165. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1166. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1167. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1168. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1169. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1170. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1171. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1172. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1173. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1174. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1175. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1176. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1177. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1178. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1179. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1180. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1181. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1182. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1183. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1184. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1185. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1186. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1187. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1188. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1189. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1190. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1191. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1192. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1193. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1194. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1195. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1196. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1197. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1198. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1199. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1200. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1201. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1202. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1203. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1204. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1205. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1206. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1207. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1208. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1209. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1210. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1211. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1212. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1213. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1214. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1215. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1216. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1217. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1218. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1219. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1220. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1221. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1222. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1223. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1224. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1225. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1226. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1227. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1228. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1229. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1230. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1231. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1232. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1233. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1234. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1235. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1236. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1237. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1238. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1239. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1240. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1241. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1242. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1243. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1244. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1245. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1246. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1247. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1248. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1249. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1250. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1251. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1252. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1253. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1254. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1255. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1256. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1257. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1258. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1259. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1260. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1261. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1262. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1263. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1264. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1265. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1266. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1267. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1268. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1269. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1270. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1271. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1272. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1273. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1274. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1275. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1276. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1277. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1278. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1279. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1280. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1281. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1282. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1283. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1284. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1285. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1286. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1287. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1288. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1289. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1290. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1291. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1292. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1293. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1294. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1295. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1296. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1297. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1298. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1299. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1300. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1301. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1302. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1303. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1304. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1305. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1306. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1307. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1308. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1309. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1310. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1311. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1312. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1313. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1314. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1315. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1316. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1317. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1318. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1319. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1320. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1321. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1322. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1323. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1324. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1325. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1326. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1327. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1328. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1329. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1330. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1331. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1332. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1333. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1334. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1335. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1336. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1337. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1338. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1339. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1340. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1341. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1342. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1343. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1344. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1345. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1346. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1347. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1348. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1349. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1350. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1351. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1352. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1353. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1354. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1355. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1356. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1357. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1358. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1359. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1360. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1361. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1362. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1363. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1364. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1365. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1366. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1367. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1368. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1369. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1370. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1371. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1372. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1373. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1374. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1375. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1376. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1377. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1378. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1379. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1380. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1381. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1382. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1383. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1384. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1385. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1386. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1387. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
1388. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
1389. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
1390. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
1391. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1392. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
1393. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
1394. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
1395. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
1396. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
1397. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
1398. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
1399. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
1400. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
1401. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
1402. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1403. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1404. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
1405. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
1406. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
1407. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
1408. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
1409. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
1410. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
1411. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
1412. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
1413. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
1414. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1415. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
1416. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
1417. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
1418. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
1419. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
1420. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
1421. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
1422. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
1423. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
1424. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
1425. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1426. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
1427. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
1428. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
1429. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
1430. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
1431. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
1432. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
1433. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
1434. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
1435. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
1436. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1437. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
1438. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
1439. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
1440. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
1441. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
1442. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
1443. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
1444. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
1445. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
1446. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
1447. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1448. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
1449. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
1450. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
1451. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
1452. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
1453. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
1454. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
1455. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
1456. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
1457. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
1458. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1459. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
1460. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
1461. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
1462. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
1463. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
1464. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
1465. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
1466. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
1467. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
1468. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
1469. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1470. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
1471. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
1472. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
1473. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
1474. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
1475. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
1476. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
1477. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
1478. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
1479. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
1480. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1481. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
1482. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
1483. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
1484. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
1485. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
1486. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
1487. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1488. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1489. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1490. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1491. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1492. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1493. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1494. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1495. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1496. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1497. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1498. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1499. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1500. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1501. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1502. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1503. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1504. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1505. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1506. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1507. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1508. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1509. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1510. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1511. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1512. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1513. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1514. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1515. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1516. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1517. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1518. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1519. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1520. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1521. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1522. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1523. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1524. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1525. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1526. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1527. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1528. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1529. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1530. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1531. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1532. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1533. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1534. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1535. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1536. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1537. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1538. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1539. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1540. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1541. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1542. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1543. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1544. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1545. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1546. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1547. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1548. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1549. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1550. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1551. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1552. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1553. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1554. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1555. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1556. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1557. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1558. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1559. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1560. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1561. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1562. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1563. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1564. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1565. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1566. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1567. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1568. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1569. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1570. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1571. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1572. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1573. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1574. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1575. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1576. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1577. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1578. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1579. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1580. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1581. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1582. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1583. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1584. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1585. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1586. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1587. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1588. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1589. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1590. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1591. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1592. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1593. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1594. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1595. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1596. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1597. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1598. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1599. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1600. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1601. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1602. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1603. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1604. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1605. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1606. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1607. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1608. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1609. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1610. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1611. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1612. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1613. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1614. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1615. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1616. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1617. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1618. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1619. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1620. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1621. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1622. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1623. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1624. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1625. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1626. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1627. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1628. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1629. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1630. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1631. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1632. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1633. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1634. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1635. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1636. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1637. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1638. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1639. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1640. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1641. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1642. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1643. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1644. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1645. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1646. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1647. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1648. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1649. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1650. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1651. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1652. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1653. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1654. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1655. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1656. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1657. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1658. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1659. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1660. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1661. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1662. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1663. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1664. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1665. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1666. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1667. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1668. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1669. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1670. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1671. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1672. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1673. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1674. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1675. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1676. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1677. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1678. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1679. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1680. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1681. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1682. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1683. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1684. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1685. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1686. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1687. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1688. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1689. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1690. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1691. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1692. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1693. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1694. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1695. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1696. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1697. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1698. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1699. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1700. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1701. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1702. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1703. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1704. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1705. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1706. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1707. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1708. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1709. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1710. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1711. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1712. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1713. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1714. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1715. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1716. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1717. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1718. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1719. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1720. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1721. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1722. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1723. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1724. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1725. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1726. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1727. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1728. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1729. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1730. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1731. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1732. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1733. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1734. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1735. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1736. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1737. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1738. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1739. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1740. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1741. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1742. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1743. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1744. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1745. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1746. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1747. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1748. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1749. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1750. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1751. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1752. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1753. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1754. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1755. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1756. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1757. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1758. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1759. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1760. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1761. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1762. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1763. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1764. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1765. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1766. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1767. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1768. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1769. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1770. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1771. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1772. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1773. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1774. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1775. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1776. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1777. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1778. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1779. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1780. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1781. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1782. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1783. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1784. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1785. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1786. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1787. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1788. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1789. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1790. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1791. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1792. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1793. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1794. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1795. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1796. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1797. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1798. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1799. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1800. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1801. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1802. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1803. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1804. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1805. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1806. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1807. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1808. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1809. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1810. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1811. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1812. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1813. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1814. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1815. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1816. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1817. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1818. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1819. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1820. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1821. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1822. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1823. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1824. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1825. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1826. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1827. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1828. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1829. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1830. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1831. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1832. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1833. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1834. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1835. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1836. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1837. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1838. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1839. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1840. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1841. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1842. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1843. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1844. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1845. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1846. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1847. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1848. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1849. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1850. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1851. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1852. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1853. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1854. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1855. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1856. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1857. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1858. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1859. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1860. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1861. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1862. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1863. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1864. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1865. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1866. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1867. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1868. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1869. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1870. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1871. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1872. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1873. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1874. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1875. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1876. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1877. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1878. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1879. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1880. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1881. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1882. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1883. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1884. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1885. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1886. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1887. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1888. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1889. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1890. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1891. gbinv1.seq - Invertebrate sequence entries, part 1.
1892. gbinv10.seq - Invertebrate sequence entries, part 10.
1893. gbinv100.seq - Invertebrate sequence entries, part 100.
1894. gbinv101.seq - Invertebrate sequence entries, part 101.
1895. gbinv102.seq - Invertebrate sequence entries, part 102.
1896. gbinv103.seq - Invertebrate sequence entries, part 103.
1897. gbinv104.seq - Invertebrate sequence entries, part 104.
1898. gbinv105.seq - Invertebrate sequence entries, part 105.
1899. gbinv106.seq - Invertebrate sequence entries, part 106.
1900. gbinv107.seq - Invertebrate sequence entries, part 107.
1901. gbinv108.seq - Invertebrate sequence entries, part 108.
1902. gbinv109.seq - Invertebrate sequence entries, part 109.
1903. gbinv11.seq - Invertebrate sequence entries, part 11.
1904. gbinv110.seq - Invertebrate sequence entries, part 110.
1905. gbinv111.seq - Invertebrate sequence entries, part 111.
1906. gbinv112.seq - Invertebrate sequence entries, part 112.
1907. gbinv113.seq - Invertebrate sequence entries, part 113.
1908. gbinv114.seq - Invertebrate sequence entries, part 114.
1909. gbinv115.seq - Invertebrate sequence entries, part 115.
1910. gbinv116.seq - Invertebrate sequence entries, part 116.
1911. gbinv117.seq - Invertebrate sequence entries, part 117.
1912. gbinv118.seq - Invertebrate sequence entries, part 118.
1913. gbinv119.seq - Invertebrate sequence entries, part 119.
1914. gbinv12.seq - Invertebrate sequence entries, part 12.
1915. gbinv120.seq - Invertebrate sequence entries, part 120.
1916. gbinv121.seq - Invertebrate sequence entries, part 121.
1917. gbinv122.seq - Invertebrate sequence entries, part 122.
1918. gbinv123.seq - Invertebrate sequence entries, part 123.
1919. gbinv124.seq - Invertebrate sequence entries, part 124.
1920. gbinv125.seq - Invertebrate sequence entries, part 125.
1921. gbinv126.seq - Invertebrate sequence entries, part 126.
1922. gbinv127.seq - Invertebrate sequence entries, part 127.
1923. gbinv128.seq - Invertebrate sequence entries, part 128.
1924. gbinv129.seq - Invertebrate sequence entries, part 129.
1925. gbinv13.seq - Invertebrate sequence entries, part 13.
1926. gbinv130.seq - Invertebrate sequence entries, part 130.
1927. gbinv131.seq - Invertebrate sequence entries, part 131.
1928. gbinv132.seq - Invertebrate sequence entries, part 132.
1929. gbinv133.seq - Invertebrate sequence entries, part 133.
1930. gbinv134.seq - Invertebrate sequence entries, part 134.
1931. gbinv135.seq - Invertebrate sequence entries, part 135.
1932. gbinv136.seq - Invertebrate sequence entries, part 136.
1933. gbinv137.seq - Invertebrate sequence entries, part 137.
1934. gbinv138.seq - Invertebrate sequence entries, part 138.
1935. gbinv139.seq - Invertebrate sequence entries, part 139.
1936. gbinv14.seq - Invertebrate sequence entries, part 14.
1937. gbinv140.seq - Invertebrate sequence entries, part 140.
1938. gbinv141.seq - Invertebrate sequence entries, part 141.
1939. gbinv142.seq - Invertebrate sequence entries, part 142.
1940. gbinv143.seq - Invertebrate sequence entries, part 143.
1941. gbinv144.seq - Invertebrate sequence entries, part 144.
1942. gbinv145.seq - Invertebrate sequence entries, part 145.
1943. gbinv146.seq - Invertebrate sequence entries, part 146.
1944. gbinv147.seq - Invertebrate sequence entries, part 147.
1945. gbinv148.seq - Invertebrate sequence entries, part 148.
1946. gbinv149.seq - Invertebrate sequence entries, part 149.
1947. gbinv15.seq - Invertebrate sequence entries, part 15.
1948. gbinv150.seq - Invertebrate sequence entries, part 150.
1949. gbinv151.seq - Invertebrate sequence entries, part 151.
1950. gbinv152.seq - Invertebrate sequence entries, part 152.
1951. gbinv153.seq - Invertebrate sequence entries, part 153.
1952. gbinv154.seq - Invertebrate sequence entries, part 154.
1953. gbinv155.seq - Invertebrate sequence entries, part 155.
1954. gbinv156.seq - Invertebrate sequence entries, part 156.
1955. gbinv157.seq - Invertebrate sequence entries, part 157.
1956. gbinv158.seq - Invertebrate sequence entries, part 158.
1957. gbinv159.seq - Invertebrate sequence entries, part 159.
1958. gbinv16.seq - Invertebrate sequence entries, part 16.
1959. gbinv160.seq - Invertebrate sequence entries, part 160.
1960. gbinv161.seq - Invertebrate sequence entries, part 161.
1961. gbinv162.seq - Invertebrate sequence entries, part 162.
1962. gbinv163.seq - Invertebrate sequence entries, part 163.
1963. gbinv164.seq - Invertebrate sequence entries, part 164.
1964. gbinv165.seq - Invertebrate sequence entries, part 165.
1965. gbinv166.seq - Invertebrate sequence entries, part 166.
1966. gbinv167.seq - Invertebrate sequence entries, part 167.
1967. gbinv168.seq - Invertebrate sequence entries, part 168.
1968. gbinv169.seq - Invertebrate sequence entries, part 169.
1969. gbinv17.seq - Invertebrate sequence entries, part 17.
1970. gbinv170.seq - Invertebrate sequence entries, part 170.
1971. gbinv171.seq - Invertebrate sequence entries, part 171.
1972. gbinv172.seq - Invertebrate sequence entries, part 172.
1973. gbinv173.seq - Invertebrate sequence entries, part 173.
1974. gbinv174.seq - Invertebrate sequence entries, part 174.
1975. gbinv175.seq - Invertebrate sequence entries, part 175.
1976. gbinv176.seq - Invertebrate sequence entries, part 176.
1977. gbinv177.seq - Invertebrate sequence entries, part 177.
1978. gbinv178.seq - Invertebrate sequence entries, part 178.
1979. gbinv179.seq - Invertebrate sequence entries, part 179.
1980. gbinv18.seq - Invertebrate sequence entries, part 18.
1981. gbinv180.seq - Invertebrate sequence entries, part 180.
1982. gbinv181.seq - Invertebrate sequence entries, part 181.
1983. gbinv182.seq - Invertebrate sequence entries, part 182.
1984. gbinv183.seq - Invertebrate sequence entries, part 183.
1985. gbinv184.seq - Invertebrate sequence entries, part 184.
1986. gbinv185.seq - Invertebrate sequence entries, part 185.
1987. gbinv186.seq - Invertebrate sequence entries, part 186.
1988. gbinv187.seq - Invertebrate sequence entries, part 187.
1989. gbinv188.seq - Invertebrate sequence entries, part 188.
1990. gbinv189.seq - Invertebrate sequence entries, part 189.
1991. gbinv19.seq - Invertebrate sequence entries, part 19.
1992. gbinv190.seq - Invertebrate sequence entries, part 190.
1993. gbinv191.seq - Invertebrate sequence entries, part 191.
1994. gbinv192.seq - Invertebrate sequence entries, part 192.
1995. gbinv193.seq - Invertebrate sequence entries, part 193.
1996. gbinv194.seq - Invertebrate sequence entries, part 194.
1997. gbinv195.seq - Invertebrate sequence entries, part 195.
1998. gbinv196.seq - Invertebrate sequence entries, part 196.
1999. gbinv197.seq - Invertebrate sequence entries, part 197.
2000. gbinv198.seq - Invertebrate sequence entries, part 198.
2001. gbinv199.seq - Invertebrate sequence entries, part 199.
2002. gbinv2.seq - Invertebrate sequence entries, part 2.
2003. gbinv20.seq - Invertebrate sequence entries, part 20.
2004. gbinv200.seq - Invertebrate sequence entries, part 200.
2005. gbinv201.seq - Invertebrate sequence entries, part 201.
2006. gbinv202.seq - Invertebrate sequence entries, part 202.
2007. gbinv203.seq - Invertebrate sequence entries, part 203.
2008. gbinv204.seq - Invertebrate sequence entries, part 204.
2009. gbinv205.seq - Invertebrate sequence entries, part 205.
2010. gbinv206.seq - Invertebrate sequence entries, part 206.
2011. gbinv207.seq - Invertebrate sequence entries, part 207.
2012. gbinv208.seq - Invertebrate sequence entries, part 208.
2013. gbinv209.seq - Invertebrate sequence entries, part 209.
2014. gbinv21.seq - Invertebrate sequence entries, part 21.
2015. gbinv210.seq - Invertebrate sequence entries, part 210.
2016. gbinv211.seq - Invertebrate sequence entries, part 211.
2017. gbinv212.seq - Invertebrate sequence entries, part 212.
2018. gbinv213.seq - Invertebrate sequence entries, part 213.
2019. gbinv214.seq - Invertebrate sequence entries, part 214.
2020. gbinv215.seq - Invertebrate sequence entries, part 215.
2021. gbinv216.seq - Invertebrate sequence entries, part 216.
2022. gbinv217.seq - Invertebrate sequence entries, part 217.
2023. gbinv218.seq - Invertebrate sequence entries, part 218.
2024. gbinv219.seq - Invertebrate sequence entries, part 219.
2025. gbinv22.seq - Invertebrate sequence entries, part 22.
2026. gbinv220.seq - Invertebrate sequence entries, part 220.
2027. gbinv221.seq - Invertebrate sequence entries, part 221.
2028. gbinv222.seq - Invertebrate sequence entries, part 222.
2029. gbinv223.seq - Invertebrate sequence entries, part 223.
2030. gbinv224.seq - Invertebrate sequence entries, part 224.
2031. gbinv225.seq - Invertebrate sequence entries, part 225.
2032. gbinv226.seq - Invertebrate sequence entries, part 226.
2033. gbinv227.seq - Invertebrate sequence entries, part 227.
2034. gbinv228.seq - Invertebrate sequence entries, part 228.
2035. gbinv229.seq - Invertebrate sequence entries, part 229.
2036. gbinv23.seq - Invertebrate sequence entries, part 23.
2037. gbinv230.seq - Invertebrate sequence entries, part 230.
2038. gbinv231.seq - Invertebrate sequence entries, part 231.
2039. gbinv232.seq - Invertebrate sequence entries, part 232.
2040. gbinv233.seq - Invertebrate sequence entries, part 233.
2041. gbinv234.seq - Invertebrate sequence entries, part 234.
2042. gbinv235.seq - Invertebrate sequence entries, part 235.
2043. gbinv236.seq - Invertebrate sequence entries, part 236.
2044. gbinv237.seq - Invertebrate sequence entries, part 237.
2045. gbinv238.seq - Invertebrate sequence entries, part 238.
2046. gbinv239.seq - Invertebrate sequence entries, part 239.
2047. gbinv24.seq - Invertebrate sequence entries, part 24.
2048. gbinv240.seq - Invertebrate sequence entries, part 240.
2049. gbinv241.seq - Invertebrate sequence entries, part 241.
2050. gbinv242.seq - Invertebrate sequence entries, part 242.
2051. gbinv243.seq - Invertebrate sequence entries, part 243.
2052. gbinv244.seq - Invertebrate sequence entries, part 244.
2053. gbinv245.seq - Invertebrate sequence entries, part 245.
2054. gbinv246.seq - Invertebrate sequence entries, part 246.
2055. gbinv247.seq - Invertebrate sequence entries, part 247.
2056. gbinv248.seq - Invertebrate sequence entries, part 248.
2057. gbinv249.seq - Invertebrate sequence entries, part 249.
2058. gbinv25.seq - Invertebrate sequence entries, part 25.
2059. gbinv250.seq - Invertebrate sequence entries, part 250.
2060. gbinv251.seq - Invertebrate sequence entries, part 251.
2061. gbinv252.seq - Invertebrate sequence entries, part 252.
2062. gbinv253.seq - Invertebrate sequence entries, part 253.
2063. gbinv254.seq - Invertebrate sequence entries, part 254.
2064. gbinv255.seq - Invertebrate sequence entries, part 255.
2065. gbinv256.seq - Invertebrate sequence entries, part 256.
2066. gbinv257.seq - Invertebrate sequence entries, part 257.
2067. gbinv258.seq - Invertebrate sequence entries, part 258.
2068. gbinv259.seq - Invertebrate sequence entries, part 259.
2069. gbinv26.seq - Invertebrate sequence entries, part 26.
2070. gbinv260.seq - Invertebrate sequence entries, part 260.
2071. gbinv261.seq - Invertebrate sequence entries, part 261.
2072. gbinv262.seq - Invertebrate sequence entries, part 262.
2073. gbinv263.seq - Invertebrate sequence entries, part 263.
2074. gbinv264.seq - Invertebrate sequence entries, part 264.
2075. gbinv265.seq - Invertebrate sequence entries, part 265.
2076. gbinv266.seq - Invertebrate sequence entries, part 266.
2077. gbinv267.seq - Invertebrate sequence entries, part 267.
2078. gbinv268.seq - Invertebrate sequence entries, part 268.
2079. gbinv269.seq - Invertebrate sequence entries, part 269.
2080. gbinv27.seq - Invertebrate sequence entries, part 27.
2081. gbinv270.seq - Invertebrate sequence entries, part 270.
2082. gbinv271.seq - Invertebrate sequence entries, part 271.
2083. gbinv272.seq - Invertebrate sequence entries, part 272.
2084. gbinv273.seq - Invertebrate sequence entries, part 273.
2085. gbinv274.seq - Invertebrate sequence entries, part 274.
2086. gbinv275.seq - Invertebrate sequence entries, part 275.
2087. gbinv276.seq - Invertebrate sequence entries, part 276.
2088. gbinv277.seq - Invertebrate sequence entries, part 277.
2089. gbinv278.seq - Invertebrate sequence entries, part 278.
2090. gbinv279.seq - Invertebrate sequence entries, part 279.
2091. gbinv28.seq - Invertebrate sequence entries, part 28.
2092. gbinv280.seq - Invertebrate sequence entries, part 280.
2093. gbinv281.seq - Invertebrate sequence entries, part 281.
2094. gbinv282.seq - Invertebrate sequence entries, part 282.
2095. gbinv283.seq - Invertebrate sequence entries, part 283.
2096. gbinv284.seq - Invertebrate sequence entries, part 284.
2097. gbinv285.seq - Invertebrate sequence entries, part 285.
2098. gbinv286.seq - Invertebrate sequence entries, part 286.
2099. gbinv287.seq - Invertebrate sequence entries, part 287.
2100. gbinv288.seq - Invertebrate sequence entries, part 288.
2101. gbinv289.seq - Invertebrate sequence entries, part 289.
2102. gbinv29.seq - Invertebrate sequence entries, part 29.
2103. gbinv290.seq - Invertebrate sequence entries, part 290.
2104. gbinv291.seq - Invertebrate sequence entries, part 291.
2105. gbinv292.seq - Invertebrate sequence entries, part 292.
2106. gbinv293.seq - Invertebrate sequence entries, part 293.
2107. gbinv294.seq - Invertebrate sequence entries, part 294.
2108. gbinv295.seq - Invertebrate sequence entries, part 295.
2109. gbinv296.seq - Invertebrate sequence entries, part 296.
2110. gbinv297.seq - Invertebrate sequence entries, part 297.
2111. gbinv298.seq - Invertebrate sequence entries, part 298.
2112. gbinv299.seq - Invertebrate sequence entries, part 299.
2113. gbinv3.seq - Invertebrate sequence entries, part 3.
2114. gbinv30.seq - Invertebrate sequence entries, part 30.
2115. gbinv300.seq - Invertebrate sequence entries, part 300.
2116. gbinv301.seq - Invertebrate sequence entries, part 301.
2117. gbinv302.seq - Invertebrate sequence entries, part 302.
2118. gbinv303.seq - Invertebrate sequence entries, part 303.
2119. gbinv304.seq - Invertebrate sequence entries, part 304.
2120. gbinv305.seq - Invertebrate sequence entries, part 305.
2121. gbinv306.seq - Invertebrate sequence entries, part 306.
2122. gbinv307.seq - Invertebrate sequence entries, part 307.
2123. gbinv308.seq - Invertebrate sequence entries, part 308.
2124. gbinv309.seq - Invertebrate sequence entries, part 309.
2125. gbinv31.seq - Invertebrate sequence entries, part 31.
2126. gbinv310.seq - Invertebrate sequence entries, part 310.
2127. gbinv311.seq - Invertebrate sequence entries, part 311.
2128. gbinv312.seq - Invertebrate sequence entries, part 312.
2129. gbinv313.seq - Invertebrate sequence entries, part 313.
2130. gbinv314.seq - Invertebrate sequence entries, part 314.
2131. gbinv315.seq - Invertebrate sequence entries, part 315.
2132. gbinv316.seq - Invertebrate sequence entries, part 316.
2133. gbinv317.seq - Invertebrate sequence entries, part 317.
2134. gbinv318.seq - Invertebrate sequence entries, part 318.
2135. gbinv319.seq - Invertebrate sequence entries, part 319.
2136. gbinv32.seq - Invertebrate sequence entries, part 32.
2137. gbinv320.seq - Invertebrate sequence entries, part 320.
2138. gbinv321.seq - Invertebrate sequence entries, part 321.
2139. gbinv322.seq - Invertebrate sequence entries, part 322.
2140. gbinv323.seq - Invertebrate sequence entries, part 323.
2141. gbinv324.seq - Invertebrate sequence entries, part 324.
2142. gbinv325.seq - Invertebrate sequence entries, part 325.
2143. gbinv326.seq - Invertebrate sequence entries, part 326.
2144. gbinv327.seq - Invertebrate sequence entries, part 327.
2145. gbinv328.seq - Invertebrate sequence entries, part 328.
2146. gbinv329.seq - Invertebrate sequence entries, part 329.
2147. gbinv33.seq - Invertebrate sequence entries, part 33.
2148. gbinv330.seq - Invertebrate sequence entries, part 330.
2149. gbinv331.seq - Invertebrate sequence entries, part 331.
2150. gbinv332.seq - Invertebrate sequence entries, part 332.
2151. gbinv333.seq - Invertebrate sequence entries, part 333.
2152. gbinv334.seq - Invertebrate sequence entries, part 334.
2153. gbinv335.seq - Invertebrate sequence entries, part 335.
2154. gbinv336.seq - Invertebrate sequence entries, part 336.
2155. gbinv337.seq - Invertebrate sequence entries, part 337.
2156. gbinv338.seq - Invertebrate sequence entries, part 338.
2157. gbinv339.seq - Invertebrate sequence entries, part 339.
2158. gbinv34.seq - Invertebrate sequence entries, part 34.
2159. gbinv340.seq - Invertebrate sequence entries, part 340.
2160. gbinv341.seq - Invertebrate sequence entries, part 341.
2161. gbinv342.seq - Invertebrate sequence entries, part 342.
2162. gbinv343.seq - Invertebrate sequence entries, part 343.
2163. gbinv344.seq - Invertebrate sequence entries, part 344.
2164. gbinv345.seq - Invertebrate sequence entries, part 345.
2165. gbinv346.seq - Invertebrate sequence entries, part 346.
2166. gbinv347.seq - Invertebrate sequence entries, part 347.
2167. gbinv348.seq - Invertebrate sequence entries, part 348.
2168. gbinv349.seq - Invertebrate sequence entries, part 349.
2169. gbinv35.seq - Invertebrate sequence entries, part 35.
2170. gbinv350.seq - Invertebrate sequence entries, part 350.
2171. gbinv351.seq - Invertebrate sequence entries, part 351.
2172. gbinv352.seq - Invertebrate sequence entries, part 352.
2173. gbinv353.seq - Invertebrate sequence entries, part 353.
2174. gbinv354.seq - Invertebrate sequence entries, part 354.
2175. gbinv355.seq - Invertebrate sequence entries, part 355.
2176. gbinv356.seq - Invertebrate sequence entries, part 356.
2177. gbinv357.seq - Invertebrate sequence entries, part 357.
2178. gbinv358.seq - Invertebrate sequence entries, part 358.
2179. gbinv359.seq - Invertebrate sequence entries, part 359.
2180. gbinv36.seq - Invertebrate sequence entries, part 36.
2181. gbinv360.seq - Invertebrate sequence entries, part 360.
2182. gbinv361.seq - Invertebrate sequence entries, part 361.
2183. gbinv362.seq - Invertebrate sequence entries, part 362.
2184. gbinv363.seq - Invertebrate sequence entries, part 363.
2185. gbinv364.seq - Invertebrate sequence entries, part 364.
2186. gbinv365.seq - Invertebrate sequence entries, part 365.
2187. gbinv366.seq - Invertebrate sequence entries, part 366.
2188. gbinv367.seq - Invertebrate sequence entries, part 367.
2189. gbinv368.seq - Invertebrate sequence entries, part 368.
2190. gbinv369.seq - Invertebrate sequence entries, part 369.
2191. gbinv37.seq - Invertebrate sequence entries, part 37.
2192. gbinv370.seq - Invertebrate sequence entries, part 370.
2193. gbinv371.seq - Invertebrate sequence entries, part 371.
2194. gbinv372.seq - Invertebrate sequence entries, part 372.
2195. gbinv373.seq - Invertebrate sequence entries, part 373.
2196. gbinv374.seq - Invertebrate sequence entries, part 374.
2197. gbinv375.seq - Invertebrate sequence entries, part 375.
2198. gbinv376.seq - Invertebrate sequence entries, part 376.
2199. gbinv377.seq - Invertebrate sequence entries, part 377.
2200. gbinv378.seq - Invertebrate sequence entries, part 378.
2201. gbinv379.seq - Invertebrate sequence entries, part 379.
2202. gbinv38.seq - Invertebrate sequence entries, part 38.
2203. gbinv380.seq - Invertebrate sequence entries, part 380.
2204. gbinv381.seq - Invertebrate sequence entries, part 381.
2205. gbinv382.seq - Invertebrate sequence entries, part 382.
2206. gbinv383.seq - Invertebrate sequence entries, part 383.
2207. gbinv384.seq - Invertebrate sequence entries, part 384.
2208. gbinv385.seq - Invertebrate sequence entries, part 385.
2209. gbinv386.seq - Invertebrate sequence entries, part 386.
2210. gbinv387.seq - Invertebrate sequence entries, part 387.
2211. gbinv388.seq - Invertebrate sequence entries, part 388.
2212. gbinv389.seq - Invertebrate sequence entries, part 389.
2213. gbinv39.seq - Invertebrate sequence entries, part 39.
2214. gbinv390.seq - Invertebrate sequence entries, part 390.
2215. gbinv391.seq - Invertebrate sequence entries, part 391.
2216. gbinv392.seq - Invertebrate sequence entries, part 392.
2217. gbinv393.seq - Invertebrate sequence entries, part 393.
2218. gbinv394.seq - Invertebrate sequence entries, part 394.
2219. gbinv395.seq - Invertebrate sequence entries, part 395.
2220. gbinv396.seq - Invertebrate sequence entries, part 396.
2221. gbinv397.seq - Invertebrate sequence entries, part 397.
2222. gbinv398.seq - Invertebrate sequence entries, part 398.
2223. gbinv399.seq - Invertebrate sequence entries, part 399.
2224. gbinv4.seq - Invertebrate sequence entries, part 4.
2225. gbinv40.seq - Invertebrate sequence entries, part 40.
2226. gbinv400.seq - Invertebrate sequence entries, part 400.
2227. gbinv401.seq - Invertebrate sequence entries, part 401.
2228. gbinv402.seq - Invertebrate sequence entries, part 402.
2229. gbinv403.seq - Invertebrate sequence entries, part 403.
2230. gbinv404.seq - Invertebrate sequence entries, part 404.
2231. gbinv405.seq - Invertebrate sequence entries, part 405.
2232. gbinv406.seq - Invertebrate sequence entries, part 406.
2233. gbinv407.seq - Invertebrate sequence entries, part 407.
2234. gbinv408.seq - Invertebrate sequence entries, part 408.
2235. gbinv409.seq - Invertebrate sequence entries, part 409.
2236. gbinv41.seq - Invertebrate sequence entries, part 41.
2237. gbinv410.seq - Invertebrate sequence entries, part 410.
2238. gbinv411.seq - Invertebrate sequence entries, part 411.
2239. gbinv412.seq - Invertebrate sequence entries, part 412.
2240. gbinv413.seq - Invertebrate sequence entries, part 413.
2241. gbinv414.seq - Invertebrate sequence entries, part 414.
2242. gbinv415.seq - Invertebrate sequence entries, part 415.
2243. gbinv416.seq - Invertebrate sequence entries, part 416.
2244. gbinv417.seq - Invertebrate sequence entries, part 417.
2245. gbinv418.seq - Invertebrate sequence entries, part 418.
2246. gbinv419.seq - Invertebrate sequence entries, part 419.
2247. gbinv42.seq - Invertebrate sequence entries, part 42.
2248. gbinv420.seq - Invertebrate sequence entries, part 420.
2249. gbinv421.seq - Invertebrate sequence entries, part 421.
2250. gbinv422.seq - Invertebrate sequence entries, part 422.
2251. gbinv423.seq - Invertebrate sequence entries, part 423.
2252. gbinv424.seq - Invertebrate sequence entries, part 424.
2253. gbinv425.seq - Invertebrate sequence entries, part 425.
2254. gbinv426.seq - Invertebrate sequence entries, part 426.
2255. gbinv427.seq - Invertebrate sequence entries, part 427.
2256. gbinv428.seq - Invertebrate sequence entries, part 428.
2257. gbinv429.seq - Invertebrate sequence entries, part 429.
2258. gbinv43.seq - Invertebrate sequence entries, part 43.
2259. gbinv430.seq - Invertebrate sequence entries, part 430.
2260. gbinv431.seq - Invertebrate sequence entries, part 431.
2261. gbinv432.seq - Invertebrate sequence entries, part 432.
2262. gbinv433.seq - Invertebrate sequence entries, part 433.
2263. gbinv434.seq - Invertebrate sequence entries, part 434.
2264. gbinv435.seq - Invertebrate sequence entries, part 435.
2265. gbinv436.seq - Invertebrate sequence entries, part 436.
2266. gbinv437.seq - Invertebrate sequence entries, part 437.
2267. gbinv438.seq - Invertebrate sequence entries, part 438.
2268. gbinv439.seq - Invertebrate sequence entries, part 439.
2269. gbinv44.seq - Invertebrate sequence entries, part 44.
2270. gbinv440.seq - Invertebrate sequence entries, part 440.
2271. gbinv441.seq - Invertebrate sequence entries, part 441.
2272. gbinv442.seq - Invertebrate sequence entries, part 442.
2273. gbinv443.seq - Invertebrate sequence entries, part 443.
2274. gbinv444.seq - Invertebrate sequence entries, part 444.
2275. gbinv445.seq - Invertebrate sequence entries, part 445.
2276. gbinv446.seq - Invertebrate sequence entries, part 446.
2277. gbinv447.seq - Invertebrate sequence entries, part 447.
2278. gbinv448.seq - Invertebrate sequence entries, part 448.
2279. gbinv449.seq - Invertebrate sequence entries, part 449.
2280. gbinv45.seq - Invertebrate sequence entries, part 45.
2281. gbinv450.seq - Invertebrate sequence entries, part 450.
2282. gbinv451.seq - Invertebrate sequence entries, part 451.
2283. gbinv452.seq - Invertebrate sequence entries, part 452.
2284. gbinv453.seq - Invertebrate sequence entries, part 453.
2285. gbinv454.seq - Invertebrate sequence entries, part 454.
2286. gbinv455.seq - Invertebrate sequence entries, part 455.
2287. gbinv456.seq - Invertebrate sequence entries, part 456.
2288. gbinv457.seq - Invertebrate sequence entries, part 457.
2289. gbinv458.seq - Invertebrate sequence entries, part 458.
2290. gbinv459.seq - Invertebrate sequence entries, part 459.
2291. gbinv46.seq - Invertebrate sequence entries, part 46.
2292. gbinv460.seq - Invertebrate sequence entries, part 460.
2293. gbinv461.seq - Invertebrate sequence entries, part 461.
2294. gbinv47.seq - Invertebrate sequence entries, part 47.
2295. gbinv48.seq - Invertebrate sequence entries, part 48.
2296. gbinv49.seq - Invertebrate sequence entries, part 49.
2297. gbinv5.seq - Invertebrate sequence entries, part 5.
2298. gbinv50.seq - Invertebrate sequence entries, part 50.
2299. gbinv51.seq - Invertebrate sequence entries, part 51.
2300. gbinv52.seq - Invertebrate sequence entries, part 52.
2301. gbinv53.seq - Invertebrate sequence entries, part 53.
2302. gbinv54.seq - Invertebrate sequence entries, part 54.
2303. gbinv55.seq - Invertebrate sequence entries, part 55.
2304. gbinv56.seq - Invertebrate sequence entries, part 56.
2305. gbinv57.seq - Invertebrate sequence entries, part 57.
2306. gbinv58.seq - Invertebrate sequence entries, part 58.
2307. gbinv59.seq - Invertebrate sequence entries, part 59.
2308. gbinv6.seq - Invertebrate sequence entries, part 6.
2309. gbinv60.seq - Invertebrate sequence entries, part 60.
2310. gbinv61.seq - Invertebrate sequence entries, part 61.
2311. gbinv62.seq - Invertebrate sequence entries, part 62.
2312. gbinv63.seq - Invertebrate sequence entries, part 63.
2313. gbinv64.seq - Invertebrate sequence entries, part 64.
2314. gbinv65.seq - Invertebrate sequence entries, part 65.
2315. gbinv66.seq - Invertebrate sequence entries, part 66.
2316. gbinv67.seq - Invertebrate sequence entries, part 67.
2317. gbinv68.seq - Invertebrate sequence entries, part 68.
2318. gbinv69.seq - Invertebrate sequence entries, part 69.
2319. gbinv7.seq - Invertebrate sequence entries, part 7.
2320. gbinv70.seq - Invertebrate sequence entries, part 70.
2321. gbinv71.seq - Invertebrate sequence entries, part 71.
2322. gbinv72.seq - Invertebrate sequence entries, part 72.
2323. gbinv73.seq - Invertebrate sequence entries, part 73.
2324. gbinv74.seq - Invertebrate sequence entries, part 74.
2325. gbinv75.seq - Invertebrate sequence entries, part 75.
2326. gbinv76.seq - Invertebrate sequence entries, part 76.
2327. gbinv77.seq - Invertebrate sequence entries, part 77.
2328. gbinv78.seq - Invertebrate sequence entries, part 78.
2329. gbinv79.seq - Invertebrate sequence entries, part 79.
2330. gbinv8.seq - Invertebrate sequence entries, part 8.
2331. gbinv80.seq - Invertebrate sequence entries, part 80.
2332. gbinv81.seq - Invertebrate sequence entries, part 81.
2333. gbinv82.seq - Invertebrate sequence entries, part 82.
2334. gbinv83.seq - Invertebrate sequence entries, part 83.
2335. gbinv84.seq - Invertebrate sequence entries, part 84.
2336. gbinv85.seq - Invertebrate sequence entries, part 85.
2337. gbinv86.seq - Invertebrate sequence entries, part 86.
2338. gbinv87.seq - Invertebrate sequence entries, part 87.
2339. gbinv88.seq - Invertebrate sequence entries, part 88.
2340. gbinv89.seq - Invertebrate sequence entries, part 89.
2341. gbinv9.seq - Invertebrate sequence entries, part 9.
2342. gbinv90.seq - Invertebrate sequence entries, part 90.
2343. gbinv91.seq - Invertebrate sequence entries, part 91.
2344. gbinv92.seq - Invertebrate sequence entries, part 92.
2345. gbinv93.seq - Invertebrate sequence entries, part 93.
2346. gbinv94.seq - Invertebrate sequence entries, part 94.
2347. gbinv95.seq - Invertebrate sequence entries, part 95.
2348. gbinv96.seq - Invertebrate sequence entries, part 96.
2349. gbinv97.seq - Invertebrate sequence entries, part 97.
2350. gbinv98.seq - Invertebrate sequence entries, part 98.
2351. gbinv99.seq - Invertebrate sequence entries, part 99.
2352. gbmam1.seq - Other mammalian sequence entries, part 1.
2353. gbmam10.seq - Other mammalian sequence entries, part 10.
2354. gbmam11.seq - Other mammalian sequence entries, part 11.
2355. gbmam12.seq - Other mammalian sequence entries, part 12.
2356. gbmam13.seq - Other mammalian sequence entries, part 13.
2357. gbmam14.seq - Other mammalian sequence entries, part 14.
2358. gbmam15.seq - Other mammalian sequence entries, part 15.
2359. gbmam16.seq - Other mammalian sequence entries, part 16.
2360. gbmam17.seq - Other mammalian sequence entries, part 17.
2361. gbmam18.seq - Other mammalian sequence entries, part 18.
2362. gbmam19.seq - Other mammalian sequence entries, part 19.
2363. gbmam2.seq - Other mammalian sequence entries, part 2.
2364. gbmam20.seq - Other mammalian sequence entries, part 20.
2365. gbmam21.seq - Other mammalian sequence entries, part 21.
2366. gbmam22.seq - Other mammalian sequence entries, part 22.
2367. gbmam23.seq - Other mammalian sequence entries, part 23.
2368. gbmam24.seq - Other mammalian sequence entries, part 24.
2369. gbmam25.seq - Other mammalian sequence entries, part 25.
2370. gbmam26.seq - Other mammalian sequence entries, part 26.
2371. gbmam27.seq - Other mammalian sequence entries, part 27.
2372. gbmam28.seq - Other mammalian sequence entries, part 28.
2373. gbmam29.seq - Other mammalian sequence entries, part 29.
2374. gbmam3.seq - Other mammalian sequence entries, part 3.
2375. gbmam30.seq - Other mammalian sequence entries, part 30.
2376. gbmam31.seq - Other mammalian sequence entries, part 31.
2377. gbmam32.seq - Other mammalian sequence entries, part 32.
2378. gbmam33.seq - Other mammalian sequence entries, part 33.
2379. gbmam34.seq - Other mammalian sequence entries, part 34.
2380. gbmam35.seq - Other mammalian sequence entries, part 35.
2381. gbmam36.seq - Other mammalian sequence entries, part 36.
2382. gbmam37.seq - Other mammalian sequence entries, part 37.
2383. gbmam38.seq - Other mammalian sequence entries, part 38.
2384. gbmam39.seq - Other mammalian sequence entries, part 39.
2385. gbmam4.seq - Other mammalian sequence entries, part 4.
2386. gbmam40.seq - Other mammalian sequence entries, part 40.
2387. gbmam41.seq - Other mammalian sequence entries, part 41.
2388. gbmam42.seq - Other mammalian sequence entries, part 42.
2389. gbmam43.seq - Other mammalian sequence entries, part 43.
2390. gbmam44.seq - Other mammalian sequence entries, part 44.
2391. gbmam45.seq - Other mammalian sequence entries, part 45.
2392. gbmam46.seq - Other mammalian sequence entries, part 46.
2393. gbmam47.seq - Other mammalian sequence entries, part 47.
2394. gbmam48.seq - Other mammalian sequence entries, part 48.
2395. gbmam49.seq - Other mammalian sequence entries, part 49.
2396. gbmam5.seq - Other mammalian sequence entries, part 5.
2397. gbmam50.seq - Other mammalian sequence entries, part 50.
2398. gbmam51.seq - Other mammalian sequence entries, part 51.
2399. gbmam52.seq - Other mammalian sequence entries, part 52.
2400. gbmam53.seq - Other mammalian sequence entries, part 53.
2401. gbmam54.seq - Other mammalian sequence entries, part 54.
2402. gbmam55.seq - Other mammalian sequence entries, part 55.
2403. gbmam56.seq - Other mammalian sequence entries, part 56.
2404. gbmam57.seq - Other mammalian sequence entries, part 57.
2405. gbmam58.seq - Other mammalian sequence entries, part 58.
2406. gbmam59.seq - Other mammalian sequence entries, part 59.
2407. gbmam6.seq - Other mammalian sequence entries, part 6.
2408. gbmam60.seq - Other mammalian sequence entries, part 60.
2409. gbmam61.seq - Other mammalian sequence entries, part 61.
2410. gbmam62.seq - Other mammalian sequence entries, part 62.
2411. gbmam63.seq - Other mammalian sequence entries, part 63.
2412. gbmam64.seq - Other mammalian sequence entries, part 64.
2413. gbmam65.seq - Other mammalian sequence entries, part 65.
2414. gbmam66.seq - Other mammalian sequence entries, part 66.
2415. gbmam67.seq - Other mammalian sequence entries, part 67.
2416. gbmam68.seq - Other mammalian sequence entries, part 68.
2417. gbmam69.seq - Other mammalian sequence entries, part 69.
2418. gbmam7.seq - Other mammalian sequence entries, part 7.
2419. gbmam70.seq - Other mammalian sequence entries, part 70.
2420. gbmam71.seq - Other mammalian sequence entries, part 71.
2421. gbmam72.seq - Other mammalian sequence entries, part 72.
2422. gbmam73.seq - Other mammalian sequence entries, part 73.
2423. gbmam74.seq - Other mammalian sequence entries, part 74.
2424. gbmam75.seq - Other mammalian sequence entries, part 75.
2425. gbmam76.seq - Other mammalian sequence entries, part 76.
2426. gbmam77.seq - Other mammalian sequence entries, part 77.
2427. gbmam78.seq - Other mammalian sequence entries, part 78.
2428. gbmam79.seq - Other mammalian sequence entries, part 79.
2429. gbmam8.seq - Other mammalian sequence entries, part 8.
2430. gbmam80.seq - Other mammalian sequence entries, part 80.
2431. gbmam81.seq - Other mammalian sequence entries, part 81.
2432. gbmam82.seq - Other mammalian sequence entries, part 82.
2433. gbmam83.seq - Other mammalian sequence entries, part 83.
2434. gbmam84.seq - Other mammalian sequence entries, part 84.
2435. gbmam85.seq - Other mammalian sequence entries, part 85.
2436. gbmam86.seq - Other mammalian sequence entries, part 86.
2437. gbmam87.seq - Other mammalian sequence entries, part 87.
2438. gbmam88.seq - Other mammalian sequence entries, part 88.
2439. gbmam89.seq - Other mammalian sequence entries, part 89.
2440. gbmam9.seq - Other mammalian sequence entries, part 9.
2441. gbmam90.seq - Other mammalian sequence entries, part 90.
2442. gbmam91.seq - Other mammalian sequence entries, part 91.
2443. gbmam92.seq - Other mammalian sequence entries, part 92.
2444. gbmam93.seq - Other mammalian sequence entries, part 93.
2445. gbmam94.seq - Other mammalian sequence entries, part 94.
2446. gbmam95.seq - Other mammalian sequence entries, part 95.
2447. gbmam96.seq - Other mammalian sequence entries, part 96.
2448. gbmam97.seq - Other mammalian sequence entries, part 97.
2449. gbmam98.seq - Other mammalian sequence entries, part 98.
2450. gbmam99.seq - Other mammalian sequence entries, part 99.
2451. gbnew.txt - Accession numbers of entries new since the previous release.
2452. gbpat1.seq - Patent sequence entries, part 1.
2453. gbpat10.seq - Patent sequence entries, part 10.
2454. gbpat100.seq - Patent sequence entries, part 100.
2455. gbpat101.seq - Patent sequence entries, part 101.
2456. gbpat102.seq - Patent sequence entries, part 102.
2457. gbpat103.seq - Patent sequence entries, part 103.
2458. gbpat104.seq - Patent sequence entries, part 104.
2459. gbpat105.seq - Patent sequence entries, part 105.
2460. gbpat106.seq - Patent sequence entries, part 106.
2461. gbpat107.seq - Patent sequence entries, part 107.
2462. gbpat108.seq - Patent sequence entries, part 108.
2463. gbpat109.seq - Patent sequence entries, part 109.
2464. gbpat11.seq - Patent sequence entries, part 11.
2465. gbpat110.seq - Patent sequence entries, part 110.
2466. gbpat111.seq - Patent sequence entries, part 111.
2467. gbpat112.seq - Patent sequence entries, part 112.
2468. gbpat113.seq - Patent sequence entries, part 113.
2469. gbpat114.seq - Patent sequence entries, part 114.
2470. gbpat115.seq - Patent sequence entries, part 115.
2471. gbpat116.seq - Patent sequence entries, part 116.
2472. gbpat117.seq - Patent sequence entries, part 117.
2473. gbpat118.seq - Patent sequence entries, part 118.
2474. gbpat119.seq - Patent sequence entries, part 119.
2475. gbpat12.seq - Patent sequence entries, part 12.
2476. gbpat120.seq - Patent sequence entries, part 120.
2477. gbpat121.seq - Patent sequence entries, part 121.
2478. gbpat122.seq - Patent sequence entries, part 122.
2479. gbpat123.seq - Patent sequence entries, part 123.
2480. gbpat124.seq - Patent sequence entries, part 124.
2481. gbpat125.seq - Patent sequence entries, part 125.
2482. gbpat126.seq - Patent sequence entries, part 126.
2483. gbpat127.seq - Patent sequence entries, part 127.
2484. gbpat128.seq - Patent sequence entries, part 128.
2485. gbpat129.seq - Patent sequence entries, part 129.
2486. gbpat13.seq - Patent sequence entries, part 13.
2487. gbpat130.seq - Patent sequence entries, part 130.
2488. gbpat131.seq - Patent sequence entries, part 131.
2489. gbpat132.seq - Patent sequence entries, part 132.
2490. gbpat133.seq - Patent sequence entries, part 133.
2491. gbpat134.seq - Patent sequence entries, part 134.
2492. gbpat135.seq - Patent sequence entries, part 135.
2493. gbpat136.seq - Patent sequence entries, part 136.
2494. gbpat137.seq - Patent sequence entries, part 137.
2495. gbpat138.seq - Patent sequence entries, part 138.
2496. gbpat139.seq - Patent sequence entries, part 139.
2497. gbpat14.seq - Patent sequence entries, part 14.
2498. gbpat140.seq - Patent sequence entries, part 140.
2499. gbpat141.seq - Patent sequence entries, part 141.
2500. gbpat142.seq - Patent sequence entries, part 142.
2501. gbpat143.seq - Patent sequence entries, part 143.
2502. gbpat144.seq - Patent sequence entries, part 144.
2503. gbpat145.seq - Patent sequence entries, part 145.
2504. gbpat146.seq - Patent sequence entries, part 146.
2505. gbpat147.seq - Patent sequence entries, part 147.
2506. gbpat148.seq - Patent sequence entries, part 148.
2507. gbpat149.seq - Patent sequence entries, part 149.
2508. gbpat15.seq - Patent sequence entries, part 15.
2509. gbpat150.seq - Patent sequence entries, part 150.
2510. gbpat151.seq - Patent sequence entries, part 151.
2511. gbpat152.seq - Patent sequence entries, part 152.
2512. gbpat153.seq - Patent sequence entries, part 153.
2513. gbpat154.seq - Patent sequence entries, part 154.
2514. gbpat155.seq - Patent sequence entries, part 155.
2515. gbpat156.seq - Patent sequence entries, part 156.
2516. gbpat157.seq - Patent sequence entries, part 157.
2517. gbpat158.seq - Patent sequence entries, part 158.
2518. gbpat159.seq - Patent sequence entries, part 159.
2519. gbpat16.seq - Patent sequence entries, part 16.
2520. gbpat160.seq - Patent sequence entries, part 160.
2521. gbpat161.seq - Patent sequence entries, part 161.
2522. gbpat162.seq - Patent sequence entries, part 162.
2523. gbpat163.seq - Patent sequence entries, part 163.
2524. gbpat164.seq - Patent sequence entries, part 164.
2525. gbpat165.seq - Patent sequence entries, part 165.
2526. gbpat166.seq - Patent sequence entries, part 166.
2527. gbpat167.seq - Patent sequence entries, part 167.
2528. gbpat168.seq - Patent sequence entries, part 168.
2529. gbpat169.seq - Patent sequence entries, part 169.
2530. gbpat17.seq - Patent sequence entries, part 17.
2531. gbpat170.seq - Patent sequence entries, part 170.
2532. gbpat171.seq - Patent sequence entries, part 171.
2533. gbpat172.seq - Patent sequence entries, part 172.
2534. gbpat173.seq - Patent sequence entries, part 173.
2535. gbpat174.seq - Patent sequence entries, part 174.
2536. gbpat175.seq - Patent sequence entries, part 175.
2537. gbpat176.seq - Patent sequence entries, part 176.
2538. gbpat177.seq - Patent sequence entries, part 177.
2539. gbpat178.seq - Patent sequence entries, part 178.
2540. gbpat179.seq - Patent sequence entries, part 179.
2541. gbpat18.seq - Patent sequence entries, part 18.
2542. gbpat180.seq - Patent sequence entries, part 180.
2543. gbpat181.seq - Patent sequence entries, part 181.
2544. gbpat182.seq - Patent sequence entries, part 182.
2545. gbpat183.seq - Patent sequence entries, part 183.
2546. gbpat184.seq - Patent sequence entries, part 184.
2547. gbpat185.seq - Patent sequence entries, part 185.
2548. gbpat186.seq - Patent sequence entries, part 186.
2549. gbpat187.seq - Patent sequence entries, part 187.
2550. gbpat188.seq - Patent sequence entries, part 188.
2551. gbpat189.seq - Patent sequence entries, part 189.
2552. gbpat19.seq - Patent sequence entries, part 19.
2553. gbpat190.seq - Patent sequence entries, part 190.
2554. gbpat191.seq - Patent sequence entries, part 191.
2555. gbpat192.seq - Patent sequence entries, part 192.
2556. gbpat193.seq - Patent sequence entries, part 193.
2557. gbpat194.seq - Patent sequence entries, part 194.
2558. gbpat195.seq - Patent sequence entries, part 195.
2559. gbpat196.seq - Patent sequence entries, part 196.
2560. gbpat197.seq - Patent sequence entries, part 197.
2561. gbpat198.seq - Patent sequence entries, part 198.
2562. gbpat199.seq - Patent sequence entries, part 199.
2563. gbpat2.seq - Patent sequence entries, part 2.
2564. gbpat20.seq - Patent sequence entries, part 20.
2565. gbpat200.seq - Patent sequence entries, part 200.
2566. gbpat201.seq - Patent sequence entries, part 201.
2567. gbpat202.seq - Patent sequence entries, part 202.
2568. gbpat203.seq - Patent sequence entries, part 203.
2569. gbpat204.seq - Patent sequence entries, part 204.
2570. gbpat205.seq - Patent sequence entries, part 205.
2571. gbpat206.seq - Patent sequence entries, part 206.
2572. gbpat207.seq - Patent sequence entries, part 207.
2573. gbpat208.seq - Patent sequence entries, part 208.
2574. gbpat209.seq - Patent sequence entries, part 209.
2575. gbpat21.seq - Patent sequence entries, part 21.
2576. gbpat210.seq - Patent sequence entries, part 210.
2577. gbpat211.seq - Patent sequence entries, part 211.
2578. gbpat212.seq - Patent sequence entries, part 212.
2579. gbpat213.seq - Patent sequence entries, part 213.
2580. gbpat214.seq - Patent sequence entries, part 214.
2581. gbpat215.seq - Patent sequence entries, part 215.
2582. gbpat216.seq - Patent sequence entries, part 216.
2583. gbpat217.seq - Patent sequence entries, part 217.
2584. gbpat218.seq - Patent sequence entries, part 218.
2585. gbpat219.seq - Patent sequence entries, part 219.
2586. gbpat22.seq - Patent sequence entries, part 22.
2587. gbpat220.seq - Patent sequence entries, part 220.
2588. gbpat221.seq - Patent sequence entries, part 221.
2589. gbpat222.seq - Patent sequence entries, part 222.
2590. gbpat223.seq - Patent sequence entries, part 223.
2591. gbpat224.seq - Patent sequence entries, part 224.
2592. gbpat225.seq - Patent sequence entries, part 225.
2593. gbpat226.seq - Patent sequence entries, part 226.
2594. gbpat227.seq - Patent sequence entries, part 227.
2595. gbpat228.seq - Patent sequence entries, part 228.
2596. gbpat229.seq - Patent sequence entries, part 229.
2597. gbpat23.seq - Patent sequence entries, part 23.
2598. gbpat230.seq - Patent sequence entries, part 230.
2599. gbpat231.seq - Patent sequence entries, part 231.
2600. gbpat232.seq - Patent sequence entries, part 232.
2601. gbpat233.seq - Patent sequence entries, part 233.
2602. gbpat234.seq - Patent sequence entries, part 234.
2603. gbpat235.seq - Patent sequence entries, part 235.
2604. gbpat236.seq - Patent sequence entries, part 236.
2605. gbpat237.seq - Patent sequence entries, part 237.
2606. gbpat238.seq - Patent sequence entries, part 238.
2607. gbpat239.seq - Patent sequence entries, part 239.
2608. gbpat24.seq - Patent sequence entries, part 24.
2609. gbpat240.seq - Patent sequence entries, part 240.
2610. gbpat241.seq - Patent sequence entries, part 241.
2611. gbpat242.seq - Patent sequence entries, part 242.
2612. gbpat243.seq - Patent sequence entries, part 243.
2613. gbpat244.seq - Patent sequence entries, part 244.
2614. gbpat245.seq - Patent sequence entries, part 245.
2615. gbpat246.seq - Patent sequence entries, part 246.
2616. gbpat25.seq - Patent sequence entries, part 25.
2617. gbpat26.seq - Patent sequence entries, part 26.
2618. gbpat27.seq - Patent sequence entries, part 27.
2619. gbpat28.seq - Patent sequence entries, part 28.
2620. gbpat29.seq - Patent sequence entries, part 29.
2621. gbpat3.seq - Patent sequence entries, part 3.
2622. gbpat30.seq - Patent sequence entries, part 30.
2623. gbpat31.seq - Patent sequence entries, part 31.
2624. gbpat32.seq - Patent sequence entries, part 32.
2625. gbpat33.seq - Patent sequence entries, part 33.
2626. gbpat34.seq - Patent sequence entries, part 34.
2627. gbpat35.seq - Patent sequence entries, part 35.
2628. gbpat36.seq - Patent sequence entries, part 36.
2629. gbpat37.seq - Patent sequence entries, part 37.
2630. gbpat38.seq - Patent sequence entries, part 38.
2631. gbpat39.seq - Patent sequence entries, part 39.
2632. gbpat4.seq - Patent sequence entries, part 4.
2633. gbpat40.seq - Patent sequence entries, part 40.
2634. gbpat41.seq - Patent sequence entries, part 41.
2635. gbpat42.seq - Patent sequence entries, part 42.
2636. gbpat43.seq - Patent sequence entries, part 43.
2637. gbpat44.seq - Patent sequence entries, part 44.
2638. gbpat45.seq - Patent sequence entries, part 45.
2639. gbpat46.seq - Patent sequence entries, part 46.
2640. gbpat47.seq - Patent sequence entries, part 47.
2641. gbpat48.seq - Patent sequence entries, part 48.
2642. gbpat49.seq - Patent sequence entries, part 49.
2643. gbpat5.seq - Patent sequence entries, part 5.
2644. gbpat50.seq - Patent sequence entries, part 50.
2645. gbpat51.seq - Patent sequence entries, part 51.
2646. gbpat52.seq - Patent sequence entries, part 52.
2647. gbpat53.seq - Patent sequence entries, part 53.
2648. gbpat54.seq - Patent sequence entries, part 54.
2649. gbpat55.seq - Patent sequence entries, part 55.
2650. gbpat56.seq - Patent sequence entries, part 56.
2651. gbpat57.seq - Patent sequence entries, part 57.
2652. gbpat58.seq - Patent sequence entries, part 58.
2653. gbpat59.seq - Patent sequence entries, part 59.
2654. gbpat6.seq - Patent sequence entries, part 6.
2655. gbpat60.seq - Patent sequence entries, part 60.
2656. gbpat61.seq - Patent sequence entries, part 61.
2657. gbpat62.seq - Patent sequence entries, part 62.
2658. gbpat63.seq - Patent sequence entries, part 63.
2659. gbpat64.seq - Patent sequence entries, part 64.
2660. gbpat65.seq - Patent sequence entries, part 65.
2661. gbpat66.seq - Patent sequence entries, part 66.
2662. gbpat67.seq - Patent sequence entries, part 67.
2663. gbpat68.seq - Patent sequence entries, part 68.
2664. gbpat69.seq - Patent sequence entries, part 69.
2665. gbpat7.seq - Patent sequence entries, part 7.
2666. gbpat70.seq - Patent sequence entries, part 70.
2667. gbpat71.seq - Patent sequence entries, part 71.
2668. gbpat72.seq - Patent sequence entries, part 72.
2669. gbpat73.seq - Patent sequence entries, part 73.
2670. gbpat74.seq - Patent sequence entries, part 74.
2671. gbpat75.seq - Patent sequence entries, part 75.
2672. gbpat76.seq - Patent sequence entries, part 76.
2673. gbpat77.seq - Patent sequence entries, part 77.
2674. gbpat78.seq - Patent sequence entries, part 78.
2675. gbpat79.seq - Patent sequence entries, part 79.
2676. gbpat8.seq - Patent sequence entries, part 8.
2677. gbpat80.seq - Patent sequence entries, part 80.
2678. gbpat81.seq - Patent sequence entries, part 81.
2679. gbpat82.seq - Patent sequence entries, part 82.
2680. gbpat83.seq - Patent sequence entries, part 83.
2681. gbpat84.seq - Patent sequence entries, part 84.
2682. gbpat85.seq - Patent sequence entries, part 85.
2683. gbpat86.seq - Patent sequence entries, part 86.
2684. gbpat87.seq - Patent sequence entries, part 87.
2685. gbpat88.seq - Patent sequence entries, part 88.
2686. gbpat89.seq - Patent sequence entries, part 89.
2687. gbpat9.seq - Patent sequence entries, part 9.
2688. gbpat90.seq - Patent sequence entries, part 90.
2689. gbpat91.seq - Patent sequence entries, part 91.
2690. gbpat92.seq - Patent sequence entries, part 92.
2691. gbpat93.seq - Patent sequence entries, part 93.
2692. gbpat94.seq - Patent sequence entries, part 94.
2693. gbpat95.seq - Patent sequence entries, part 95.
2694. gbpat96.seq - Patent sequence entries, part 96.
2695. gbpat97.seq - Patent sequence entries, part 97.
2696. gbpat98.seq - Patent sequence entries, part 98.
2697. gbpat99.seq - Patent sequence entries, part 99.
2698. gbphg1.seq - Phage sequence entries, part 1.
2699. gbphg2.seq - Phage sequence entries, part 2.
2700. gbphg3.seq - Phage sequence entries, part 3.
2701. gbphg4.seq - Phage sequence entries, part 4.
2702. gbphg5.seq - Phage sequence entries, part 5.
2703. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2704. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2705. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2706. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2707. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2708. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2709. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2710. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2711. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2712. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2713. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2714. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2715. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2716. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2717. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2718. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2719. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2720. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2721. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2722. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2723. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2724. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2725. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2726. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2727. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2728. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2729. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2730. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2731. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2732. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2733. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2734. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2735. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2736. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2737. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2738. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2739. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2740. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2741. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2742. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2743. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2744. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2745. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2746. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2747. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2748. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2749. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2750. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2751. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2752. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2753. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2754. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2755. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2756. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2757. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2758. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
2759. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2760. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
2761. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
2762. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
2763. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
2764. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
2765. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
2766. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
2767. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
2768. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
2769. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
2770. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2771. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
2772. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
2773. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
2774. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
2775. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
2776. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
2777. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
2778. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
2779. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
2780. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
2781. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2782. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
2783. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
2784. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
2785. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
2786. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
2787. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
2788. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
2789. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
2790. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
2791. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
2792. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2793. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
2794. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
2795. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
2796. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
2797. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
2798. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
2799. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
2800. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
2801. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
2802. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
2803. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2804. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
2805. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
2806. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
2807. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
2808. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
2809. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
2810. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
2811. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
2812. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
2813. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
2814. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2815. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2816. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
2817. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
2818. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
2819. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
2820. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
2821. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
2822. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
2823. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
2824. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
2825. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
2826. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2827. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
2828. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
2829. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
2830. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
2831. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
2832. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
2833. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
2834. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
2835. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
2836. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
2837. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2838. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
2839. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
2840. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
2841. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
2842. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
2843. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
2844. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
2845. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
2846. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
2847. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
2848. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2849. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
2850. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
2851. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
2852. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
2853. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
2854. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
2855. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
2856. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
2857. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
2858. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
2859. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2860. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
2861. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
2862. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
2863. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
2864. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
2865. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
2866. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
2867. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
2868. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
2869. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
2870. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2871. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
2872. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
2873. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
2874. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
2875. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
2876. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
2877. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
2878. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
2879. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
2880. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
2881. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2882. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
2883. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
2884. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
2885. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
2886. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
2887. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
2888. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
2889. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
2890. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
2891. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
2892. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2893. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
2894. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
2895. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
2896. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
2897. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
2898. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
2899. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
2900. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
2901. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
2902. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
2903. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2904. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
2905. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
2906. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
2907. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
2908. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
2909. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
2910. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
2911. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
2912. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
2913. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
2914. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2915. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
2916. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
2917. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
2918. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
2919. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
2920. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
2921. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
2922. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
2923. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
2924. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
2925. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2926. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2927. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
2928. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
2929. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
2930. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
2931. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
2932. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
2933. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
2934. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
2935. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
2936. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
2937. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
2938. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
2939. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
2940. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
2941. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
2942. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
2943. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
2944. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
2945. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
2946. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
2947. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
2948. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
2949. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
2950. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
2951. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
2952. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
2953. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
2954. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
2955. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
2956. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
2957. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
2958. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
2959. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
2960. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
2961. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
2962. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
2963. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
2964. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
2965. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
2966. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
2967. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
2968. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
2969. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
2970. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
2971. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
2972. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
2973. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
2974. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
2975. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
2976. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
2977. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
2978. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
2979. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
2980. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
2981. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
2982. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
2983. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
2984. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
2985. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
2986. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
2987. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
2988. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
2989. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
2990. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
2991. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
2992. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
2993. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
2994. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
2995. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
2996. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
2997. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
2998. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
2999. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
3000. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
3001. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
3002. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
3003. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
3004. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
3005. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
3006. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
3007. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
3008. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
3009. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
3010. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
3011. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
3012. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
3013. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
3014. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
3015. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
3016. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
3017. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
3018. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
3019. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
3020. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
3021. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
3022. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
3023. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
3024. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
3025. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
3026. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
3027. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
3028. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
3029. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
3030. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
3031. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
3032. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
3033. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
3034. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
3035. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
3036. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
3037. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
3038. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
3039. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
3040. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
3041. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
3042. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
3043. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
3044. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
3045. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
3046. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
3047. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
3048. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
3049. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
3050. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
3051. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
3052. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
3053. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
3054. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
3055. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
3056. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
3057. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
3058. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
3059. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
3060. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
3061. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
3062. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
3063. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
3064. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
3065. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
3066. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
3067. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
3068. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
3069. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
3070. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
3071. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
3072. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
3073. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
3074. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
3075. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
3076. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
3077. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
3078. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
3079. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
3080. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
3081. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
3082. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
3083. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
3084. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
3085. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
3086. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
3087. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
3088. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
3089. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
3090. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
3091. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
3092. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
3093. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
3094. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
3095. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
3096. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
3097. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
3098. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
3099. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
3100. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
3101. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
3102. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
3103. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
3104. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
3105. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
3106. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
3107. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
3108. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
3109. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
3110. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
3111. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
3112. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
3113. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
3114. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
3115. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
3116. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
3117. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
3118. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
3119. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
3120. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
3121. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
3122. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
3123. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
3124. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
3125. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
3126. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
3127. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
3128. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
3129. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
3130. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
3131. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
3132. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
3133. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
3134. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
3135. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
3136. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
3137. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
3138. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
3139. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
3140. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
3141. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
3142. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
3143. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
3144. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
3145. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
3146. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
3147. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
3148. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
3149. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
3150. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
3151. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
3152. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
3153. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
3154. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
3155. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
3156. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
3157. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
3158. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
3159. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
3160. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
3161. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
3162. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
3163. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
3164. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
3165. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
3166. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
3167. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
3168. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
3169. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
3170. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
3171. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
3172. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
3173. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
3174. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
3175. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
3176. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
3177. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
3178. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
3179. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
3180. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
3181. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
3182. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
3183. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
3184. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
3185. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
3186. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
3187. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
3188. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
3189. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
3190. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
3191. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
3192. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
3193. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
3194. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
3195. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
3196. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
3197. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
3198. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
3199. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
3200. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
3201. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
3202. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
3203. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
3204. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
3205. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
3206. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
3207. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
3208. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
3209. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
3210. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
3211. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
3212. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
3213. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
3214. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
3215. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
3216. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
3217. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
3218. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
3219. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
3220. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
3221. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
3222. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
3223. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
3224. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
3225. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
3226. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
3227. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
3228. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
3229. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
3230. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
3231. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
3232. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
3233. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
3234. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
3235. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
3236. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
3237. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
3238. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
3239. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
3240. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
3241. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
3242. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
3243. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
3244. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
3245. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
3246. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
3247. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
3248. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
3249. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
3250. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
3251. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
3252. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
3253. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
3254. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
3255. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
3256. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
3257. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
3258. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
3259. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
3260. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
3261. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
3262. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
3263. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
3264. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
3265. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
3266. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
3267. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
3268. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
3269. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
3270. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
3271. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
3272. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
3273. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
3274. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
3275. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
3276. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
3277. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
3278. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
3279. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
3280. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
3281. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
3282. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
3283. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
3284. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
3285. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
3286. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
3287. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
3288. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
3289. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
3290. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
3291. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
3292. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
3293. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
3294. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
3295. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
3296. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
3297. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
3298. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
3299. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
3300. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
3301. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
3302. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
3303. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
3304. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
3305. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
3306. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
3307. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
3308. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
3309. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
3310. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
3311. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
3312. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
3313. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
3314. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
3315. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
3316. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
3317. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
3318. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
3319. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
3320. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
3321. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
3322. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
3323. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
3324. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
3325. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
3326. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
3327. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
3328. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
3329. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
3330. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
3331. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665.
3332. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666.
3333. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667.
3334. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668.
3335. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669.
3336. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
3337. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670.
3338. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671.
3339. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672.
3340. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673.
3341. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674.
3342. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675.
3343. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676.
3344. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677.
3345. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678.
3346. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679.
3347. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
3348. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680.
3349. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681.
3350. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682.
3351. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683.
3352. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684.
3353. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685.
3354. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686.
3355. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687.
3356. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688.
3357. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689.
3358. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
3359. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690.
3360. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691.
3361. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692.
3362. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693.
3363. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694.
3364. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695.
3365. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696.
3366. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697.
3367. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698.
3368. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699.
3369. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
3370. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
3371. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700.
3372. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701.
3373. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702.
3374. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703.
3375. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704.
3376. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705.
3377. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706.
3378. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707.
3379. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708.
3380. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709.
3381. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
3382. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710.
3383. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711.
3384. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712.
3385. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713.
3386. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714.
3387. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715.
3388. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716.
3389. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717.
3390. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718.
3391. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719.
3392. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
3393. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720.
3394. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721.
3395. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722.
3396. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723.
3397. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
3398. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
3399. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
3400. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
3401. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
3402. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
3403. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
3404. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
3405. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
3406. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
3407. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
3408. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
3409. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
3410. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
3411. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
3412. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
3413. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
3414. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
3415. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
3416. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
3417. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
3418. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
3419. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
3420. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
3421. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
3422. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
3423. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
3424. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
3425. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
3426. gbpri1.seq - Primate sequence entries, part 1.
3427. gbpri10.seq - Primate sequence entries, part 10.
3428. gbpri11.seq - Primate sequence entries, part 11.
3429. gbpri12.seq - Primate sequence entries, part 12.
3430. gbpri13.seq - Primate sequence entries, part 13.
3431. gbpri14.seq - Primate sequence entries, part 14.
3432. gbpri15.seq - Primate sequence entries, part 15.
3433. gbpri16.seq - Primate sequence entries, part 16.
3434. gbpri17.seq - Primate sequence entries, part 17.
3435. gbpri18.seq - Primate sequence entries, part 18.
3436. gbpri19.seq - Primate sequence entries, part 19.
3437. gbpri2.seq - Primate sequence entries, part 2.
3438. gbpri20.seq - Primate sequence entries, part 20.
3439. gbpri21.seq - Primate sequence entries, part 21.
3440. gbpri22.seq - Primate sequence entries, part 22.
3441. gbpri23.seq - Primate sequence entries, part 23.
3442. gbpri24.seq - Primate sequence entries, part 24.
3443. gbpri25.seq - Primate sequence entries, part 25.
3444. gbpri26.seq - Primate sequence entries, part 26.
3445. gbpri27.seq - Primate sequence entries, part 27.
3446. gbpri28.seq - Primate sequence entries, part 28.
3447. gbpri29.seq - Primate sequence entries, part 29.
3448. gbpri3.seq - Primate sequence entries, part 3.
3449. gbpri30.seq - Primate sequence entries, part 30.
3450. gbpri31.seq - Primate sequence entries, part 31.
3451. gbpri32.seq - Primate sequence entries, part 32.
3452. gbpri33.seq - Primate sequence entries, part 33.
3453. gbpri34.seq - Primate sequence entries, part 34.
3454. gbpri35.seq - Primate sequence entries, part 35.
3455. gbpri36.seq - Primate sequence entries, part 36.
3456. gbpri37.seq - Primate sequence entries, part 37.
3457. gbpri38.seq - Primate sequence entries, part 38.
3458. gbpri39.seq - Primate sequence entries, part 39.
3459. gbpri4.seq - Primate sequence entries, part 4.
3460. gbpri40.seq - Primate sequence entries, part 40.
3461. gbpri41.seq - Primate sequence entries, part 41.
3462. gbpri42.seq - Primate sequence entries, part 42.
3463. gbpri43.seq - Primate sequence entries, part 43.
3464. gbpri44.seq - Primate sequence entries, part 44.
3465. gbpri45.seq - Primate sequence entries, part 45.
3466. gbpri46.seq - Primate sequence entries, part 46.
3467. gbpri47.seq - Primate sequence entries, part 47.
3468. gbpri48.seq - Primate sequence entries, part 48.
3469. gbpri49.seq - Primate sequence entries, part 49.
3470. gbpri5.seq - Primate sequence entries, part 5.
3471. gbpri50.seq - Primate sequence entries, part 50.
3472. gbpri51.seq - Primate sequence entries, part 51.
3473. gbpri52.seq - Primate sequence entries, part 52.
3474. gbpri53.seq - Primate sequence entries, part 53.
3475. gbpri54.seq - Primate sequence entries, part 54.
3476. gbpri55.seq - Primate sequence entries, part 55.
3477. gbpri6.seq - Primate sequence entries, part 6.
3478. gbpri7.seq - Primate sequence entries, part 7.
3479. gbpri8.seq - Primate sequence entries, part 8.
3480. gbpri9.seq - Primate sequence entries, part 9.
3481. gbrel.txt - Release notes (this document).
3482. gbrod1.seq - Rodent sequence entries, part 1.
3483. gbrod10.seq - Rodent sequence entries, part 10.
3484. gbrod11.seq - Rodent sequence entries, part 11.
3485. gbrod12.seq - Rodent sequence entries, part 12.
3486. gbrod13.seq - Rodent sequence entries, part 13.
3487. gbrod14.seq - Rodent sequence entries, part 14.
3488. gbrod15.seq - Rodent sequence entries, part 15.
3489. gbrod16.seq - Rodent sequence entries, part 16.
3490. gbrod17.seq - Rodent sequence entries, part 17.
3491. gbrod18.seq - Rodent sequence entries, part 18.
3492. gbrod19.seq - Rodent sequence entries, part 19.
3493. gbrod2.seq - Rodent sequence entries, part 2.
3494. gbrod20.seq - Rodent sequence entries, part 20.
3495. gbrod21.seq - Rodent sequence entries, part 21.
3496. gbrod22.seq - Rodent sequence entries, part 22.
3497. gbrod23.seq - Rodent sequence entries, part 23.
3498. gbrod24.seq - Rodent sequence entries, part 24.
3499. gbrod25.seq - Rodent sequence entries, part 25.
3500. gbrod26.seq - Rodent sequence entries, part 26.
3501. gbrod27.seq - Rodent sequence entries, part 27.
3502. gbrod28.seq - Rodent sequence entries, part 28.
3503. gbrod29.seq - Rodent sequence entries, part 29.
3504. gbrod3.seq - Rodent sequence entries, part 3.
3505. gbrod30.seq - Rodent sequence entries, part 30.
3506. gbrod31.seq - Rodent sequence entries, part 31.
3507. gbrod32.seq - Rodent sequence entries, part 32.
3508. gbrod33.seq - Rodent sequence entries, part 33.
3509. gbrod34.seq - Rodent sequence entries, part 34.
3510. gbrod35.seq - Rodent sequence entries, part 35.
3511. gbrod36.seq - Rodent sequence entries, part 36.
3512. gbrod37.seq - Rodent sequence entries, part 37.
3513. gbrod38.seq - Rodent sequence entries, part 38.
3514. gbrod39.seq - Rodent sequence entries, part 39.
3515. gbrod4.seq - Rodent sequence entries, part 4.
3516. gbrod40.seq - Rodent sequence entries, part 40.
3517. gbrod41.seq - Rodent sequence entries, part 41.
3518. gbrod42.seq - Rodent sequence entries, part 42.
3519. gbrod43.seq - Rodent sequence entries, part 43.
3520. gbrod44.seq - Rodent sequence entries, part 44.
3521. gbrod45.seq - Rodent sequence entries, part 45.
3522. gbrod46.seq - Rodent sequence entries, part 46.
3523. gbrod47.seq - Rodent sequence entries, part 47.
3524. gbrod48.seq - Rodent sequence entries, part 48.
3525. gbrod49.seq - Rodent sequence entries, part 49.
3526. gbrod5.seq - Rodent sequence entries, part 5.
3527. gbrod50.seq - Rodent sequence entries, part 50.
3528. gbrod51.seq - Rodent sequence entries, part 51.
3529. gbrod52.seq - Rodent sequence entries, part 52.
3530. gbrod53.seq - Rodent sequence entries, part 53.
3531. gbrod54.seq - Rodent sequence entries, part 54.
3532. gbrod55.seq - Rodent sequence entries, part 55.
3533. gbrod56.seq - Rodent sequence entries, part 56.
3534. gbrod57.seq - Rodent sequence entries, part 57.
3535. gbrod58.seq - Rodent sequence entries, part 58.
3536. gbrod59.seq - Rodent sequence entries, part 59.
3537. gbrod6.seq - Rodent sequence entries, part 6.
3538. gbrod60.seq - Rodent sequence entries, part 60.
3539. gbrod61.seq - Rodent sequence entries, part 61.
3540. gbrod62.seq - Rodent sequence entries, part 62.
3541. gbrod63.seq - Rodent sequence entries, part 63.
3542. gbrod64.seq - Rodent sequence entries, part 64.
3543. gbrod65.seq - Rodent sequence entries, part 65.
3544. gbrod66.seq - Rodent sequence entries, part 66.
3545. gbrod67.seq - Rodent sequence entries, part 67.
3546. gbrod68.seq - Rodent sequence entries, part 68.
3547. gbrod69.seq - Rodent sequence entries, part 69.
3548. gbrod7.seq - Rodent sequence entries, part 7.
3549. gbrod70.seq - Rodent sequence entries, part 70.
3550. gbrod71.seq - Rodent sequence entries, part 71.
3551. gbrod72.seq - Rodent sequence entries, part 72.
3552. gbrod73.seq - Rodent sequence entries, part 73.
3553. gbrod74.seq - Rodent sequence entries, part 74.
3554. gbrod75.seq - Rodent sequence entries, part 75.
3555. gbrod76.seq - Rodent sequence entries, part 76.
3556. gbrod77.seq - Rodent sequence entries, part 77.
3557. gbrod8.seq - Rodent sequence entries, part 8.
3558. gbrod9.seq - Rodent sequence entries, part 9.
3559. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
3560. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
3561. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
3562. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
3563. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
3564. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
3565. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
3566. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
3567. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
3568. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
3569. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
3570. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
3571. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
3572. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
3573. gbsyn12.seq - Synthetic and chimeric sequence entries, part 12.
3574. gbsyn13.seq - Synthetic and chimeric sequence entries, part 13.
3575. gbsyn14.seq - Synthetic and chimeric sequence entries, part 14.
3576. gbsyn15.seq - Synthetic and chimeric sequence entries, part 15.
3577. gbsyn16.seq - Synthetic and chimeric sequence entries, part 16.
3578. gbsyn17.seq - Synthetic and chimeric sequence entries, part 17.
3579. gbsyn18.seq - Synthetic and chimeric sequence entries, part 18.
3580. gbsyn19.seq - Synthetic and chimeric sequence entries, part 19.
3581. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
3582. gbsyn20.seq - Synthetic and chimeric sequence entries, part 20.
3583. gbsyn21.seq - Synthetic and chimeric sequence entries, part 21.
3584. gbsyn22.seq - Synthetic and chimeric sequence entries, part 22.
3585. gbsyn23.seq - Synthetic and chimeric sequence entries, part 23.
3586. gbsyn24.seq - Synthetic and chimeric sequence entries, part 24.
3587. gbsyn25.seq - Synthetic and chimeric sequence entries, part 25.
3588. gbsyn26.seq - Synthetic and chimeric sequence entries, part 26.
3589. gbsyn27.seq - Synthetic and chimeric sequence entries, part 27.
3590. gbsyn28.seq - Synthetic and chimeric sequence entries, part 28.
3591. gbsyn29.seq - Synthetic and chimeric sequence entries, part 29.
3592. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
3593. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
3594. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
3595. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
3596. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
3597. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
3598. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
3599. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
3600. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
3601. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
3602. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
3603. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
3604. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
3605. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
3606. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
3607. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
3608. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
3609. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
3610. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
3611. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
3612. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
3613. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
3614. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
3615. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
3616. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
3617. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
3618. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
3619. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
3620. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
3621. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
3622. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
3623. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
3624. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
3625. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
3626. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
3627. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
3628. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
3629. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
3630. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
3631. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
3632. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
3633. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
3634. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
3635. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
3636. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
3637. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
3638. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
3639. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
3640. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
3641. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
3642. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
3643. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
3644. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
3645. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
3646. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
3647. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
3648. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
3649. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
3650. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
3651. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
3652. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
3653. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
3654. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
3655. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
3656. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
3657. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
3658. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
3659. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
3660. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
3661. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
3662. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
3663. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
3664. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
3665. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
3666. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
3667. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
3668. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
3669. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
3670. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
3671. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
3672. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
3673. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
3674. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
3675. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
3676. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
3677. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
3678. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
3679. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
3680. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
3681. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
3682. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
3683. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
3684. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
3685. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
3686. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
3687. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
3688. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
3689. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
3690. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
3691. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
3692. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
3693. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
3694. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
3695. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
3696. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
3697. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
3698. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
3699. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
3700. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
3701. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
3702. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
3703. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
3704. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
3705. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
3706. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
3707. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
3708. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
3709. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
3710. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
3711. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
3712. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
3713. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
3714. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
3715. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
3716. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
3717. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
3718. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
3719. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
3720. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
3721. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
3722. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
3723. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
3724. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
3725. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
3726. gbuna1.seq - Unannotated sequence entries, part 1.
3727. gbvrl1.seq - Viral sequence entries, part 1.
3728. gbvrl10.seq - Viral sequence entries, part 10.
3729. gbvrl100.seq - Viral sequence entries, part 100.
3730. gbvrl101.seq - Viral sequence entries, part 101.
3731. gbvrl102.seq - Viral sequence entries, part 102.
3732. gbvrl103.seq - Viral sequence entries, part 103.
3733. gbvrl104.seq - Viral sequence entries, part 104.
3734. gbvrl105.seq - Viral sequence entries, part 105.
3735. gbvrl106.seq - Viral sequence entries, part 106.
3736. gbvrl107.seq - Viral sequence entries, part 107.
3737. gbvrl108.seq - Viral sequence entries, part 108.
3738. gbvrl109.seq - Viral sequence entries, part 109.
3739. gbvrl11.seq - Viral sequence entries, part 11.
3740. gbvrl110.seq - Viral sequence entries, part 110.
3741. gbvrl111.seq - Viral sequence entries, part 111.
3742. gbvrl112.seq - Viral sequence entries, part 112.
3743. gbvrl113.seq - Viral sequence entries, part 113.
3744. gbvrl114.seq - Viral sequence entries, part 114.
3745. gbvrl115.seq - Viral sequence entries, part 115.
3746. gbvrl116.seq - Viral sequence entries, part 116.
3747. gbvrl117.seq - Viral sequence entries, part 117.
3748. gbvrl118.seq - Viral sequence entries, part 118.
3749. gbvrl119.seq - Viral sequence entries, part 119.
3750. gbvrl12.seq - Viral sequence entries, part 12.
3751. gbvrl120.seq - Viral sequence entries, part 120.
3752. gbvrl121.seq - Viral sequence entries, part 121.
3753. gbvrl122.seq - Viral sequence entries, part 122.
3754. gbvrl123.seq - Viral sequence entries, part 123.
3755. gbvrl124.seq - Viral sequence entries, part 124.
3756. gbvrl125.seq - Viral sequence entries, part 125.
3757. gbvrl126.seq - Viral sequence entries, part 126.
3758. gbvrl127.seq - Viral sequence entries, part 127.
3759. gbvrl128.seq - Viral sequence entries, part 128.
3760. gbvrl129.seq - Viral sequence entries, part 129.
3761. gbvrl13.seq - Viral sequence entries, part 13.
3762. gbvrl130.seq - Viral sequence entries, part 130.
3763. gbvrl131.seq - Viral sequence entries, part 131.
3764. gbvrl132.seq - Viral sequence entries, part 132.
3765. gbvrl133.seq - Viral sequence entries, part 133.
3766. gbvrl134.seq - Viral sequence entries, part 134.
3767. gbvrl135.seq - Viral sequence entries, part 135.
3768. gbvrl136.seq - Viral sequence entries, part 136.
3769. gbvrl137.seq - Viral sequence entries, part 137.
3770. gbvrl138.seq - Viral sequence entries, part 138.
3771. gbvrl139.seq - Viral sequence entries, part 139.
3772. gbvrl14.seq - Viral sequence entries, part 14.
3773. gbvrl140.seq - Viral sequence entries, part 140.
3774. gbvrl141.seq - Viral sequence entries, part 141.
3775. gbvrl142.seq - Viral sequence entries, part 142.
3776. gbvrl143.seq - Viral sequence entries, part 143.
3777. gbvrl144.seq - Viral sequence entries, part 144.
3778. gbvrl145.seq - Viral sequence entries, part 145.
3779. gbvrl146.seq - Viral sequence entries, part 146.
3780. gbvrl147.seq - Viral sequence entries, part 147.
3781. gbvrl148.seq - Viral sequence entries, part 148.
3782. gbvrl149.seq - Viral sequence entries, part 149.
3783. gbvrl15.seq - Viral sequence entries, part 15.
3784. gbvrl150.seq - Viral sequence entries, part 150.
3785. gbvrl151.seq - Viral sequence entries, part 151.
3786. gbvrl152.seq - Viral sequence entries, part 152.
3787. gbvrl153.seq - Viral sequence entries, part 153.
3788. gbvrl154.seq - Viral sequence entries, part 154.
3789. gbvrl155.seq - Viral sequence entries, part 155.
3790. gbvrl156.seq - Viral sequence entries, part 156.
3791. gbvrl157.seq - Viral sequence entries, part 157.
3792. gbvrl158.seq - Viral sequence entries, part 158.
3793. gbvrl159.seq - Viral sequence entries, part 159.
3794. gbvrl16.seq - Viral sequence entries, part 16.
3795. gbvrl160.seq - Viral sequence entries, part 160.
3796. gbvrl161.seq - Viral sequence entries, part 161.
3797. gbvrl162.seq - Viral sequence entries, part 162.
3798. gbvrl163.seq - Viral sequence entries, part 163.
3799. gbvrl164.seq - Viral sequence entries, part 164.
3800. gbvrl165.seq - Viral sequence entries, part 165.
3801. gbvrl166.seq - Viral sequence entries, part 166.
3802. gbvrl167.seq - Viral sequence entries, part 167.
3803. gbvrl168.seq - Viral sequence entries, part 168.
3804. gbvrl169.seq - Viral sequence entries, part 169.
3805. gbvrl17.seq - Viral sequence entries, part 17.
3806. gbvrl170.seq - Viral sequence entries, part 170.
3807. gbvrl171.seq - Viral sequence entries, part 171.
3808. gbvrl172.seq - Viral sequence entries, part 172.
3809. gbvrl173.seq - Viral sequence entries, part 173.
3810. gbvrl174.seq - Viral sequence entries, part 174.
3811. gbvrl175.seq - Viral sequence entries, part 175.
3812. gbvrl176.seq - Viral sequence entries, part 176.
3813. gbvrl177.seq - Viral sequence entries, part 177.
3814. gbvrl178.seq - Viral sequence entries, part 178.
3815. gbvrl179.seq - Viral sequence entries, part 179.
3816. gbvrl18.seq - Viral sequence entries, part 18.
3817. gbvrl180.seq - Viral sequence entries, part 180.
3818. gbvrl181.seq - Viral sequence entries, part 181.
3819. gbvrl182.seq - Viral sequence entries, part 182.
3820. gbvrl183.seq - Viral sequence entries, part 183.
3821. gbvrl184.seq - Viral sequence entries, part 184.
3822. gbvrl185.seq - Viral sequence entries, part 185.
3823. gbvrl186.seq - Viral sequence entries, part 186.
3824. gbvrl187.seq - Viral sequence entries, part 187.
3825. gbvrl188.seq - Viral sequence entries, part 188.
3826. gbvrl189.seq - Viral sequence entries, part 189.
3827. gbvrl19.seq - Viral sequence entries, part 19.
3828. gbvrl190.seq - Viral sequence entries, part 190.
3829. gbvrl191.seq - Viral sequence entries, part 191.
3830. gbvrl192.seq - Viral sequence entries, part 192.
3831. gbvrl193.seq - Viral sequence entries, part 193.
3832. gbvrl194.seq - Viral sequence entries, part 194.
3833. gbvrl195.seq - Viral sequence entries, part 195.
3834. gbvrl196.seq - Viral sequence entries, part 196.
3835. gbvrl197.seq - Viral sequence entries, part 197.
3836. gbvrl198.seq - Viral sequence entries, part 198.
3837. gbvrl199.seq - Viral sequence entries, part 199.
3838. gbvrl2.seq - Viral sequence entries, part 2.
3839. gbvrl20.seq - Viral sequence entries, part 20.
3840. gbvrl200.seq - Viral sequence entries, part 200.
3841. gbvrl201.seq - Viral sequence entries, part 201.
3842. gbvrl202.seq - Viral sequence entries, part 202.
3843. gbvrl203.seq - Viral sequence entries, part 203.
3844. gbvrl204.seq - Viral sequence entries, part 204.
3845. gbvrl205.seq - Viral sequence entries, part 205.
3846. gbvrl206.seq - Viral sequence entries, part 206.
3847. gbvrl207.seq - Viral sequence entries, part 207.
3848. gbvrl208.seq - Viral sequence entries, part 208.
3849. gbvrl209.seq - Viral sequence entries, part 209.
3850. gbvrl21.seq - Viral sequence entries, part 21.
3851. gbvrl210.seq - Viral sequence entries, part 210.
3852. gbvrl211.seq - Viral sequence entries, part 211.
3853. gbvrl212.seq - Viral sequence entries, part 212.
3854. gbvrl213.seq - Viral sequence entries, part 213.
3855. gbvrl214.seq - Viral sequence entries, part 214.
3856. gbvrl215.seq - Viral sequence entries, part 215.
3857. gbvrl216.seq - Viral sequence entries, part 216.
3858. gbvrl217.seq - Viral sequence entries, part 217.
3859. gbvrl218.seq - Viral sequence entries, part 218.
3860. gbvrl219.seq - Viral sequence entries, part 219.
3861. gbvrl22.seq - Viral sequence entries, part 22.
3862. gbvrl220.seq - Viral sequence entries, part 220.
3863. gbvrl221.seq - Viral sequence entries, part 221.
3864. gbvrl222.seq - Viral sequence entries, part 222.
3865. gbvrl223.seq - Viral sequence entries, part 223.
3866. gbvrl224.seq - Viral sequence entries, part 224.
3867. gbvrl225.seq - Viral sequence entries, part 225.
3868. gbvrl226.seq - Viral sequence entries, part 226.
3869. gbvrl227.seq - Viral sequence entries, part 227.
3870. gbvrl228.seq - Viral sequence entries, part 228.
3871. gbvrl229.seq - Viral sequence entries, part 229.
3872. gbvrl23.seq - Viral sequence entries, part 23.
3873. gbvrl230.seq - Viral sequence entries, part 230.
3874. gbvrl231.seq - Viral sequence entries, part 231.
3875. gbvrl232.seq - Viral sequence entries, part 232.
3876. gbvrl233.seq - Viral sequence entries, part 233.
3877. gbvrl234.seq - Viral sequence entries, part 234.
3878. gbvrl235.seq - Viral sequence entries, part 235.
3879. gbvrl236.seq - Viral sequence entries, part 236.
3880. gbvrl237.seq - Viral sequence entries, part 237.
3881. gbvrl238.seq - Viral sequence entries, part 238.
3882. gbvrl239.seq - Viral sequence entries, part 239.
3883. gbvrl24.seq - Viral sequence entries, part 24.
3884. gbvrl240.seq - Viral sequence entries, part 240.
3885. gbvrl241.seq - Viral sequence entries, part 241.
3886. gbvrl242.seq - Viral sequence entries, part 242.
3887. gbvrl243.seq - Viral sequence entries, part 243.
3888. gbvrl244.seq - Viral sequence entries, part 244.
3889. gbvrl245.seq - Viral sequence entries, part 245.
3890. gbvrl246.seq - Viral sequence entries, part 246.
3891. gbvrl247.seq - Viral sequence entries, part 247.
3892. gbvrl248.seq - Viral sequence entries, part 248.
3893. gbvrl249.seq - Viral sequence entries, part 249.
3894. gbvrl25.seq - Viral sequence entries, part 25.
3895. gbvrl250.seq - Viral sequence entries, part 250.
3896. gbvrl251.seq - Viral sequence entries, part 251.
3897. gbvrl252.seq - Viral sequence entries, part 252.
3898. gbvrl253.seq - Viral sequence entries, part 253.
3899. gbvrl254.seq - Viral sequence entries, part 254.
3900. gbvrl255.seq - Viral sequence entries, part 255.
3901. gbvrl256.seq - Viral sequence entries, part 256.
3902. gbvrl257.seq - Viral sequence entries, part 257.
3903. gbvrl258.seq - Viral sequence entries, part 258.
3904. gbvrl259.seq - Viral sequence entries, part 259.
3905. gbvrl26.seq - Viral sequence entries, part 26.
3906. gbvrl260.seq - Viral sequence entries, part 260.
3907. gbvrl261.seq - Viral sequence entries, part 261.
3908. gbvrl262.seq - Viral sequence entries, part 262.
3909. gbvrl263.seq - Viral sequence entries, part 263.
3910. gbvrl264.seq - Viral sequence entries, part 264.
3911. gbvrl265.seq - Viral sequence entries, part 265.
3912. gbvrl266.seq - Viral sequence entries, part 266.
3913. gbvrl267.seq - Viral sequence entries, part 267.
3914. gbvrl268.seq - Viral sequence entries, part 268.
3915. gbvrl269.seq - Viral sequence entries, part 269.
3916. gbvrl27.seq - Viral sequence entries, part 27.
3917. gbvrl270.seq - Viral sequence entries, part 270.
3918. gbvrl271.seq - Viral sequence entries, part 271.
3919. gbvrl272.seq - Viral sequence entries, part 272.
3920. gbvrl273.seq - Viral sequence entries, part 273.
3921. gbvrl274.seq - Viral sequence entries, part 274.
3922. gbvrl275.seq - Viral sequence entries, part 275.
3923. gbvrl276.seq - Viral sequence entries, part 276.
3924. gbvrl277.seq - Viral sequence entries, part 277.
3925. gbvrl278.seq - Viral sequence entries, part 278.
3926. gbvrl279.seq - Viral sequence entries, part 279.
3927. gbvrl28.seq - Viral sequence entries, part 28.
3928. gbvrl280.seq - Viral sequence entries, part 280.
3929. gbvrl281.seq - Viral sequence entries, part 281.
3930. gbvrl282.seq - Viral sequence entries, part 282.
3931. gbvrl283.seq - Viral sequence entries, part 283.
3932. gbvrl284.seq - Viral sequence entries, part 284.
3933. gbvrl285.seq - Viral sequence entries, part 285.
3934. gbvrl286.seq - Viral sequence entries, part 286.
3935. gbvrl287.seq - Viral sequence entries, part 287.
3936. gbvrl288.seq - Viral sequence entries, part 288.
3937. gbvrl289.seq - Viral sequence entries, part 289.
3938. gbvrl29.seq - Viral sequence entries, part 29.
3939. gbvrl290.seq - Viral sequence entries, part 290.
3940. gbvrl291.seq - Viral sequence entries, part 291.
3941. gbvrl292.seq - Viral sequence entries, part 292.
3942. gbvrl293.seq - Viral sequence entries, part 293.
3943. gbvrl294.seq - Viral sequence entries, part 294.
3944. gbvrl295.seq - Viral sequence entries, part 295.
3945. gbvrl296.seq - Viral sequence entries, part 296.
3946. gbvrl297.seq - Viral sequence entries, part 297.
3947. gbvrl3.seq - Viral sequence entries, part 3.
3948. gbvrl30.seq - Viral sequence entries, part 30.
3949. gbvrl31.seq - Viral sequence entries, part 31.
3950. gbvrl32.seq - Viral sequence entries, part 32.
3951. gbvrl33.seq - Viral sequence entries, part 33.
3952. gbvrl34.seq - Viral sequence entries, part 34.
3953. gbvrl35.seq - Viral sequence entries, part 35.
3954. gbvrl36.seq - Viral sequence entries, part 36.
3955. gbvrl37.seq - Viral sequence entries, part 37.
3956. gbvrl38.seq - Viral sequence entries, part 38.
3957. gbvrl39.seq - Viral sequence entries, part 39.
3958. gbvrl4.seq - Viral sequence entries, part 4.
3959. gbvrl40.seq - Viral sequence entries, part 40.
3960. gbvrl41.seq - Viral sequence entries, part 41.
3961. gbvrl42.seq - Viral sequence entries, part 42.
3962. gbvrl43.seq - Viral sequence entries, part 43.
3963. gbvrl44.seq - Viral sequence entries, part 44.
3964. gbvrl45.seq - Viral sequence entries, part 45.
3965. gbvrl46.seq - Viral sequence entries, part 46.
3966. gbvrl47.seq - Viral sequence entries, part 47.
3967. gbvrl48.seq - Viral sequence entries, part 48.
3968. gbvrl49.seq - Viral sequence entries, part 49.
3969. gbvrl5.seq - Viral sequence entries, part 5.
3970. gbvrl50.seq - Viral sequence entries, part 50.
3971. gbvrl51.seq - Viral sequence entries, part 51.
3972. gbvrl52.seq - Viral sequence entries, part 52.
3973. gbvrl53.seq - Viral sequence entries, part 53.
3974. gbvrl54.seq - Viral sequence entries, part 54.
3975. gbvrl55.seq - Viral sequence entries, part 55.
3976. gbvrl56.seq - Viral sequence entries, part 56.
3977. gbvrl57.seq - Viral sequence entries, part 57.
3978. gbvrl58.seq - Viral sequence entries, part 58.
3979. gbvrl59.seq - Viral sequence entries, part 59.
3980. gbvrl6.seq - Viral sequence entries, part 6.
3981. gbvrl60.seq - Viral sequence entries, part 60.
3982. gbvrl61.seq - Viral sequence entries, part 61.
3983. gbvrl62.seq - Viral sequence entries, part 62.
3984. gbvrl63.seq - Viral sequence entries, part 63.
3985. gbvrl64.seq - Viral sequence entries, part 64.
3986. gbvrl65.seq - Viral sequence entries, part 65.
3987. gbvrl66.seq - Viral sequence entries, part 66.
3988. gbvrl67.seq - Viral sequence entries, part 67.
3989. gbvrl68.seq - Viral sequence entries, part 68.
3990. gbvrl69.seq - Viral sequence entries, part 69.
3991. gbvrl7.seq - Viral sequence entries, part 7.
3992. gbvrl70.seq - Viral sequence entries, part 70.
3993. gbvrl71.seq - Viral sequence entries, part 71.
3994. gbvrl72.seq - Viral sequence entries, part 72.
3995. gbvrl73.seq - Viral sequence entries, part 73.
3996. gbvrl74.seq - Viral sequence entries, part 74.
3997. gbvrl75.seq - Viral sequence entries, part 75.
3998. gbvrl76.seq - Viral sequence entries, part 76.
3999. gbvrl77.seq - Viral sequence entries, part 77.
4000. gbvrl78.seq - Viral sequence entries, part 78.
4001. gbvrl79.seq - Viral sequence entries, part 79.
4002. gbvrl8.seq - Viral sequence entries, part 8.
4003. gbvrl80.seq - Viral sequence entries, part 80.
4004. gbvrl81.seq - Viral sequence entries, part 81.
4005. gbvrl82.seq - Viral sequence entries, part 82.
4006. gbvrl83.seq - Viral sequence entries, part 83.
4007. gbvrl84.seq - Viral sequence entries, part 84.
4008. gbvrl85.seq - Viral sequence entries, part 85.
4009. gbvrl86.seq - Viral sequence entries, part 86.
4010. gbvrl87.seq - Viral sequence entries, part 87.
4011. gbvrl88.seq - Viral sequence entries, part 88.
4012. gbvrl89.seq - Viral sequence entries, part 89.
4013. gbvrl9.seq - Viral sequence entries, part 9.
4014. gbvrl90.seq - Viral sequence entries, part 90.
4015. gbvrl91.seq - Viral sequence entries, part 91.
4016. gbvrl92.seq - Viral sequence entries, part 92.
4017. gbvrl93.seq - Viral sequence entries, part 93.
4018. gbvrl94.seq - Viral sequence entries, part 94.
4019. gbvrl95.seq - Viral sequence entries, part 95.
4020. gbvrl96.seq - Viral sequence entries, part 96.
4021. gbvrl97.seq - Viral sequence entries, part 97.
4022. gbvrl98.seq - Viral sequence entries, part 98.
4023. gbvrl99.seq - Viral sequence entries, part 99.
4024. gbvrt1.seq - Other vertebrate sequence entries, part 1.
4025. gbvrt10.seq - Other vertebrate sequence entries, part 10.
4026. gbvrt100.seq - Other vertebrate sequence entries, part 100.
4027. gbvrt101.seq - Other vertebrate sequence entries, part 101.
4028. gbvrt102.seq - Other vertebrate sequence entries, part 102.
4029. gbvrt103.seq - Other vertebrate sequence entries, part 103.
4030. gbvrt104.seq - Other vertebrate sequence entries, part 104.
4031. gbvrt105.seq - Other vertebrate sequence entries, part 105.
4032. gbvrt106.seq - Other vertebrate sequence entries, part 106.
4033. gbvrt107.seq - Other vertebrate sequence entries, part 107.
4034. gbvrt108.seq - Other vertebrate sequence entries, part 108.
4035. gbvrt109.seq - Other vertebrate sequence entries, part 109.
4036. gbvrt11.seq - Other vertebrate sequence entries, part 11.
4037. gbvrt110.seq - Other vertebrate sequence entries, part 110.
4038. gbvrt111.seq - Other vertebrate sequence entries, part 111.
4039. gbvrt112.seq - Other vertebrate sequence entries, part 112.
4040. gbvrt113.seq - Other vertebrate sequence entries, part 113.
4041. gbvrt114.seq - Other vertebrate sequence entries, part 114.
4042. gbvrt115.seq - Other vertebrate sequence entries, part 115.
4043. gbvrt116.seq - Other vertebrate sequence entries, part 116.
4044. gbvrt117.seq - Other vertebrate sequence entries, part 117.
4045. gbvrt118.seq - Other vertebrate sequence entries, part 118.
4046. gbvrt119.seq - Other vertebrate sequence entries, part 119.
4047. gbvrt12.seq - Other vertebrate sequence entries, part 12.
4048. gbvrt120.seq - Other vertebrate sequence entries, part 120.
4049. gbvrt121.seq - Other vertebrate sequence entries, part 121.
4050. gbvrt122.seq - Other vertebrate sequence entries, part 122.
4051. gbvrt123.seq - Other vertebrate sequence entries, part 123.
4052. gbvrt124.seq - Other vertebrate sequence entries, part 124.
4053. gbvrt125.seq - Other vertebrate sequence entries, part 125.
4054. gbvrt126.seq - Other vertebrate sequence entries, part 126.
4055. gbvrt127.seq - Other vertebrate sequence entries, part 127.
4056. gbvrt128.seq - Other vertebrate sequence entries, part 128.
4057. gbvrt129.seq - Other vertebrate sequence entries, part 129.
4058. gbvrt13.seq - Other vertebrate sequence entries, part 13.
4059. gbvrt130.seq - Other vertebrate sequence entries, part 130.
4060. gbvrt131.seq - Other vertebrate sequence entries, part 131.
4061. gbvrt132.seq - Other vertebrate sequence entries, part 132.
4062. gbvrt133.seq - Other vertebrate sequence entries, part 133.
4063. gbvrt134.seq - Other vertebrate sequence entries, part 134.
4064. gbvrt135.seq - Other vertebrate sequence entries, part 135.
4065. gbvrt136.seq - Other vertebrate sequence entries, part 136.
4066. gbvrt137.seq - Other vertebrate sequence entries, part 137.
4067. gbvrt138.seq - Other vertebrate sequence entries, part 138.
4068. gbvrt139.seq - Other vertebrate sequence entries, part 139.
4069. gbvrt14.seq - Other vertebrate sequence entries, part 14.
4070. gbvrt140.seq - Other vertebrate sequence entries, part 140.
4071. gbvrt141.seq - Other vertebrate sequence entries, part 141.
4072. gbvrt142.seq - Other vertebrate sequence entries, part 142.
4073. gbvrt143.seq - Other vertebrate sequence entries, part 143.
4074. gbvrt144.seq - Other vertebrate sequence entries, part 144.
4075. gbvrt145.seq - Other vertebrate sequence entries, part 145.
4076. gbvrt146.seq - Other vertebrate sequence entries, part 146.
4077. gbvrt147.seq - Other vertebrate sequence entries, part 147.
4078. gbvrt148.seq - Other vertebrate sequence entries, part 148.
4079. gbvrt149.seq - Other vertebrate sequence entries, part 149.
4080. gbvrt15.seq - Other vertebrate sequence entries, part 15.
4081. gbvrt150.seq - Other vertebrate sequence entries, part 150.
4082. gbvrt151.seq - Other vertebrate sequence entries, part 151.
4083. gbvrt152.seq - Other vertebrate sequence entries, part 152.
4084. gbvrt153.seq - Other vertebrate sequence entries, part 153.
4085. gbvrt154.seq - Other vertebrate sequence entries, part 154.
4086. gbvrt155.seq - Other vertebrate sequence entries, part 155.
4087. gbvrt156.seq - Other vertebrate sequence entries, part 156.
4088. gbvrt157.seq - Other vertebrate sequence entries, part 157.
4089. gbvrt158.seq - Other vertebrate sequence entries, part 158.
4090. gbvrt159.seq - Other vertebrate sequence entries, part 159.
4091. gbvrt16.seq - Other vertebrate sequence entries, part 16.
4092. gbvrt160.seq - Other vertebrate sequence entries, part 160.
4093. gbvrt161.seq - Other vertebrate sequence entries, part 161.
4094. gbvrt162.seq - Other vertebrate sequence entries, part 162.
4095. gbvrt163.seq - Other vertebrate sequence entries, part 163.
4096. gbvrt164.seq - Other vertebrate sequence entries, part 164.
4097. gbvrt165.seq - Other vertebrate sequence entries, part 165.
4098. gbvrt166.seq - Other vertebrate sequence entries, part 166.
4099. gbvrt167.seq - Other vertebrate sequence entries, part 167.
4100. gbvrt168.seq - Other vertebrate sequence entries, part 168.
4101. gbvrt169.seq - Other vertebrate sequence entries, part 169.
4102. gbvrt17.seq - Other vertebrate sequence entries, part 17.
4103. gbvrt170.seq - Other vertebrate sequence entries, part 170.
4104. gbvrt171.seq - Other vertebrate sequence entries, part 171.
4105. gbvrt172.seq - Other vertebrate sequence entries, part 172.
4106. gbvrt173.seq - Other vertebrate sequence entries, part 173.
4107. gbvrt174.seq - Other vertebrate sequence entries, part 174.
4108. gbvrt175.seq - Other vertebrate sequence entries, part 175.
4109. gbvrt176.seq - Other vertebrate sequence entries, part 176.
4110. gbvrt177.seq - Other vertebrate sequence entries, part 177.
4111. gbvrt178.seq - Other vertebrate sequence entries, part 178.
4112. gbvrt179.seq - Other vertebrate sequence entries, part 179.
4113. gbvrt18.seq - Other vertebrate sequence entries, part 18.
4114. gbvrt180.seq - Other vertebrate sequence entries, part 180.
4115. gbvrt181.seq - Other vertebrate sequence entries, part 181.
4116. gbvrt182.seq - Other vertebrate sequence entries, part 182.
4117. gbvrt183.seq - Other vertebrate sequence entries, part 183.
4118. gbvrt184.seq - Other vertebrate sequence entries, part 184.
4119. gbvrt185.seq - Other vertebrate sequence entries, part 185.
4120. gbvrt186.seq - Other vertebrate sequence entries, part 186.
4121. gbvrt187.seq - Other vertebrate sequence entries, part 187.
4122. gbvrt188.seq - Other vertebrate sequence entries, part 188.
4123. gbvrt189.seq - Other vertebrate sequence entries, part 189.
4124. gbvrt19.seq - Other vertebrate sequence entries, part 19.
4125. gbvrt190.seq - Other vertebrate sequence entries, part 190.
4126. gbvrt191.seq - Other vertebrate sequence entries, part 191.
4127. gbvrt192.seq - Other vertebrate sequence entries, part 192.
4128. gbvrt193.seq - Other vertebrate sequence entries, part 193.
4129. gbvrt194.seq - Other vertebrate sequence entries, part 194.
4130. gbvrt195.seq - Other vertebrate sequence entries, part 195.
4131. gbvrt196.seq - Other vertebrate sequence entries, part 196.
4132. gbvrt197.seq - Other vertebrate sequence entries, part 197.
4133. gbvrt198.seq - Other vertebrate sequence entries, part 198.
4134. gbvrt199.seq - Other vertebrate sequence entries, part 199.
4135. gbvrt2.seq - Other vertebrate sequence entries, part 2.
4136. gbvrt20.seq - Other vertebrate sequence entries, part 20.
4137. gbvrt200.seq - Other vertebrate sequence entries, part 200.
4138. gbvrt201.seq - Other vertebrate sequence entries, part 201.
4139. gbvrt202.seq - Other vertebrate sequence entries, part 202.
4140. gbvrt203.seq - Other vertebrate sequence entries, part 203.
4141. gbvrt204.seq - Other vertebrate sequence entries, part 204.
4142. gbvrt205.seq - Other vertebrate sequence entries, part 205.
4143. gbvrt206.seq - Other vertebrate sequence entries, part 206.
4144. gbvrt207.seq - Other vertebrate sequence entries, part 207.
4145. gbvrt208.seq - Other vertebrate sequence entries, part 208.
4146. gbvrt209.seq - Other vertebrate sequence entries, part 209.
4147. gbvrt21.seq - Other vertebrate sequence entries, part 21.
4148. gbvrt210.seq - Other vertebrate sequence entries, part 210.
4149. gbvrt211.seq - Other vertebrate sequence entries, part 211.
4150. gbvrt212.seq - Other vertebrate sequence entries, part 212.
4151. gbvrt213.seq - Other vertebrate sequence entries, part 213.
4152. gbvrt214.seq - Other vertebrate sequence entries, part 214.
4153. gbvrt215.seq - Other vertebrate sequence entries, part 215.
4154. gbvrt216.seq - Other vertebrate sequence entries, part 216.
4155. gbvrt217.seq - Other vertebrate sequence entries, part 217.
4156. gbvrt218.seq - Other vertebrate sequence entries, part 218.
4157. gbvrt219.seq - Other vertebrate sequence entries, part 219.
4158. gbvrt22.seq - Other vertebrate sequence entries, part 22.
4159. gbvrt220.seq - Other vertebrate sequence entries, part 220.
4160. gbvrt221.seq - Other vertebrate sequence entries, part 221.
4161. gbvrt222.seq - Other vertebrate sequence entries, part 222.
4162. gbvrt223.seq - Other vertebrate sequence entries, part 223.
4163. gbvrt224.seq - Other vertebrate sequence entries, part 224.
4164. gbvrt225.seq - Other vertebrate sequence entries, part 225.
4165. gbvrt226.seq - Other vertebrate sequence entries, part 226.
4166. gbvrt227.seq - Other vertebrate sequence entries, part 227.
4167. gbvrt228.seq - Other vertebrate sequence entries, part 228.
4168. gbvrt229.seq - Other vertebrate sequence entries, part 229.
4169. gbvrt23.seq - Other vertebrate sequence entries, part 23.
4170. gbvrt230.seq - Other vertebrate sequence entries, part 230.
4171. gbvrt231.seq - Other vertebrate sequence entries, part 231.
4172. gbvrt232.seq - Other vertebrate sequence entries, part 232.
4173. gbvrt233.seq - Other vertebrate sequence entries, part 233.
4174. gbvrt234.seq - Other vertebrate sequence entries, part 234.
4175. gbvrt235.seq - Other vertebrate sequence entries, part 235.
4176. gbvrt236.seq - Other vertebrate sequence entries, part 236.
4177. gbvrt237.seq - Other vertebrate sequence entries, part 237.
4178. gbvrt238.seq - Other vertebrate sequence entries, part 238.
4179. gbvrt239.seq - Other vertebrate sequence entries, part 239.
4180. gbvrt24.seq - Other vertebrate sequence entries, part 24.
4181. gbvrt240.seq - Other vertebrate sequence entries, part 240.
4182. gbvrt241.seq - Other vertebrate sequence entries, part 241.
4183. gbvrt242.seq - Other vertebrate sequence entries, part 242.
4184. gbvrt243.seq - Other vertebrate sequence entries, part 243.
4185. gbvrt244.seq - Other vertebrate sequence entries, part 244.
4186. gbvrt245.seq - Other vertebrate sequence entries, part 245.
4187. gbvrt246.seq - Other vertebrate sequence entries, part 246.
4188. gbvrt247.seq - Other vertebrate sequence entries, part 247.
4189. gbvrt248.seq - Other vertebrate sequence entries, part 248.
4190. gbvrt249.seq - Other vertebrate sequence entries, part 249.
4191. gbvrt25.seq - Other vertebrate sequence entries, part 25.
4192. gbvrt250.seq - Other vertebrate sequence entries, part 250.
4193. gbvrt251.seq - Other vertebrate sequence entries, part 251.
4194. gbvrt252.seq - Other vertebrate sequence entries, part 252.
4195. gbvrt253.seq - Other vertebrate sequence entries, part 253.
4196. gbvrt254.seq - Other vertebrate sequence entries, part 254.
4197. gbvrt255.seq - Other vertebrate sequence entries, part 255.
4198. gbvrt256.seq - Other vertebrate sequence entries, part 256.
4199. gbvrt257.seq - Other vertebrate sequence entries, part 257.
4200. gbvrt258.seq - Other vertebrate sequence entries, part 258.
4201. gbvrt259.seq - Other vertebrate sequence entries, part 259.
4202. gbvrt26.seq - Other vertebrate sequence entries, part 26.
4203. gbvrt260.seq - Other vertebrate sequence entries, part 260.
4204. gbvrt261.seq - Other vertebrate sequence entries, part 261.
4205. gbvrt262.seq - Other vertebrate sequence entries, part 262.
4206. gbvrt263.seq - Other vertebrate sequence entries, part 263.
4207. gbvrt264.seq - Other vertebrate sequence entries, part 264.
4208. gbvrt265.seq - Other vertebrate sequence entries, part 265.
4209. gbvrt266.seq - Other vertebrate sequence entries, part 266.
4210. gbvrt267.seq - Other vertebrate sequence entries, part 267.
4211. gbvrt268.seq - Other vertebrate sequence entries, part 268.
4212. gbvrt269.seq - Other vertebrate sequence entries, part 269.
4213. gbvrt27.seq - Other vertebrate sequence entries, part 27.
4214. gbvrt270.seq - Other vertebrate sequence entries, part 270.
4215. gbvrt271.seq - Other vertebrate sequence entries, part 271.
4216. gbvrt272.seq - Other vertebrate sequence entries, part 272.
4217. gbvrt273.seq - Other vertebrate sequence entries, part 273.
4218. gbvrt274.seq - Other vertebrate sequence entries, part 274.
4219. gbvrt275.seq - Other vertebrate sequence entries, part 275.
4220. gbvrt276.seq - Other vertebrate sequence entries, part 276.
4221. gbvrt277.seq - Other vertebrate sequence entries, part 277.
4222. gbvrt28.seq - Other vertebrate sequence entries, part 28.
4223. gbvrt29.seq - Other vertebrate sequence entries, part 29.
4224. gbvrt3.seq - Other vertebrate sequence entries, part 3.
4225. gbvrt30.seq - Other vertebrate sequence entries, part 30.
4226. gbvrt31.seq - Other vertebrate sequence entries, part 31.
4227. gbvrt32.seq - Other vertebrate sequence entries, part 32.
4228. gbvrt33.seq - Other vertebrate sequence entries, part 33.
4229. gbvrt34.seq - Other vertebrate sequence entries, part 34.
4230. gbvrt35.seq - Other vertebrate sequence entries, part 35.
4231. gbvrt36.seq - Other vertebrate sequence entries, part 36.
4232. gbvrt37.seq - Other vertebrate sequence entries, part 37.
4233. gbvrt38.seq - Other vertebrate sequence entries, part 38.
4234. gbvrt39.seq - Other vertebrate sequence entries, part 39.
4235. gbvrt4.seq - Other vertebrate sequence entries, part 4.
4236. gbvrt40.seq - Other vertebrate sequence entries, part 40.
4237. gbvrt41.seq - Other vertebrate sequence entries, part 41.
4238. gbvrt42.seq - Other vertebrate sequence entries, part 42.
4239. gbvrt43.seq - Other vertebrate sequence entries, part 43.
4240. gbvrt44.seq - Other vertebrate sequence entries, part 44.
4241. gbvrt45.seq - Other vertebrate sequence entries, part 45.
4242. gbvrt46.seq - Other vertebrate sequence entries, part 46.
4243. gbvrt47.seq - Other vertebrate sequence entries, part 47.
4244. gbvrt48.seq - Other vertebrate sequence entries, part 48.
4245. gbvrt49.seq - Other vertebrate sequence entries, part 49.
4246. gbvrt5.seq - Other vertebrate sequence entries, part 5.
4247. gbvrt50.seq - Other vertebrate sequence entries, part 50.
4248. gbvrt51.seq - Other vertebrate sequence entries, part 51.
4249. gbvrt52.seq - Other vertebrate sequence entries, part 52.
4250. gbvrt53.seq - Other vertebrate sequence entries, part 53.
4251. gbvrt54.seq - Other vertebrate sequence entries, part 54.
4252. gbvrt55.seq - Other vertebrate sequence entries, part 55.
4253. gbvrt56.seq - Other vertebrate sequence entries, part 56.
4254. gbvrt57.seq - Other vertebrate sequence entries, part 57.
4255. gbvrt58.seq - Other vertebrate sequence entries, part 58.
4256. gbvrt59.seq - Other vertebrate sequence entries, part 59.
4257. gbvrt6.seq - Other vertebrate sequence entries, part 6.
4258. gbvrt60.seq - Other vertebrate sequence entries, part 60.
4259. gbvrt61.seq - Other vertebrate sequence entries, part 61.
4260. gbvrt62.seq - Other vertebrate sequence entries, part 62.
4261. gbvrt63.seq - Other vertebrate sequence entries, part 63.
4262. gbvrt64.seq - Other vertebrate sequence entries, part 64.
4263. gbvrt65.seq - Other vertebrate sequence entries, part 65.
4264. gbvrt66.seq - Other vertebrate sequence entries, part 66.
4265. gbvrt67.seq - Other vertebrate sequence entries, part 67.
4266. gbvrt68.seq - Other vertebrate sequence entries, part 68.
4267. gbvrt69.seq - Other vertebrate sequence entries, part 69.
4268. gbvrt7.seq - Other vertebrate sequence entries, part 7.
4269. gbvrt70.seq - Other vertebrate sequence entries, part 70.
4270. gbvrt71.seq - Other vertebrate sequence entries, part 71.
4271. gbvrt72.seq - Other vertebrate sequence entries, part 72.
4272. gbvrt73.seq - Other vertebrate sequence entries, part 73.
4273. gbvrt74.seq - Other vertebrate sequence entries, part 74.
4274. gbvrt75.seq - Other vertebrate sequence entries, part 75.
4275. gbvrt76.seq - Other vertebrate sequence entries, part 76.
4276. gbvrt77.seq - Other vertebrate sequence entries, part 77.
4277. gbvrt78.seq - Other vertebrate sequence entries, part 78.
4278. gbvrt79.seq - Other vertebrate sequence entries, part 79.
4279. gbvrt8.seq - Other vertebrate sequence entries, part 8.
4280. gbvrt80.seq - Other vertebrate sequence entries, part 80.
4281. gbvrt81.seq - Other vertebrate sequence entries, part 81.
4282. gbvrt82.seq - Other vertebrate sequence entries, part 82.
4283. gbvrt83.seq - Other vertebrate sequence entries, part 83.
4284. gbvrt84.seq - Other vertebrate sequence entries, part 84.
4285. gbvrt85.seq - Other vertebrate sequence entries, part 85.
4286. gbvrt86.seq - Other vertebrate sequence entries, part 86.
4287. gbvrt87.seq - Other vertebrate sequence entries, part 87.
4288. gbvrt88.seq - Other vertebrate sequence entries, part 88.
4289. gbvrt89.seq - Other vertebrate sequence entries, part 89.
4290. gbvrt9.seq - Other vertebrate sequence entries, part 9.
4291. gbvrt90.seq - Other vertebrate sequence entries, part 90.
4292. gbvrt91.seq - Other vertebrate sequence entries, part 91.
4293. gbvrt92.seq - Other vertebrate sequence entries, part 92.
4294. gbvrt93.seq - Other vertebrate sequence entries, part 93.
4295. gbvrt94.seq - Other vertebrate sequence entries, part 94.
4296. gbvrt95.seq - Other vertebrate sequence entries, part 95.
4297. gbvrt96.seq - Other vertebrate sequence entries, part 96.
4298. gbvrt97.seq - Other vertebrate sequence entries, part 97.
4299. gbvrt98.seq - Other vertebrate sequence entries, part 98.
4300. gbvrt99.seq - Other vertebrate sequence entries, part 99.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 246.0 flatfiles require roughly 2007 GB, including the sequence files and the *.txt files.

  The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 499234897     gbbct1.seq
 496612972     gbbct10.seq
 499323616     gbbct100.seq
 499932129     gbbct101.seq
 389028332     gbbct102.seq
 499874269     gbbct103.seq
 498124390     gbbct104.seq
 499292542     gbbct105.seq
 491408242     gbbct106.seq
  13752576     gbbct107.seq
 493589471     gbbct108.seq
 494745668     gbbct109.seq
 498136887     gbbct11.seq
 495416736     gbbct110.seq
 491069744     gbbct111.seq
 195549944     gbbct112.seq
 494137200     gbbct113.seq
 492532488     gbbct114.seq
 493222611     gbbct115.seq
 497237543     gbbct116.seq
  99480399     gbbct117.seq
 499009910     gbbct118.seq
 494100520     gbbct119.seq
 498756057     gbbct12.seq
 498830163     gbbct120.seq
 333297898     gbbct121.seq
 490710542     gbbct122.seq
 498618623     gbbct123.seq
 499996356     gbbct124.seq
 426871650     gbbct125.seq
 491476188     gbbct126.seq
 489083430     gbbct127.seq
 487156063     gbbct128.seq
 498575649     gbbct129.seq
  27848759     gbbct13.seq
 490822555     gbbct130.seq
 488628042     gbbct131.seq
 425698035     gbbct132.seq
 498287339     gbbct133.seq
 489448148     gbbct134.seq
 499734618     gbbct135.seq
 461301891     gbbct136.seq
 495776368     gbbct137.seq
 493829169     gbbct138.seq
 491660818     gbbct139.seq
 499887543     gbbct14.seq
 498685040     gbbct140.seq
 499805976     gbbct141.seq
 147979251     gbbct142.seq
 496896672     gbbct143.seq
 494838895     gbbct144.seq
 493251433     gbbct145.seq
 494975862     gbbct146.seq
 404787544     gbbct147.seq
 489367404     gbbct148.seq
 490446699     gbbct149.seq
 496454369     gbbct15.seq
 498396046     gbbct150.seq
 497203879     gbbct151.seq
 492635428     gbbct152.seq
 341076520     gbbct153.seq
 497655653     gbbct154.seq
 494967354     gbbct155.seq
 496951771     gbbct156.seq
 489042983     gbbct157.seq
 493287270     gbbct158.seq
 496052394     gbbct159.seq
 496649064     gbbct16.seq
 159717876     gbbct160.seq
 494730826     gbbct161.seq
 491513943     gbbct162.seq
 495159906     gbbct163.seq
 475148166     gbbct164.seq
 497456269     gbbct165.seq
 493190155     gbbct166.seq
 492198857     gbbct167.seq
 491123378     gbbct168.seq
 493968225     gbbct169.seq
 492261760     gbbct17.seq
 489220550     gbbct170.seq
 497866317     gbbct171.seq
 493887435     gbbct172.seq
 185980561     gbbct173.seq
 493674813     gbbct174.seq
 491173480     gbbct175.seq
 499374985     gbbct176.seq
 273475546     gbbct177.seq
 495005879     gbbct178.seq
 495931571     gbbct179.seq
  10689912     gbbct18.seq
 489789940     gbbct180.seq
 303707273     gbbct181.seq
 499225441     gbbct182.seq
 489058588     gbbct183.seq
 495424960     gbbct184.seq
 496021636     gbbct185.seq
  67162117     gbbct186.seq
 498036458     gbbct187.seq
 497779313     gbbct188.seq
 496082440     gbbct189.seq
 498897840     gbbct19.seq
 496491370     gbbct190.seq
 499746791     gbbct191.seq
 192261371     gbbct192.seq
 498767447     gbbct193.seq
 497238586     gbbct194.seq
 493962311     gbbct195.seq
 497330044     gbbct196.seq
 275862662     gbbct197.seq
 495095244     gbbct198.seq
 497997142     gbbct199.seq
 497213539     gbbct2.seq
 494174617     gbbct20.seq
 499947869     gbbct200.seq
 492734062     gbbct201.seq
 234727325     gbbct202.seq
 499816748     gbbct203.seq
 497425857     gbbct204.seq
 497029279     gbbct205.seq
 484791432     gbbct206.seq
 440229834     gbbct207.seq
 499900154     gbbct208.seq
 496011487     gbbct209.seq
 499428738     gbbct21.seq
 481293122     gbbct210.seq
 496168589     gbbct211.seq
 495262198     gbbct212.seq
 499946264     gbbct213.seq
 318928575     gbbct214.seq
 497109606     gbbct215.seq
 493797184     gbbct216.seq
 496714661     gbbct217.seq
 378276688     gbbct218.seq
 484833376     gbbct219.seq
 494261825     gbbct22.seq
 495646128     gbbct220.seq
 499614873     gbbct221.seq
 497011144     gbbct222.seq
 228371517     gbbct223.seq
 493986934     gbbct224.seq
 489510176     gbbct225.seq
 488962596     gbbct226.seq
 173356905     gbbct227.seq
 493892217     gbbct228.seq
 492907138     gbbct229.seq
  65823481     gbbct23.seq
 493520366     gbbct230.seq
 496872199     gbbct231.seq
 136681481     gbbct232.seq
 494063240     gbbct233.seq
 488279901     gbbct234.seq
 489824761     gbbct235.seq
 489986531     gbbct236.seq
 145652118     gbbct237.seq
 483161557     gbbct238.seq
 496790511     gbbct239.seq
 492477094     gbbct24.seq
 489570535     gbbct240.seq
 446055765     gbbct241.seq
 492193715     gbbct242.seq
 487559480     gbbct243.seq
 492443952     gbbct244.seq
 457216254     gbbct245.seq
 499715547     gbbct246.seq
 495907353     gbbct247.seq
 494166515     gbbct248.seq
 494502548     gbbct249.seq
 490123494     gbbct25.seq
 494779438     gbbct250.seq
 100302076     gbbct251.seq
 491982962     gbbct252.seq
 488305385     gbbct253.seq
 484960307     gbbct254.seq
 448261370     gbbct255.seq
 496469952     gbbct256.seq
 495798176     gbbct257.seq
 499577645     gbbct258.seq
 448624123     gbbct259.seq
 498214368     gbbct26.seq
 496061025     gbbct260.seq
 499419637     gbbct261.seq
 488827306     gbbct262.seq
 496557238     gbbct263.seq
 496528823     gbbct264.seq
 497206896     gbbct265.seq
 157062352     gbbct266.seq
 491162801     gbbct267.seq
 488410493     gbbct268.seq
 497409194     gbbct269.seq
 497674028     gbbct27.seq
 495126997     gbbct270.seq
  24400806     gbbct271.seq
 497188850     gbbct272.seq
 496648193     gbbct273.seq
 496913595     gbbct274.seq
 458244211     gbbct275.seq
 498861913     gbbct276.seq
 493444366     gbbct277.seq
 499643473     gbbct278.seq
 486051956     gbbct279.seq
 196408670     gbbct28.seq
 492090803     gbbct280.seq
 498417678     gbbct281.seq
 498412099     gbbct282.seq
 481644680     gbbct283.seq
 487661704     gbbct284.seq
 490839761     gbbct285.seq
 497466688     gbbct286.seq
 496514153     gbbct287.seq
 498703281     gbbct288.seq
 491042232     gbbct289.seq
 497340221     gbbct29.seq
 243311387     gbbct290.seq
 492633179     gbbct291.seq
 498721787     gbbct292.seq
 496314451     gbbct293.seq
 495823905     gbbct294.seq
 358381782     gbbct295.seq
 498732025     gbbct296.seq
 495863990     gbbct297.seq
 496227335     gbbct298.seq
 496935580     gbbct299.seq
 301450432     gbbct3.seq
 497861500     gbbct30.seq
 387482481     gbbct300.seq
 494855962     gbbct301.seq
 494741550     gbbct302.seq
 499982679     gbbct303.seq
 489769251     gbbct304.seq
 413162739     gbbct305.seq
 498784828     gbbct306.seq
 492287586     gbbct307.seq
 498548275     gbbct308.seq
 496011550     gbbct309.seq
 499962340     gbbct31.seq
 374916064     gbbct310.seq
 491216900     gbbct311.seq
 497116159     gbbct312.seq
 497052272     gbbct313.seq
 494542358     gbbct314.seq
 433978275     gbbct315.seq
 497529581     gbbct316.seq
 493929686     gbbct317.seq
 499363468     gbbct318.seq
 496245307     gbbct319.seq
 460837757     gbbct32.seq
 232180401     gbbct320.seq
 495594076     gbbct321.seq
 498469779     gbbct322.seq
 492943296     gbbct323.seq
 495557352     gbbct324.seq
 409376191     gbbct325.seq
 490874656     gbbct326.seq
 499740377     gbbct327.seq
 495156285     gbbct328.seq
 496472875     gbbct329.seq
 499615969     gbbct33.seq
 497532841     gbbct330.seq
 497318172     gbbct331.seq
 494052635     gbbct332.seq
 200007003     gbbct333.seq
 488777153     gbbct334.seq
 496209188     gbbct335.seq
 492687703     gbbct336.seq
 495895744     gbbct337.seq
 492154954     gbbct338.seq
 495701034     gbbct339.seq
 496631634     gbbct34.seq
 200905335     gbbct340.seq
 493830573     gbbct341.seq
 499628384     gbbct342.seq
 499948901     gbbct343.seq
 499387160     gbbct344.seq
 346576950     gbbct345.seq
 497564972     gbbct346.seq
 499825715     gbbct347.seq
 490103674     gbbct348.seq
 486817335     gbbct349.seq
 483651980     gbbct35.seq
 496051375     gbbct350.seq
 499501315     gbbct351.seq
 495843837     gbbct352.seq
   6565056     gbbct353.seq
 488617852     gbbct354.seq
 488289413     gbbct355.seq
 497016570     gbbct356.seq
 495367457     gbbct357.seq
 496591230     gbbct358.seq
 496020279     gbbct359.seq
 493335811     gbbct36.seq
 499426865     gbbct360.seq
 405332294     gbbct361.seq
 492034094     gbbct362.seq
 496395987     gbbct363.seq
 492762552     gbbct364.seq
 498390502     gbbct365.seq
 493564294     gbbct366.seq
 491470306     gbbct367.seq
  78679756     gbbct368.seq
 497084397     gbbct369.seq
 195358983     gbbct37.seq
 496693501     gbbct370.seq
 498025703     gbbct371.seq
 495750007     gbbct372.seq
 492102525     gbbct373.seq
 496668765     gbbct374.seq
 186463751     gbbct375.seq
 490502559     gbbct376.seq
 498185513     gbbct377.seq
 493195269     gbbct378.seq
 498843008     gbbct379.seq
  21418277     gbbct38.seq
 497203072     gbbct380.seq
 175983756     gbbct381.seq
 495693150     gbbct382.seq
 493701094     gbbct383.seq
 497742269     gbbct384.seq
 495114019     gbbct385.seq
 490532237     gbbct386.seq
 400797089     gbbct387.seq
 496813525     gbbct388.seq
 491384339     gbbct389.seq
  38668516     gbbct39.seq
 497873400     gbbct390.seq
 497522429     gbbct391.seq
 493728622     gbbct392.seq
 497921726     gbbct393.seq
 238815277     gbbct394.seq
 491413607     gbbct395.seq
 493169219     gbbct396.seq
 496244589     gbbct397.seq
 495287675     gbbct398.seq
 142636038     gbbct399.seq
 394591917     gbbct4.seq
 499502480     gbbct40.seq
 484011793     gbbct400.seq
 494094084     gbbct401.seq
 498211901     gbbct402.seq
 498467154     gbbct403.seq
 365379026     gbbct404.seq
 497735880     gbbct405.seq
 495588339     gbbct406.seq
 492255060     gbbct407.seq
 492577616     gbbct408.seq
 219936540     gbbct409.seq
 495939533     gbbct41.seq
 493594456     gbbct410.seq
 495578005     gbbct411.seq
 495904337     gbbct412.seq
 493958459     gbbct413.seq
 147493883     gbbct414.seq
 499863800     gbbct415.seq
 493319153     gbbct416.seq
 487924111     gbbct417.seq
 497771554     gbbct418.seq
  24099917     gbbct419.seq
 497800129     gbbct42.seq
 494159595     gbbct420.seq
 498759724     gbbct421.seq
 498971511     gbbct422.seq
 487259151     gbbct423.seq
 493426836     gbbct424.seq
 490784917     gbbct425.seq
 494689373     gbbct426.seq
 498374330     gbbct427.seq
 494559174     gbbct428.seq
 209364910     gbbct429.seq
 446397852     gbbct43.seq
 496499347     gbbct430.seq
 497253734     gbbct431.seq
 490426322     gbbct432.seq
 492330463     gbbct433.seq
 396148312     gbbct434.seq
 492735251     gbbct435.seq
 491656765     gbbct436.seq
 498341617     gbbct437.seq
 492422446     gbbct438.seq
 497905612     gbbct439.seq
 497462657     gbbct44.seq
 495138142     gbbct440.seq
  26230258     gbbct441.seq
 494893466     gbbct442.seq
 494078251     gbbct443.seq
 497059308     gbbct444.seq
 497396363     gbbct445.seq
 495243357     gbbct446.seq
 488504124     gbbct447.seq
 104823772     gbbct448.seq
 488323919     gbbct449.seq
 491183857     gbbct45.seq
 497533445     gbbct450.seq
 493548787     gbbct451.seq
 499403246     gbbct452.seq
 490775893     gbbct453.seq
 457647469     gbbct454.seq
 494298014     gbbct455.seq
 493347926     gbbct456.seq
 495710628     gbbct457.seq
 488826899     gbbct458.seq
 115773966     gbbct459.seq
 499083038     gbbct46.seq
 496594591     gbbct460.seq
 499149918     gbbct461.seq
 499123699     gbbct462.seq
 499944947     gbbct463.seq
 490800842     gbbct464.seq
 494863642     gbbct465.seq
 248271804     gbbct466.seq
 490780668     gbbct467.seq
 497766210     gbbct468.seq
 484417968     gbbct469.seq
 495738195     gbbct47.seq
 495452245     gbbct470.seq
 496603218     gbbct471.seq
 428583991     gbbct472.seq
 489158914     gbbct473.seq
 489835631     gbbct474.seq
 497845923     gbbct475.seq
 495450803     gbbct476.seq
 497974139     gbbct477.seq
 300530818     gbbct478.seq
 499164300     gbbct479.seq
 488459737     gbbct48.seq
 487164463     gbbct480.seq
 495032202     gbbct481.seq
 492975508     gbbct482.seq
 495030691     gbbct483.seq
 494982874     gbbct484.seq
 172358845     gbbct485.seq
 496001919     gbbct486.seq
 497948551     gbbct487.seq
 498127558     gbbct488.seq
 496935116     gbbct489.seq
 274679466     gbbct49.seq
 489182512     gbbct490.seq
 302609864     gbbct491.seq
 486521028     gbbct492.seq
 497043011     gbbct493.seq
 496608354     gbbct494.seq
 497948073     gbbct495.seq
 497210727     gbbct496.seq
 141670823     gbbct497.seq
 497236329     gbbct498.seq
 495438245     gbbct499.seq
 459634361     gbbct5.seq
 496358757     gbbct50.seq
 499312665     gbbct500.seq
 498625423     gbbct501.seq
 294683024     gbbct502.seq
 495964841     gbbct503.seq
 496897841     gbbct504.seq
 492532539     gbbct505.seq
 490565418     gbbct506.seq
 493106885     gbbct507.seq
 412643119     gbbct508.seq
 491799332     gbbct509.seq
 499742184     gbbct51.seq
 496307540     gbbct510.seq
 484604599     gbbct511.seq
 494026976     gbbct512.seq
 300742897     gbbct513.seq
 495818350     gbbct514.seq
 494009730     gbbct515.seq
 492317456     gbbct516.seq
 497436360     gbbct517.seq
 353315866     gbbct518.seq
 497777355     gbbct519.seq
 499660450     gbbct52.seq
 497925020     gbbct520.seq
 498555593     gbbct521.seq
 491177161     gbbct522.seq
 439916343     gbbct523.seq
 490256030     gbbct524.seq
 495352231     gbbct525.seq
 490394456     gbbct526.seq
 494634564     gbbct527.seq
 487620662     gbbct528.seq
 495434748     gbbct529.seq
 499517350     gbbct53.seq
 494507804     gbbct530.seq
 495235220     gbbct531.seq
 495110326     gbbct532.seq
 408828796     gbbct533.seq
 496032922     gbbct534.seq
 498948443     gbbct535.seq
 493870765     gbbct536.seq
 491317535     gbbct537.seq
 439402608     gbbct538.seq
 492718523     gbbct539.seq
 491852127     gbbct54.seq
 488680115     gbbct540.seq
 492109494     gbbct541.seq
 494052211     gbbct542.seq
 468205713     gbbct543.seq
 491627518     gbbct544.seq
 498331208     gbbct545.seq
 496437664     gbbct546.seq
 498087829     gbbct547.seq
 497891318     gbbct548.seq
 287142338     gbbct549.seq
 327207260     gbbct55.seq
 492008709     gbbct550.seq
 496332307     gbbct551.seq
 490514779     gbbct552.seq
 497412171     gbbct553.seq
 260293428     gbbct554.seq
 489172478     gbbct555.seq
 495720252     gbbct556.seq
 496548381     gbbct557.seq
 499361161     gbbct558.seq
 496540837     gbbct559.seq
 499974669     gbbct56.seq
 255950384     gbbct560.seq
 488170255     gbbct561.seq
 491595512     gbbct562.seq
 490701686     gbbct563.seq
 493765682     gbbct564.seq
 127989549     gbbct565.seq
 489160964     gbbct566.seq
 497105679     gbbct567.seq
 490260756     gbbct568.seq
 498248896     gbbct569.seq
 492293158     gbbct57.seq
 499249289     gbbct570.seq
 497066149     gbbct571.seq
  10015832     gbbct572.seq
 498933073     gbbct573.seq
 492435699     gbbct574.seq
 491121953     gbbct575.seq
 493859119     gbbct576.seq
  94454566     gbbct577.seq
 498783711     gbbct578.seq
 496945414     gbbct579.seq
 489450213     gbbct58.seq
 494511356     gbbct580.seq
 496529140     gbbct581.seq
 489519713     gbbct582.seq
 496952213     gbbct583.seq
 499667599     gbbct584.seq
 491525465     gbbct585.seq
 498403592     gbbct586.seq
 498104017     gbbct587.seq
 112960962     gbbct588.seq
 305795224     gbbct589.seq
 497371462     gbbct59.seq
   6889808     gbbct590.seq
  14165236     gbbct591.seq
  22794824     gbbct592.seq
  44484418     gbbct593.seq
  86600715     gbbct594.seq
 168525867     gbbct595.seq
 499999600     gbbct596.seq
 492597518     gbbct597.seq
 499476364     gbbct598.seq
 499965227     gbbct599.seq
 102230707     gbbct6.seq
 499930194     gbbct60.seq
 498193526     gbbct600.seq
 499994647     gbbct601.seq
 130863950     gbbct602.seq
 493348442     gbbct603.seq
 499342583     gbbct604.seq
 499949827     gbbct605.seq
 499997034     gbbct606.seq
 172217652     gbbct607.seq
 499999053     gbbct608.seq
 290267664     gbbct609.seq
 495180468     gbbct61.seq
 499998200     gbbct610.seq
  85284066     gbbct611.seq
 499997468     gbbct612.seq
 125161778     gbbct613.seq
 500000237     gbbct614.seq
  44424708     gbbct615.seq
 146502188     gbbct616.seq
 499915458     gbbct617.seq
 495555686     gbbct618.seq
 497109676     gbbct619.seq
 112142395     gbbct62.seq
 489924846     gbbct620.seq
 493049406     gbbct621.seq
 497932927     gbbct622.seq
 497254245     gbbct623.seq
 488463861     gbbct624.seq
 305471094     gbbct625.seq
 495496716     gbbct626.seq
 498011043     gbbct627.seq
 498176306     gbbct628.seq
 168612832     gbbct629.seq
 494607611     gbbct63.seq
 472461242     gbbct630.seq
 497338312     gbbct631.seq
 497109136     gbbct632.seq
 499752939     gbbct633.seq
 126536198     gbbct634.seq
 488189921     gbbct635.seq
 495948532     gbbct636.seq
 495751489     gbbct637.seq
 330365945     gbbct638.seq
 498499361     gbbct639.seq
 499071306     gbbct64.seq
 497461802     gbbct640.seq
 491450723     gbbct641.seq
 325905521     gbbct642.seq
 496306969     gbbct643.seq
 497541958     gbbct644.seq
 499034930     gbbct645.seq
 243470279     gbbct646.seq
 492624326     gbbct647.seq
 496920887     gbbct648.seq
 498725996     gbbct649.seq
 496563599     gbbct65.seq
 498558962     gbbct650.seq
 105681527     gbbct651.seq
 496393561     gbbct652.seq
 489823083     gbbct653.seq
 498850275     gbbct654.seq
 457159465     gbbct655.seq
  51228427     gbbct656.seq
 107817606     gbbct657.seq
 499918778     gbbct658.seq
 499999225     gbbct659.seq
 497567549     gbbct66.seq
 499997142     gbbct660.seq
 499998314     gbbct661.seq
 499160722     gbbct662.seq
 257709943     gbbct663.seq
 499752485     gbbct67.seq
 490382242     gbbct68.seq
 257412822     gbbct69.seq
 282434856     gbbct7.seq
 499969290     gbbct70.seq
 495193617     gbbct71.seq
 486287619     gbbct72.seq
 493007129     gbbct73.seq
 475858045     gbbct74.seq
 490138106     gbbct75.seq
 485838276     gbbct76.seq
 497985735     gbbct77.seq
 498936922     gbbct78.seq
 306897163     gbbct79.seq
 493057050     gbbct8.seq
 491474134     gbbct80.seq
 494313903     gbbct81.seq
 495819854     gbbct82.seq
 498720135     gbbct83.seq
 499103525     gbbct84.seq
 261686681     gbbct85.seq
 498131174     gbbct86.seq
 499517842     gbbct87.seq
 498962621     gbbct88.seq
 488107727     gbbct89.seq
 493341951     gbbct9.seq
 397950576     gbbct90.seq
 498261521     gbbct91.seq
 492775526     gbbct92.seq
 495523568     gbbct93.seq
 300972590     gbbct94.seq
 499886211     gbbct95.seq
 495464494     gbbct96.seq
 496856418     gbbct97.seq
  74937857     gbbct98.seq
 489628381     gbbct99.seq
   1215460     gbchg.txt
 499829089     gbcon1.seq
 499996944     gbcon10.seq
 499999046     gbcon100.seq
 499995174     gbcon101.seq
 169085272     gbcon102.seq
 499870515     gbcon103.seq
 498434527     gbcon104.seq
 499996134     gbcon105.seq
 499909973     gbcon106.seq
 295510103     gbcon107.seq
 499999656     gbcon108.seq
 499998885     gbcon109.seq
 498633713     gbcon11.seq
 302127481     gbcon110.seq
 499998740     gbcon111.seq
 499998869     gbcon112.seq
 129719889     gbcon113.seq
 499879850     gbcon114.seq
 499997736     gbcon115.seq
 499541839     gbcon116.seq
 277040753     gbcon117.seq
 499999876     gbcon118.seq
 499999395     gbcon119.seq
 499993433     gbcon12.seq
 222253215     gbcon120.seq
  45836617     gbcon121.seq
 499942540     gbcon122.seq
 499998578     gbcon123.seq
 447238322     gbcon124.seq
 499998009     gbcon125.seq
 499997822     gbcon126.seq
 499991213     gbcon127.seq
 196447274     gbcon128.seq
 499995599     gbcon129.seq
 498148072     gbcon13.seq
 499998307     gbcon130.seq
 238753423     gbcon131.seq
 499998967     gbcon132.seq
 466835800     gbcon133.seq
 499998616     gbcon134.seq
 499997635     gbcon135.seq
 258859804     gbcon136.seq
 500000241     gbcon137.seq
 500000076     gbcon138.seq
 497440535     gbcon139.seq
 496523069     gbcon14.seq
 499999139     gbcon140.seq
 499997145     gbcon141.seq
 179142419     gbcon142.seq
 499998502     gbcon143.seq
 499999166     gbcon144.seq
  22645865     gbcon145.seq
 499889958     gbcon146.seq
 499998779     gbcon147.seq
 410561272     gbcon148.seq
 499942667     gbcon149.seq
 498686185     gbcon15.seq
 499908953     gbcon150.seq
 376962145     gbcon151.seq
 499993470     gbcon152.seq
 499962915     gbcon153.seq
 264123217     gbcon154.seq
 499999348     gbcon155.seq
 499998024     gbcon156.seq
  81972538     gbcon157.seq
 499997713     gbcon158.seq
 499889797     gbcon159.seq
 499918078     gbcon16.seq
 499994720     gbcon160.seq
 141101720     gbcon161.seq
 499830763     gbcon162.seq
 499983832     gbcon163.seq
 499968068     gbcon164.seq
 336326273     gbcon165.seq
 499999604     gbcon166.seq
 499979048     gbcon167.seq
 398551763     gbcon168.seq
 499999531     gbcon169.seq
 496596370     gbcon17.seq
 499999335     gbcon170.seq
 499997649     gbcon171.seq
 271482842     gbcon172.seq
 499999711     gbcon173.seq
 499999650     gbcon174.seq
 499386113     gbcon175.seq
 499999294     gbcon176.seq
 154734611     gbcon177.seq
 500000243     gbcon178.seq
 499997549     gbcon179.seq
 499859891     gbcon18.seq
 137298577     gbcon180.seq
 499992726     gbcon181.seq
 499997814     gbcon182.seq
 499998661     gbcon183.seq
 302177094     gbcon184.seq
 499943322     gbcon185.seq
 499997155     gbcon186.seq
 478528460     gbcon187.seq
 499996887     gbcon188.seq
 499981253     gbcon189.seq
 150679446     gbcon19.seq
 397710774     gbcon190.seq
 499934774     gbcon191.seq
 499994397     gbcon192.seq
 499979529     gbcon193.seq
 156248302     gbcon194.seq
 499998392     gbcon195.seq
 499998372     gbcon196.seq
  37871910     gbcon197.seq
 499997011     gbcon198.seq
 500000246     gbcon199.seq
 499999210     gbcon2.seq
 499997687     gbcon20.seq
 499998611     gbcon200.seq
 500000201     gbcon201.seq
 499951306     gbcon202.seq
 266805595     gbcon203.seq
 499999224     gbcon204.seq
 452407112     gbcon205.seq
 499990515     gbcon206.seq
 499996980     gbcon207.seq
 485367056     gbcon208.seq
 500000137     gbcon209.seq
 499999250     gbcon21.seq
 499996880     gbcon210.seq
 499997199     gbcon211.seq
  16855954     gbcon212.seq
 499996313     gbcon213.seq
 499971821     gbcon214.seq
 499997635     gbcon215.seq
 273368980     gbcon216.seq
 499877383     gbcon217.seq
 499922453     gbcon218.seq
 499993552     gbcon219.seq
 499998925     gbcon22.seq
 499949185     gbcon220.seq
 499999820     gbcon221.seq
 498895974     gbcon222.seq
  81416614     gbcon23.seq
 499998430     gbcon24.seq
 499999189     gbcon25.seq
 499420818     gbcon26.seq
 286265985     gbcon27.seq
 499486419     gbcon28.seq
 125749326     gbcon29.seq
 499999976     gbcon3.seq
 126436397     gbcon30.seq
 499925023     gbcon31.seq
 499992465     gbcon32.seq
  26152220     gbcon33.seq
 499999414     gbcon34.seq
 499998297     gbcon35.seq
 443990166     gbcon36.seq
 499999057     gbcon37.seq
 499998568     gbcon38.seq
 499999100     gbcon39.seq
 106301568     gbcon4.seq
  41918782     gbcon40.seq
 500000081     gbcon41.seq
 499998540     gbcon42.seq
 277009775     gbcon43.seq
 499996336     gbcon44.seq
 499998469     gbcon45.seq
 270612827     gbcon46.seq
 499996532     gbcon47.seq
 499996905     gbcon48.seq
 385374935     gbcon49.seq
 499940282     gbcon5.seq
 499997390     gbcon50.seq
 499999185     gbcon51.seq
 176580283     gbcon52.seq
 499999848     gbcon53.seq
 499997718     gbcon54.seq
 238773972     gbcon55.seq
 499997628     gbcon56.seq
 499995125     gbcon57.seq
 335698760     gbcon58.seq
 499996299     gbcon59.seq
 494453997     gbcon6.seq
 499999132     gbcon60.seq
 298461041     gbcon61.seq
 499995314     gbcon62.seq
 499999014     gbcon63.seq
 259899669     gbcon64.seq
 499996880     gbcon65.seq
 499997062     gbcon66.seq
 187377116     gbcon67.seq
 499996720     gbcon68.seq
 499999826     gbcon69.seq
 494750151     gbcon7.seq
 364586197     gbcon70.seq
 499993696     gbcon71.seq
 499999904     gbcon72.seq
 386119955     gbcon73.seq
 499993762     gbcon74.seq
 472811181     gbcon75.seq
 174082386     gbcon76.seq
 499941095     gbcon77.seq
  23944933     gbcon78.seq
 499987096     gbcon79.seq
 499998872     gbcon8.seq
 203666963     gbcon80.seq
 199581356     gbcon81.seq
 499494027     gbcon82.seq
 499984730     gbcon83.seq
 337640522     gbcon84.seq
 499532057     gbcon85.seq
 495874659     gbcon86.seq
 499843567     gbcon87.seq
 337606451     gbcon88.seq
 499974953     gbcon89.seq
  61944908     gbcon9.seq
 500000088     gbcon90.seq
 499924918     gbcon91.seq
 167922702     gbcon92.seq
 499999241     gbcon93.seq
 499999436     gbcon94.seq
 132485713     gbcon95.seq
 499986934     gbcon96.seq
 499999769     gbcon97.seq
 499997622     gbcon98.seq
 266010665     gbcon99.seq
    114057     gbdel.txt
 500000217     gbenv1.seq
 499999854     gbenv10.seq
 126478067     gbenv11.seq
 499999038     gbenv12.seq
 499997545     gbenv13.seq
  53790069     gbenv14.seq
 499999132     gbenv15.seq
 500000038     gbenv16.seq
 499999565     gbenv17.seq
 499999316     gbenv18.seq
   3322010     gbenv19.seq
 499998502     gbenv2.seq
 500000254     gbenv20.seq
 499998621     gbenv21.seq
 173623395     gbenv22.seq
 499959878     gbenv23.seq
 499999316     gbenv24.seq
 499999667     gbenv25.seq
  82901318     gbenv26.seq
 499999694     gbenv27.seq
 499997386     gbenv28.seq
 177809609     gbenv29.seq
 345015109     gbenv3.seq
 499999862     gbenv30.seq
 499996637     gbenv31.seq
 499999359     gbenv32.seq
  46355793     gbenv33.seq
 499999762     gbenv34.seq
 499999527     gbenv35.seq
 192725634     gbenv36.seq
 499996455     gbenv37.seq
 499997825     gbenv38.seq
 334819715     gbenv39.seq
 494542285     gbenv4.seq
 499998642     gbenv40.seq
 499999203     gbenv41.seq
 470552604     gbenv42.seq
 499998291     gbenv43.seq
 499997986     gbenv44.seq
 338449376     gbenv45.seq
 500000123     gbenv46.seq
 499999404     gbenv47.seq
 394362533     gbenv48.seq
 500000229     gbenv49.seq
 496523136     gbenv5.seq
 499999720     gbenv50.seq
 345191137     gbenv51.seq
 499998817     gbenv52.seq
 499999362     gbenv53.seq
 237939752     gbenv54.seq
 499999111     gbenv55.seq
 499997885     gbenv56.seq
 390605584     gbenv57.seq
 499999104     gbenv58.seq
 499988051     gbenv59.seq
 499830422     gbenv6.seq
 499999634     gbenv60.seq
  82788557     gbenv61.seq
 499850633     gbenv62.seq
 499998263     gbenv63.seq
 499999725     gbenv64.seq
 143862740     gbenv65.seq
 499999121     gbenv66.seq
 499999872     gbenv67.seq
 499928796     gbenv68.seq
 499999334     gbenv69.seq
 466426908     gbenv7.seq
 106974114     gbenv70.seq
 497119813     gbenv8.seq
 499997783     gbenv9.seq
 499998581     gbest1.seq
 499999733     gbest10.seq
 499999220     gbest100.seq
 500000099     gbest101.seq
 499997479     gbest102.seq
 499998343     gbest103.seq
  26182198     gbest104.seq
 499997739     gbest105.seq
 499996559     gbest106.seq
 499999711     gbest107.seq
 499996203     gbest108.seq
   9426180     gbest109.seq
 499998473     gbest11.seq
 499999283     gbest110.seq
 499998031     gbest111.seq
 499998955     gbest112.seq
 499998225     gbest113.seq
  19921978     gbest114.seq
 500000014     gbest115.seq
 499998435     gbest116.seq
 499999531     gbest117.seq
   9147880     gbest118.seq
 499998004     gbest119.seq
 474277084     gbest12.seq
 499998752     gbest120.seq
 499997835     gbest121.seq
  69022439     gbest122.seq
 499996892     gbest123.seq
 499998214     gbest124.seq
 223712939     gbest125.seq
 499997461     gbest126.seq
 499998633     gbest127.seq
 195307357     gbest128.seq
 499997173     gbest129.seq
 499999143     gbest13.seq
 499998792     gbest130.seq
 499995025     gbest131.seq
 499996839     gbest132.seq
  85321549     gbest133.seq
 499999011     gbest134.seq
 499996610     gbest135.seq
 500000110     gbest136.seq
 499999122     gbest137.seq
  98779968     gbest138.seq
 500000002     gbest139.seq
 249784262     gbest14.seq
 499997959     gbest140.seq
 499998236     gbest141.seq
 499999192     gbest142.seq
  24946687     gbest143.seq
 499997319     gbest144.seq
 499995843     gbest145.seq
 499999717     gbest146.seq
 499999913     gbest147.seq
  30453490     gbest148.seq
 499998561     gbest149.seq
 499999671     gbest15.seq
 499999358     gbest150.seq
 499998219     gbest151.seq
 322722212     gbest152.seq
 499996387     gbest153.seq
 499998779     gbest154.seq
 499995778     gbest155.seq
 499998742     gbest156.seq
  22334741     gbest157.seq
 500000171     gbest158.seq
 499999919     gbest159.seq
 499998336     gbest16.seq
 499996596     gbest160.seq
 499998368     gbest161.seq
  10327640     gbest162.seq
 499999757     gbest163.seq
 499997629     gbest164.seq
 499999067     gbest165.seq
 499996901     gbest166.seq
  83685503     gbest167.seq
 500000180     gbest168.seq
 499996624     gbest169.seq
 420893863     gbest17.seq
 499997982     gbest170.seq
 499996832     gbest171.seq
 120388331     gbest172.seq
 499998796     gbest173.seq
 499996875     gbest174.seq
 499998096     gbest175.seq
 500000066     gbest176.seq
  66109540     gbest177.seq
 499999609     gbest178.seq
 403619645     gbest179.seq
 499999173     gbest18.seq
 500000063     gbest180.seq
 499999705     gbest181.seq
 499997986     gbest182.seq
 499999873     gbest183.seq
  42448093     gbest184.seq
 499999170     gbest185.seq
 499998375     gbest186.seq
 499998599     gbest187.seq
 499997179     gbest188.seq
  41293649     gbest189.seq
 499996805     gbest19.seq
 499998332     gbest190.seq
 499997812     gbest191.seq
 499998689     gbest192.seq
 500000232     gbest193.seq
  10891288     gbest194.seq
 499999221     gbest195.seq
 499998819     gbest196.seq
 500000021     gbest197.seq
 499998814     gbest198.seq
  27086967     gbest199.seq
 499998769     gbest2.seq
 262051360     gbest20.seq
 499998833     gbest200.seq
 499997633     gbest201.seq
 499998589     gbest202.seq
 499999311     gbest203.seq
  32042635     gbest204.seq
  13610371     gbest205.seq
 500000009     gbest206.seq
 499999777     gbest207.seq
 328407486     gbest208.seq
 499998412     gbest209.seq
 500000121     gbest21.seq
 499996653     gbest210.seq
 317123453     gbest211.seq
 499997666     gbest212.seq
 499998222     gbest213.seq
 265471772     gbest214.seq
 499996413     gbest215.seq
 500000158     gbest216.seq
 269693487     gbest217.seq
 499997149     gbest218.seq
 499999248     gbest219.seq
 499998661     gbest22.seq
 499999631     gbest220.seq
 500000163     gbest221.seq
  49197565     gbest222.seq
 499999284     gbest223.seq
 499999484     gbest224.seq
 499998195     gbest225.seq
 500000115     gbest226.seq
  46767660     gbest227.seq
 499999291     gbest228.seq
 499998753     gbest229.seq
 243684731     gbest23.seq
 175256219     gbest230.seq
 499998729     gbest231.seq
 499999681     gbest232.seq
 499999475     gbest233.seq
 478347570     gbest234.seq
 499997785     gbest235.seq
 499999603     gbest236.seq
 499997429     gbest237.seq
 462328784     gbest238.seq
 499999067     gbest239.seq
 499999963     gbest24.seq
 499999466     gbest240.seq
 499999877     gbest241.seq
 494650973     gbest242.seq
 499998531     gbest243.seq
 499998185     gbest244.seq
 499997969     gbest245.seq
 499998635     gbest246.seq
  24311445     gbest247.seq
 499998408     gbest248.seq
 499998480     gbest249.seq
 499996714     gbest25.seq
 497223296     gbest250.seq
 499999018     gbest251.seq
 499998363     gbest252.seq
 499999589     gbest253.seq
 499995954     gbest254.seq
  21377068     gbest255.seq
 499998685     gbest256.seq
 499999456     gbest257.seq
 499992679     gbest258.seq
 499999776     gbest259.seq
 499999785     gbest26.seq
  75121353     gbest260.seq
 499999815     gbest261.seq
 499999182     gbest262.seq
 499998456     gbest263.seq
 499999062     gbest264.seq
  14352516     gbest265.seq
 499996812     gbest266.seq
 500000012     gbest267.seq
 499995965     gbest268.seq
 500000130     gbest269.seq
 499999101     gbest27.seq
  53599541     gbest270.seq
 499999104     gbest271.seq
 499998969     gbest272.seq
 499998846     gbest273.seq
 119014253     gbest274.seq
 499996151     gbest275.seq
 499997199     gbest276.seq
 499999053     gbest277.seq
 499998565     gbest278.seq
  53630504     gbest279.seq
  48938088     gbest28.seq
 499999317     gbest280.seq
 499997549     gbest281.seq
 499997631     gbest282.seq
 499998870     gbest283.seq
  56086801     gbest284.seq
 499999854     gbest285.seq
 499999427     gbest286.seq
 499998420     gbest287.seq
 499999297     gbest288.seq
  11817252     gbest289.seq
 499999934     gbest29.seq
 499997241     gbest290.seq
 500000143     gbest291.seq
 499997193     gbest292.seq
 499999266     gbest293.seq
  25249973     gbest294.seq
 499999965     gbest295.seq
 499996255     gbest296.seq
 485857148     gbest297.seq
 499996746     gbest298.seq
 499998051     gbest299.seq
 499998416     gbest3.seq
 500000238     gbest30.seq
 499999666     gbest300.seq
 499998500     gbest301.seq
   5577915     gbest302.seq
 499998622     gbest303.seq
 499999578     gbest304.seq
 499997985     gbest305.seq
 499998280     gbest306.seq
   8353862     gbest307.seq
 499999018     gbest308.seq
 500000027     gbest309.seq
 499998758     gbest31.seq
 499998037     gbest310.seq
 421694602     gbest311.seq
 500000066     gbest312.seq
 499998272     gbest313.seq
 499999108     gbest314.seq
 496147533     gbest315.seq
 499997885     gbest316.seq
 499997415     gbest317.seq
 468073576     gbest318.seq
 499999035     gbest319.seq
 486152246     gbest32.seq
 499999387     gbest320.seq
 500000238     gbest321.seq
 499998922     gbest322.seq
  39560997     gbest323.seq
 500000256     gbest324.seq
 499998824     gbest325.seq
 499998042     gbest326.seq
 493136865     gbest327.seq
 499998749     gbest328.seq
 499997759     gbest329.seq
 499997679     gbest33.seq
 499999540     gbest330.seq
 499997029     gbest331.seq
  55168282     gbest332.seq
 499999943     gbest333.seq
 499999960     gbest334.seq
 499998379     gbest335.seq
 469196415     gbest336.seq
 499998299     gbest337.seq
 499999395     gbest338.seq
 500000050     gbest339.seq
 499999122     gbest34.seq
 500000223     gbest340.seq
  18186152     gbest341.seq
 499998023     gbest342.seq
 491618868     gbest343.seq
 499998746     gbest344.seq
 499999937     gbest345.seq
 499999493     gbest346.seq
 499999913     gbest347.seq
   5664451     gbest348.seq
 499996833     gbest349.seq
 499999366     gbest35.seq
 499998440     gbest350.seq
 499998762     gbest351.seq
 445260919     gbest352.seq
 499998629     gbest353.seq
 500000207     gbest354.seq
 499999612     gbest355.seq
 387623893     gbest356.seq
 499999012     gbest357.seq
 499996946     gbest358.seq
 499998298     gbest359.seq
 464766402     gbest36.seq
 499998840     gbest360.seq
  21213467     gbest361.seq
 499997139     gbest362.seq
 500000037     gbest363.seq
 499998204     gbest364.seq
 499998663     gbest365.seq
  56149185     gbest366.seq
 166258344     gbest367.seq
 499997707     gbest368.seq
 499998882     gbest369.seq
 499999414     gbest37.seq
 499998160     gbest370.seq
 499999199     gbest371.seq
  86045134     gbest372.seq
 499997252     gbest373.seq
 499998118     gbest374.seq
 499999892     gbest375.seq
 499998855     gbest376.seq
 166666388     gbest377.seq
 499996810     gbest378.seq
 499996558     gbest379.seq
 499997253     gbest38.seq
 499998375     gbest380.seq
 500000151     gbest381.seq
 151580674     gbest382.seq
 499997221     gbest383.seq
 499999329     gbest384.seq
 499997189     gbest385.seq
 497175622     gbest386.seq
 499997498     gbest387.seq
 499998709     gbest388.seq
 499998596     gbest389.seq
 499996751     gbest39.seq
  64052070     gbest390.seq
 499998385     gbest391.seq
 499999008     gbest392.seq
 499996496     gbest393.seq
 499997691     gbest394.seq
  83414510     gbest395.seq
 499996944     gbest396.seq
 499997015     gbest397.seq
 499998040     gbest398.seq
 499999190     gbest399.seq
 434664907     gbest4.seq
 499996416     gbest40.seq
  85820972     gbest400.seq
 499999952     gbest401.seq
 499998092     gbest402.seq
 499999582     gbest403.seq
 499998501     gbest404.seq
  49032427     gbest405.seq
 499998825     gbest406.seq
 499998991     gbest407.seq
 499997959     gbest408.seq
 499998392     gbest409.seq
 191408304     gbest41.seq
  88071166     gbest410.seq
 499999741     gbest411.seq
 499998374     gbest412.seq
 499993677     gbest413.seq
 499993201     gbest414.seq
 124851254     gbest415.seq
 499999918     gbest416.seq
 327382356     gbest417.seq
 499998194     gbest418.seq
 499997992     gbest419.seq
 499997364     gbest42.seq
 499999615     gbest420.seq
 499998742     gbest421.seq
  53760245     gbest422.seq
 499999058     gbest423.seq
 499999991     gbest424.seq
 499995917     gbest425.seq
 410296162     gbest426.seq
 499997260     gbest427.seq
 499999283     gbest428.seq
 335979604     gbest429.seq
 499997237     gbest43.seq
 499999961     gbest430.seq
 499999304     gbest431.seq
 262197966     gbest432.seq
 499999061     gbest433.seq
 499998847     gbest434.seq
 458912468     gbest435.seq
 499997775     gbest436.seq
 499995081     gbest437.seq
 307806619     gbest438.seq
 499996212     gbest439.seq
 499997245     gbest44.seq
 499998800     gbest440.seq
 333974609     gbest441.seq
 499999541     gbest442.seq
 499997289     gbest443.seq
 186040190     gbest444.seq
 500000126     gbest445.seq
 499999505     gbest446.seq
 119005290     gbest447.seq
 499998841     gbest448.seq
 499999145     gbest449.seq
 499996431     gbest45.seq
 142065868     gbest450.seq
 499999879     gbest451.seq
 499998318     gbest452.seq
 146708639     gbest453.seq
 500000202     gbest454.seq
 499999189     gbest455.seq
 499998072     gbest456.seq
 486290213     gbest457.seq
 499999523     gbest458.seq
 499997276     gbest459.seq
 189558363     gbest46.seq
 500000217     gbest460.seq
 500000093     gbest461.seq
  20448393     gbest462.seq
 170019681     gbest463.seq
 499998234     gbest464.seq
 499997948     gbest465.seq
 499996964     gbest466.seq
 499998273     gbest467.seq
  23774165     gbest468.seq
 499999458     gbest469.seq
 499999058     gbest47.seq
 499999208     gbest470.seq
 499999217     gbest471.seq
 499998573     gbest472.seq
  59936590     gbest473.seq
 499997586     gbest474.seq
 499998545     gbest475.seq
 499998359     gbest476.seq
 499999709     gbest477.seq
  58034918     gbest478.seq
 499998110     gbest479.seq
 499997398     gbest48.seq
 499998435     gbest480.seq
 499997613     gbest481.seq
 499999689     gbest482.seq
  37667601     gbest483.seq
 499997371     gbest484.seq
 499999019     gbest485.seq
 499998507     gbest486.seq
 500000121     gbest487.seq
  73824175     gbest488.seq
 499997662     gbest489.seq
 499998871     gbest49.seq
 499999130     gbest490.seq
 500000163     gbest491.seq
 206731273     gbest492.seq
 499996334     gbest493.seq
 499997901     gbest494.seq
 499999131     gbest495.seq
 499999371     gbest496.seq
  89549034     gbest497.seq
 499998125     gbest498.seq
 499997888     gbest499.seq
 499998500     gbest5.seq
 475083605     gbest50.seq
 500000231     gbest500.seq
 499997115     gbest501.seq
  53664381     gbest502.seq
 499994065     gbest503.seq
 499997608     gbest504.seq
 499995938     gbest505.seq
 499999200     gbest506.seq
 143190346     gbest507.seq
 499999091     gbest508.seq
 499999463     gbest509.seq
 499997701     gbest51.seq
 499997413     gbest510.seq
 499998318     gbest511.seq
 142155683     gbest512.seq
 499997833     gbest513.seq
 499996770     gbest514.seq
 499999160     gbest515.seq
 499999361     gbest516.seq
  17223581     gbest517.seq
 174254470     gbest518.seq
 499997829     gbest519.seq
 355950520     gbest52.seq
 500000018     gbest520.seq
  83958051     gbest521.seq
 499997944     gbest522.seq
 499998345     gbest523.seq
  75364218     gbest524.seq
 499999451     gbest525.seq
 499999095     gbest526.seq
 499997240     gbest527.seq
 500000018     gbest528.seq
  99290674     gbest529.seq
 499998564     gbest53.seq
 499999697     gbest530.seq
 499999874     gbest531.seq
 499998102     gbest532.seq
 500000109     gbest533.seq
   9341136     gbest534.seq
 499999430     gbest535.seq
 499999910     gbest536.seq
 499998159     gbest537.seq
 477178951     gbest538.seq
 499998569     gbest539.seq
 499999062     gbest54.seq
 499998452     gbest540.seq
 499998569     gbest541.seq
 413045717     gbest542.seq
 499998900     gbest543.seq
 499999161     gbest544.seq
 499999901     gbest545.seq
 500000090     gbest546.seq
  82655201     gbest547.seq
 499998013     gbest548.seq
 500000188     gbest549.seq
 499997809     gbest55.seq
 499998067     gbest550.seq
 499999132     gbest551.seq
  33919554     gbest552.seq
 499998664     gbest553.seq
 499997885     gbest554.seq
 499997388     gbest555.seq
 499999535     gbest556.seq
  44487956     gbest557.seq
 499998480     gbest558.seq
 500000263     gbest559.seq
 483409497     gbest56.seq
 499997579     gbest560.seq
 499999937     gbest561.seq
   9348982     gbest562.seq
 499998309     gbest563.seq
 499999967     gbest564.seq
 392784153     gbest565.seq
 500000181     gbest566.seq
 499998059     gbest567.seq
 100753733     gbest568.seq
 499998740     gbest569.seq
 499999963     gbest57.seq
 499998391     gbest570.seq
  50311057     gbest571.seq
 499999914     gbest572.seq
 499997175     gbest573.seq
 499998760     gbest574.seq
 254449849     gbest575.seq
 499999250     gbest58.seq
 499998894     gbest59.seq
 499999229     gbest6.seq
 464091191     gbest60.seq
 499999088     gbest61.seq
 499999098     gbest62.seq
 499997667     gbest63.seq
 499999437     gbest64.seq
   6861076     gbest65.seq
 500000049     gbest66.seq
 499998783     gbest67.seq
 499998482     gbest68.seq
 483714543     gbest69.seq
 499999606     gbest7.seq
 499998717     gbest70.seq
 499998737     gbest71.seq
 499999921     gbest72.seq
 499999569     gbest73.seq
   8367902     gbest74.seq
 123216343     gbest75.seq
 499998883     gbest76.seq
 499999229     gbest77.seq
 500000011     gbest78.seq
 499998569     gbest79.seq
 469350696     gbest8.seq
   5383905     gbest80.seq
 499998041     gbest81.seq
 499996972     gbest82.seq
 499996950     gbest83.seq
 499995253     gbest84.seq
  46010588     gbest85.seq
 499999370     gbest86.seq
 499997556     gbest87.seq
 499999924     gbest88.seq
 499999990     gbest89.seq
 499998998     gbest9.seq
  53044991     gbest90.seq
 500000263     gbest91.seq
 499997907     gbest92.seq
 499996978     gbest93.seq
 472029655     gbest94.seq
 500000196     gbest95.seq
 499998752     gbest96.seq
 499998281     gbest97.seq
 498657288     gbest98.seq
  35234983     gbest99.seq
 499998103     gbgss1.seq
  55431063     gbgss10.seq
 499999207     gbgss100.seq
 500000257     gbgss101.seq
 500000134     gbgss102.seq
 468268660     gbgss103.seq
 499996751     gbgss104.seq
 499999692     gbgss105.seq
 499997757     gbgss106.seq
 499998352     gbgss107.seq
  40402012     gbgss108.seq
 499999314     gbgss109.seq
 499999328     gbgss11.seq
 499999661     gbgss110.seq
 499997830     gbgss111.seq
 316916938     gbgss112.seq
 499998412     gbgss113.seq
 499997321     gbgss114.seq
 499999598     gbgss115.seq
 499998006     gbgss116.seq
 104211862     gbgss117.seq
 499998179     gbgss118.seq
 499999331     gbgss119.seq
 499998298     gbgss12.seq
 499997853     gbgss120.seq
 499999736     gbgss121.seq
   6537142     gbgss122.seq
 499998633     gbgss123.seq
 499999968     gbgss124.seq
 499998799     gbgss125.seq
 449734063     gbgss126.seq
 499998381     gbgss127.seq
 499999211     gbgss128.seq
 499997711     gbgss129.seq
 499999246     gbgss13.seq
 499998622     gbgss130.seq
  29785783     gbgss131.seq
 499997877     gbgss132.seq
 209679641     gbgss133.seq
 500000110     gbgss134.seq
 499999602     gbgss135.seq
 499997969     gbgss136.seq
 500000125     gbgss137.seq
  14831686     gbgss138.seq
 499996726     gbgss139.seq
 498664595     gbgss14.seq
 499997951     gbgss140.seq
 499999528     gbgss141.seq
 499997001     gbgss142.seq
  16786266     gbgss143.seq
 499997786     gbgss144.seq
 499996974     gbgss145.seq
 499999546     gbgss146.seq
 499996547     gbgss147.seq
   2045398     gbgss148.seq
 499997382     gbgss149.seq
 499997425     gbgss15.seq
 499998165     gbgss150.seq
 499998480     gbgss151.seq
 499997367     gbgss152.seq
   6835799     gbgss153.seq
 373479550     gbgss154.seq
 499998497     gbgss155.seq
 499999520     gbgss156.seq
 499998987     gbgss157.seq
 452015031     gbgss158.seq
 499999674     gbgss159.seq
 499997738     gbgss16.seq
 499998566     gbgss160.seq
 499998516     gbgss161.seq
 454413234     gbgss162.seq
 499997998     gbgss163.seq
 499999955     gbgss164.seq
 499997965     gbgss165.seq
 456856217     gbgss166.seq
 499997805     gbgss167.seq
 499999559     gbgss168.seq
 499999924     gbgss169.seq
 499999295     gbgss17.seq
 362956480     gbgss170.seq
 499999614     gbgss171.seq
 499999108     gbgss172.seq
 215505908     gbgss173.seq
 499998415     gbgss174.seq
 499998134     gbgss175.seq
  67002892     gbgss176.seq
 499999079     gbgss177.seq
 499999336     gbgss178.seq
 499998518     gbgss179.seq
 480471778     gbgss18.seq
 499999975     gbgss180.seq
  49671428     gbgss181.seq
 500000175     gbgss182.seq
 499999211     gbgss183.seq
 500000209     gbgss184.seq
 499999501     gbgss185.seq
  39656212     gbgss186.seq
 499999015     gbgss187.seq
 499999023     gbgss188.seq
  23241200     gbgss189.seq
 499998975     gbgss19.seq
 499998791     gbgss190.seq
 499996639     gbgss191.seq
 499998774     gbgss192.seq
 495024971     gbgss193.seq
 499999000     gbgss194.seq
 499999717     gbgss195.seq
 499999860     gbgss196.seq
 499999901     gbgss197.seq
  53998378     gbgss198.seq
 499998820     gbgss199.seq
 499999269     gbgss2.seq
 325856321     gbgss20.seq
 499999274     gbgss200.seq
 499999783     gbgss201.seq
 479851147     gbgss202.seq
 499997737     gbgss203.seq
 499997752     gbgss204.seq
  56421213     gbgss205.seq
 499997703     gbgss206.seq
 500000150     gbgss207.seq
 499999163     gbgss208.seq
 481466169     gbgss209.seq
 499999364     gbgss21.seq
 499996771     gbgss210.seq
 499999404     gbgss211.seq
 499997241     gbgss212.seq
 488372551     gbgss213.seq
 499999175     gbgss214.seq
 499999239     gbgss215.seq
 499999176     gbgss216.seq
 467990953     gbgss217.seq
 499999749     gbgss218.seq
 499999749     gbgss219.seq
 499997480     gbgss22.seq
 499997938     gbgss220.seq
   6989681     gbgss221.seq
 499999723     gbgss222.seq
 499999684     gbgss223.seq
 499998774     gbgss224.seq
 264582471     gbgss225.seq
 499998308     gbgss226.seq
 499997919     gbgss227.seq
 499999547     gbgss228.seq
 429737750     gbgss229.seq
 499997001     gbgss23.seq
 499998680     gbgss230.seq
 499997412     gbgss231.seq
 499999464     gbgss232.seq
 468539336     gbgss233.seq
 499999119     gbgss234.seq
 500000083     gbgss235.seq
 499999330     gbgss236.seq
 418145094     gbgss237.seq
 499998654     gbgss238.seq
 499999983     gbgss239.seq
 499999217     gbgss24.seq
 499998793     gbgss240.seq
 499998625     gbgss241.seq
  16537478     gbgss242.seq
 315572447     gbgss243.seq
 499997744     gbgss244.seq
 499999895     gbgss245.seq
 499998432     gbgss246.seq
 467293763     gbgss247.seq
 499998755     gbgss248.seq
 499999780     gbgss249.seq
  47915040     gbgss25.seq
 499999818     gbgss250.seq
 499997858     gbgss251.seq
  36102519     gbgss252.seq
 499998608     gbgss253.seq
 499997686     gbgss254.seq
 499998198     gbgss255.seq
 499999134     gbgss256.seq
  19020583     gbgss257.seq
 499998709     gbgss258.seq
 499997285     gbgss259.seq
 499998203     gbgss26.seq
 499998938     gbgss260.seq
   1409124     gbgss261.seq
 500000180     gbgss262.seq
 499999092     gbgss263.seq
 499998857     gbgss264.seq
 480468608     gbgss265.seq
 499999638     gbgss266.seq
 499998584     gbgss267.seq
 472073119     gbgss268.seq
 499999289     gbgss27.seq
 499996662     gbgss28.seq
 499998293     gbgss29.seq
 499999955     gbgss3.seq
  28371252     gbgss30.seq
 499999620     gbgss31.seq
 499999369     gbgss32.seq
 499997779     gbgss33.seq
 474354474     gbgss34.seq
 499997672     gbgss35.seq
 499999711     gbgss36.seq
 499998458     gbgss37.seq
 499998787     gbgss38.seq
  10244239     gbgss39.seq
 499997976     gbgss4.seq
 499998628     gbgss40.seq
 500000104     gbgss41.seq
 168816398     gbgss42.seq
 499998707     gbgss43.seq
 499999529     gbgss44.seq
 500000062     gbgss45.seq
 487188150     gbgss46.seq
 500000097     gbgss47.seq
 499997762     gbgss48.seq
 500000086     gbgss49.seq
  37756294     gbgss5.seq
 444024675     gbgss50.seq
 499998446     gbgss51.seq
 500000163     gbgss52.seq
 499998853     gbgss53.seq
 420972611     gbgss54.seq
 499998235     gbgss55.seq
 500000088     gbgss56.seq
 500000162     gbgss57.seq
 427769194     gbgss58.seq
  67685650     gbgss59.seq
 499999011     gbgss6.seq
 500000215     gbgss60.seq
 499997984     gbgss61.seq
 500000021     gbgss62.seq
 492676767     gbgss63.seq
 499997513     gbgss64.seq
 500000022     gbgss65.seq
 499999623     gbgss66.seq
 495013992     gbgss67.seq
 499998492     gbgss68.seq
 499999132     gbgss69.seq
 499998063     gbgss7.seq
 499999264     gbgss70.seq
 419358340     gbgss71.seq
 499999747     gbgss72.seq
 499998402     gbgss73.seq
 499998080     gbgss74.seq
  33896316     gbgss75.seq
 499997046     gbgss76.seq
 499999706     gbgss77.seq
 499999836     gbgss78.seq
 490829495     gbgss79.seq
 499998114     gbgss8.seq
 499999758     gbgss80.seq
 499998791     gbgss81.seq
 499998121     gbgss82.seq
 499997910     gbgss83.seq
   6352079     gbgss84.seq
 499998294     gbgss85.seq
 499996907     gbgss86.seq
 499999311     gbgss87.seq
 499997750     gbgss88.seq
  28277451     gbgss89.seq
 499999620     gbgss9.seq
 499998289     gbgss90.seq
 500000231     gbgss91.seq
 499998914     gbgss92.seq
 463167513     gbgss93.seq
 244248654     gbgss94.seq
 499999492     gbgss95.seq
 499998457     gbgss96.seq
 500000176     gbgss97.seq
 499997669     gbgss98.seq
  45242083     gbgss99.seq
 499991077     gbhtc1.seq
 499994049     gbhtc2.seq
 499986002     gbhtc3.seq
 330777725     gbhtc4.seq
 499997968     gbhtc5.seq
 438151816     gbhtc6.seq
 499999221     gbhtc7.seq
 211983401     gbhtc8.seq
 499944811     gbhtg1.seq
 499980257     gbhtg10.seq
 485099546     gbhtg11.seq
 499977093     gbhtg12.seq
 499847932     gbhtg13.seq
 499963690     gbhtg14.seq
 499701367     gbhtg15.seq
 474637756     gbhtg16.seq
 499709316     gbhtg17.seq
 499810399     gbhtg18.seq
 499965464     gbhtg19.seq
 499847283     gbhtg2.seq
 499990521     gbhtg20.seq
 473197896     gbhtg21.seq
 499917570     gbhtg22.seq
 499967580     gbhtg23.seq
 499096826     gbhtg24.seq
 499960078     gbhtg25.seq
 484456052     gbhtg26.seq
 499961890     gbhtg27.seq
 499870377     gbhtg28.seq
 268060905     gbhtg29.seq
 499869170     gbhtg3.seq
 499926304     gbhtg30.seq
 499809717     gbhtg31.seq
 224936220     gbhtg32.seq
 499949654     gbhtg33.seq
 499926474     gbhtg34.seq
 265477168     gbhtg35.seq
 499867371     gbhtg36.seq
 499973632     gbhtg37.seq
 223152909     gbhtg38.seq
 499807323     gbhtg39.seq
 499846457     gbhtg4.seq
 499973486     gbhtg40.seq
 234952784     gbhtg41.seq
 499825428     gbhtg42.seq
 499886028     gbhtg43.seq
 202125596     gbhtg44.seq
 499794710     gbhtg45.seq
 499925955     gbhtg46.seq
 205797151     gbhtg47.seq
 499976374     gbhtg48.seq
 499930130     gbhtg49.seq
 499934498     gbhtg5.seq
 193865027     gbhtg50.seq
 499926863     gbhtg51.seq
 499937126     gbhtg52.seq
 161358165     gbhtg53.seq
 499996939     gbhtg54.seq
 499996869     gbhtg55.seq
 252726190     gbhtg56.seq
 499940545     gbhtg57.seq
 499966721     gbhtg58.seq
 499998091     gbhtg59.seq
    507366     gbhtg6.seq
 167066142     gbhtg60.seq
 499929757     gbhtg61.seq
 499926029     gbhtg62.seq
 499877376     gbhtg63.seq
 468570824     gbhtg64.seq
 499882387     gbhtg65.seq
 499975194     gbhtg66.seq
 499952380     gbhtg67.seq
 499930799     gbhtg68.seq
 499789101     gbhtg69.seq
 499821242     gbhtg7.seq
 417841922     gbhtg70.seq
 499651329     gbhtg71.seq
 499807557     gbhtg72.seq
 385409482     gbhtg73.seq
 499951671     gbhtg74.seq
 499970875     gbhtg75.seq
 383567862     gbhtg76.seq
 499964642     gbhtg77.seq
 499988333     gbhtg78.seq
 499994565     gbhtg79.seq
 499933798     gbhtg8.seq
 499991192     gbhtg80.seq
 499928542     gbhtg81.seq
 273546710     gbhtg82.seq
 499899409     gbhtg9.seq
 499862151     gbinv1.seq
 490451253     gbinv10.seq
 115106581     gbinv100.seq
 499996436     gbinv101.seq
 499999449     gbinv102.seq
 404114732     gbinv103.seq
 499999388     gbinv104.seq
 499999336     gbinv105.seq
 177636630     gbinv106.seq
 499997614     gbinv107.seq
 499999116     gbinv108.seq
 117735541     gbinv109.seq
 491062219     gbinv11.seq
 500000017     gbinv110.seq
 500000158     gbinv111.seq
 148276921     gbinv112.seq
 500000254     gbinv113.seq
 499997166     gbinv114.seq
 156821713     gbinv115.seq
 499996810     gbinv116.seq
 500000185     gbinv117.seq
 193685873     gbinv118.seq
 499996960     gbinv119.seq
 469686844     gbinv12.seq
 499999321     gbinv120.seq
 247103743     gbinv121.seq
 499999119     gbinv122.seq
 499998912     gbinv123.seq
 499998744     gbinv124.seq
 499996934     gbinv125.seq
  20345064     gbinv126.seq
 499998875     gbinv127.seq
 445991559     gbinv128.seq
 288065217     gbinv129.seq
 485523455     gbinv13.seq
  54947887     gbinv130.seq
  52917687     gbinv131.seq
 156817630     gbinv132.seq
 499990822     gbinv133.seq
 266436256     gbinv134.seq
 499998557     gbinv135.seq
 499997694     gbinv136.seq
 172341792     gbinv137.seq
 499362318     gbinv138.seq
 498177672     gbinv139.seq
 174157884     gbinv14.seq
 499656507     gbinv140.seq
 128976204     gbinv141.seq
 496677517     gbinv142.seq
  51960557     gbinv143.seq
 466558064     gbinv144.seq
 479577598     gbinv145.seq
 450564845     gbinv146.seq
 482003105     gbinv147.seq
 121049467     gbinv148.seq
 494590358     gbinv149.seq
 486730694     gbinv15.seq
 499153426     gbinv150.seq
 498620693     gbinv151.seq
  70591482     gbinv152.seq
 872662073     gbinv153.seq
 815663159     gbinv154.seq
 813528097     gbinv155.seq
 780491774     gbinv156.seq
 734904723     gbinv157.seq
 816941878     gbinv158.seq
 452891562     gbinv159.seq
 481403838     gbinv16.seq
 480839037     gbinv160.seq
 375796220     gbinv161.seq
 499932212     gbinv162.seq
 485386314     gbinv163.seq
 485283938     gbinv164.seq
 498294953     gbinv165.seq
 414580638     gbinv166.seq
 498679440     gbinv167.seq
 494998502     gbinv168.seq
 486081098     gbinv169.seq
 492664237     gbinv17.seq
 483986740     gbinv170.seq
 479014607     gbinv171.seq
 377175188     gbinv172.seq
 491311809     gbinv173.seq
 482991950     gbinv174.seq
 495169229     gbinv175.seq
 493741890     gbinv176.seq
 495500028     gbinv177.seq
 371035005     gbinv178.seq
 470288952     gbinv179.seq
 478211801     gbinv18.seq
 496245676     gbinv180.seq
 496281402     gbinv181.seq
 472368883     gbinv182.seq
 493439367     gbinv183.seq
 418565417     gbinv184.seq
 493154076     gbinv185.seq
 491119641     gbinv186.seq
 465656312     gbinv187.seq
 490891118     gbinv188.seq
 459581775     gbinv189.seq
 305989097     gbinv19.seq
 406078142     gbinv190.seq
 476900813     gbinv191.seq
 481842193     gbinv192.seq
 496741571     gbinv193.seq
 492742184     gbinv194.seq
 496271174     gbinv195.seq
 392139815     gbinv196.seq
 496951694     gbinv197.seq
 492317100     gbinv198.seq
 475955596     gbinv199.seq
 455878756     gbinv2.seq
 499447601     gbinv20.seq
 498243704     gbinv200.seq
 496662010     gbinv201.seq
 351267284     gbinv202.seq
 454436392     gbinv203.seq
 490104712     gbinv204.seq
 477768949     gbinv205.seq
 497117087     gbinv206.seq
 273421111     gbinv207.seq
 484546259     gbinv208.seq
 486200140     gbinv209.seq
 331575178     gbinv21.seq
 489013669     gbinv210.seq
 499882158     gbinv211.seq
 389958867     gbinv212.seq
 230763287     gbinv213.seq
 433765668     gbinv214.seq
 341801067     gbinv215.seq
 488708469     gbinv216.seq
 442221875     gbinv217.seq
 499288334     gbinv218.seq
 498804445     gbinv219.seq
 409329256     gbinv22.seq
 192259055     gbinv220.seq
 499997864     gbinv221.seq
 499999052     gbinv222.seq
 272969334     gbinv223.seq
 500000017     gbinv224.seq
 499997405     gbinv225.seq
 200791335     gbinv226.seq
 499998721     gbinv227.seq
 499836633     gbinv228.seq
 255084518     gbinv229.seq
 337324220     gbinv23.seq
 499997053     gbinv230.seq
 499999909     gbinv231.seq
 294264712     gbinv232.seq
 499998506     gbinv233.seq
 499991265     gbinv234.seq
 499937819     gbinv235.seq
 155828851     gbinv236.seq
 499999353     gbinv237.seq
 499954513     gbinv238.seq
 394313230     gbinv239.seq
 416902989     gbinv24.seq
 499999746     gbinv240.seq
 499862404     gbinv241.seq
 499942773     gbinv242.seq
 261894712     gbinv243.seq
 499489044     gbinv244.seq
 499984461     gbinv245.seq
 499999178     gbinv246.seq
 219010924     gbinv247.seq
 499665286     gbinv248.seq
 499954794     gbinv249.seq
 480340526     gbinv25.seq
 499986274     gbinv250.seq
 349517342     gbinv251.seq
 500000137     gbinv252.seq
 499979428     gbinv253.seq
 499915813     gbinv254.seq
 499990759     gbinv255.seq
 499998437     gbinv256.seq
   7826534     gbinv257.seq
 499999636     gbinv258.seq
 499704487     gbinv259.seq
 470719972     gbinv26.seq
 499897338     gbinv260.seq
 499999895     gbinv261.seq
  68002970     gbinv262.seq
 499977802     gbinv263.seq
 499904157     gbinv264.seq
 499970007     gbinv265.seq
 499999529     gbinv266.seq
 499940074     gbinv267.seq
 122380920     gbinv268.seq
 500000224     gbinv269.seq
 478012779     gbinv27.seq
 499999552     gbinv270.seq
 468683478     gbinv271.seq
 499670167     gbinv272.seq
 499934229     gbinv273.seq
 499999149     gbinv274.seq
 498177865     gbinv275.seq
 154317558     gbinv276.seq
 481046566     gbinv277.seq
 450037909     gbinv278.seq
 303709221     gbinv279.seq
 372274412     gbinv28.seq
 293452060     gbinv280.seq
 280090041     gbinv281.seq
 279807726     gbinv282.seq
 274554532     gbinv283.seq
 266890122     gbinv284.seq
 491295946     gbinv285.seq
 418047779     gbinv286.seq
 383074444     gbinv287.seq
 489267373     gbinv288.seq
 393039367     gbinv289.seq
 473605830     gbinv29.seq
 484538369     gbinv290.seq
 482310364     gbinv291.seq
 491415359     gbinv292.seq
 495004950     gbinv293.seq
 483971663     gbinv294.seq
 495670320     gbinv295.seq
  40846857     gbinv296.seq
 492571202     gbinv297.seq
 490206006     gbinv298.seq
 445709424     gbinv299.seq
 499997768     gbinv3.seq
 493953395     gbinv30.seq
 207302902     gbinv300.seq
 370283947     gbinv301.seq
 207800719     gbinv302.seq
 403111025     gbinv303.seq
 496918509     gbinv304.seq
 495981016     gbinv305.seq
 486335901     gbinv306.seq
 491884209     gbinv307.seq
  62681775     gbinv308.seq
 487678296     gbinv309.seq
 499998419     gbinv31.seq
 495933337     gbinv310.seq
 497117994     gbinv311.seq
 485878834     gbinv312.seq
 336958408     gbinv313.seq
 470338855     gbinv314.seq
 473857916     gbinv315.seq
 488417194     gbinv316.seq
 472993064     gbinv317.seq
 444598250     gbinv318.seq
 489105559     gbinv319.seq
  83358511     gbinv32.seq
 489050792     gbinv320.seq
 492903374     gbinv321.seq
 464570821     gbinv322.seq
 389647411     gbinv323.seq
 499023581     gbinv324.seq
 459750793     gbinv325.seq
 457336109     gbinv326.seq
 468059342     gbinv327.seq
 487547225     gbinv328.seq
 494627522     gbinv329.seq
 499998762     gbinv33.seq
 499360640     gbinv330.seq
 425862368     gbinv331.seq
 447701977     gbinv332.seq
 471356977     gbinv333.seq
 106487756     gbinv334.seq
 494431929     gbinv335.seq
 499089492     gbinv336.seq
 174713884     gbinv337.seq
 439432672     gbinv338.seq
 315017082     gbinv339.seq
 405379748     gbinv34.seq
 247279447     gbinv340.seq
 493106968     gbinv341.seq
 482399453     gbinv342.seq
 487563600     gbinv343.seq
 495044965     gbinv344.seq
 345414487     gbinv345.seq
 499129683     gbinv346.seq
 496482189     gbinv347.seq
 369581275     gbinv348.seq
 456144815     gbinv349.seq
 497340657     gbinv35.seq
 200284825     gbinv350.seq
 495152558     gbinv351.seq
 341654330     gbinv352.seq
 336683654     gbinv353.seq
 493060580     gbinv354.seq
 107491235     gbinv355.seq
 487968866     gbinv356.seq
 495757046     gbinv357.seq
 481723089     gbinv358.seq
 326169629     gbinv359.seq
 491591120     gbinv36.seq
 485886250     gbinv360.seq
 492815904     gbinv361.seq
 471307712     gbinv362.seq
 311911756     gbinv363.seq
 499380148     gbinv364.seq
 482083381     gbinv365.seq
 479658829     gbinv366.seq
 363305498     gbinv367.seq
 489703355     gbinv368.seq
 499514774     gbinv369.seq
 468886272     gbinv37.seq
 496438512     gbinv370.seq
 492572846     gbinv371.seq
 486825768     gbinv372.seq
 496096827     gbinv373.seq
 476044151     gbinv374.seq
 496125908     gbinv375.seq
 481981378     gbinv376.seq
 343407139     gbinv377.seq
 493089306     gbinv378.seq
 490891004     gbinv379.seq
 480484367     gbinv38.seq
 498098866     gbinv380.seq
 498384023     gbinv381.seq
 493309215     gbinv382.seq
 324291471     gbinv383.seq
 484493924     gbinv384.seq
 491069771     gbinv385.seq
 494055574     gbinv386.seq
 235593723     gbinv387.seq
 319983008     gbinv388.seq
 484241023     gbinv389.seq
  96954549     gbinv39.seq
 216170369     gbinv390.seq
 218804026     gbinv391.seq
 336455655     gbinv392.seq
 297857601     gbinv393.seq
 477593708     gbinv394.seq
 493171167     gbinv395.seq
  96653657     gbinv396.seq
 401450903     gbinv397.seq
 471214414     gbinv398.seq
 478230772     gbinv399.seq
 499597542     gbinv4.seq
 495716316     gbinv40.seq
 481551037     gbinv400.seq
 119372855     gbinv401.seq
 489114034     gbinv402.seq
 418973715     gbinv403.seq
 492116555     gbinv404.seq
 488063426     gbinv405.seq
  86400276     gbinv406.seq
 475977144     gbinv407.seq
 479023212     gbinv408.seq
  91925882     gbinv409.seq
 459725126     gbinv41.seq
 498866242     gbinv410.seq
 475446584     gbinv411.seq
 492109157     gbinv412.seq
 493644048     gbinv413.seq
 450867996     gbinv414.seq
 491756525     gbinv415.seq
  84743944     gbinv416.seq
 423731956     gbinv417.seq
 344359358     gbinv418.seq
 487661322     gbinv419.seq
 481987024     gbinv42.seq
 481796231     gbinv420.seq
 419437489     gbinv421.seq
 447480354     gbinv422.seq
 458542150     gbinv423.seq
  84187054     gbinv424.seq
 476248749     gbinv425.seq
 482272438     gbinv426.seq
 498234741     gbinv427.seq
 471043224     gbinv428.seq
 136592520     gbinv429.seq
 494130818     gbinv43.seq
 495120952     gbinv430.seq
 498047113     gbinv431.seq
 493290837     gbinv432.seq
 467551801     gbinv433.seq
 464868282     gbinv434.seq
 485103437     gbinv435.seq
  70626150     gbinv436.seq
 444903948     gbinv437.seq
 457689916     gbinv438.seq
 485060215     gbinv439.seq
 170883604     gbinv44.seq
 496105931     gbinv440.seq
 398887277     gbinv441.seq
 496315211     gbinv442.seq
 400751741     gbinv443.seq
 420887834     gbinv444.seq
 466152865     gbinv445.seq
 492916768     gbinv446.seq
 342221593     gbinv447.seq
 352563736     gbinv448.seq
 348693377     gbinv449.seq
 473738127     gbinv45.seq
 456059312     gbinv450.seq
 497847487     gbinv451.seq
 449319091     gbinv452.seq
 468637853     gbinv453.seq
 432080041     gbinv454.seq
 138509644     gbinv455.seq
 496695255     gbinv456.seq
 499723939     gbinv457.seq
 479047519     gbinv458.seq
 482874420     gbinv459.seq
 489724528     gbinv46.seq
 499958377     gbinv460.seq
  32943362     gbinv461.seq
 481853019     gbinv47.seq
 480574803     gbinv48.seq
 175801402     gbinv49.seq
 185089486     gbinv5.seq
 495890984     gbinv50.seq
 496714825     gbinv51.seq
 484081852     gbinv52.seq
 472135201     gbinv53.seq
 487970520     gbinv54.seq
 473212643     gbinv55.seq
 119585423     gbinv56.seq
 483414567     gbinv57.seq
 490353662     gbinv58.seq
 487639364     gbinv59.seq
 496674368     gbinv6.seq
 482729413     gbinv60.seq
 499997595     gbinv61.seq
 420487767     gbinv62.seq
 485067490     gbinv63.seq
 497607048     gbinv64.seq
 492273364     gbinv65.seq
 493650304     gbinv66.seq
 319407791     gbinv67.seq
 495477837     gbinv68.seq
 496723738     gbinv69.seq
 476450800     gbinv7.seq
 492757167     gbinv70.seq
 483897094     gbinv71.seq
 478248908     gbinv72.seq
 492778641     gbinv73.seq
 499970626     gbinv74.seq
 498315478     gbinv75.seq
 483551082     gbinv76.seq
 444438685     gbinv77.seq
 483768717     gbinv78.seq
 493574813     gbinv79.seq
 422530821     gbinv8.seq
 498159916     gbinv80.seq
 461241054     gbinv81.seq
 429126368     gbinv82.seq
 472248120     gbinv83.seq
 487381580     gbinv84.seq
 488615859     gbinv85.seq
 492386441     gbinv86.seq
 410012641     gbinv87.seq
 489753781     gbinv88.seq
 486903937     gbinv89.seq
 173964300     gbinv9.seq
 475269344     gbinv90.seq
 499301158     gbinv91.seq
 356776193     gbinv92.seq
 461767421     gbinv93.seq
 479421334     gbinv94.seq
 494639844     gbinv95.seq
 328489972     gbinv96.seq
 484117250     gbinv97.seq
 499997950     gbinv98.seq
 499998671     gbinv99.seq
 499997743     gbmam1.seq
  82813179     gbmam10.seq
  71296598     gbmam11.seq
  22570876     gbmam12.seq
   1268606     gbmam13.seq
 378312073     gbmam14.seq
 338653931     gbmam15.seq
 477859990     gbmam16.seq
 445458574     gbmam17.seq
 122412955     gbmam18.seq
 451114203     gbmam19.seq
 399238033     gbmam2.seq
 418062948     gbmam20.seq
 499818197     gbmam21.seq
 462376363     gbmam22.seq
 370510653     gbmam23.seq
 446296425     gbmam24.seq
 431104447     gbmam25.seq
 480602957     gbmam26.seq
 479109873     gbmam27.seq
 483903297     gbmam28.seq
 483307008     gbmam29.seq
 400559326     gbmam3.seq
  48405032     gbmam30.seq
 363174382     gbmam31.seq
 437246747     gbmam32.seq
 470828962     gbmam33.seq
 402408906     gbmam34.seq
 304109928     gbmam35.seq
 452443739     gbmam36.seq
 451303958     gbmam37.seq
 495648598     gbmam38.seq
 405636626     gbmam39.seq
 477148353     gbmam4.seq
 410457734     gbmam40.seq
 441553748     gbmam41.seq
 367146984     gbmam42.seq
 478421809     gbmam43.seq
 316388332     gbmam44.seq
 352226884     gbmam45.seq
 195247700     gbmam46.seq
 474022452     gbmam47.seq
 378020853     gbmam48.seq
 450136561     gbmam49.seq
 374653134     gbmam5.seq
 450750944     gbmam50.seq
 468132660     gbmam51.seq
 374896622     gbmam52.seq
   9943517     gbmam53.seq
  43989127     gbmam54.seq
  91322474     gbmam55.seq
  88811460     gbmam56.seq
   6364730     gbmam57.seq
  20917981     gbmam58.seq
 449541799     gbmam59.seq
 487713568     gbmam6.seq
 423138211     gbmam60.seq
 453840584     gbmam61.seq
 491149506     gbmam62.seq
 425479852     gbmam63.seq
 461110029     gbmam64.seq
 385606603     gbmam65.seq
 489901313     gbmam66.seq
 499999348     gbmam67.seq
 499880968     gbmam68.seq
  17895078     gbmam69.seq
 401181424     gbmam7.seq
 907465328     gbmam70.seq
 839494897     gbmam71.seq
 774395849     gbmam72.seq
 588873740     gbmam73.seq
 364960392     gbmam74.seq
 428298067     gbmam75.seq
 283039896     gbmam76.seq
 266822121     gbmam77.seq
 255007049     gbmam78.seq
 250435254     gbmam79.seq
 435129139     gbmam8.seq
 405637142     gbmam80.seq
 372091504     gbmam81.seq
 465555603     gbmam82.seq
 444923782     gbmam83.seq
 341578443     gbmam84.seq
 257946240     gbmam85.seq
 485829704     gbmam86.seq
 486026993     gbmam87.seq
 483298905     gbmam88.seq
 500000226     gbmam89.seq
 275778936     gbmam9.seq
 499998738     gbmam90.seq
 497461607     gbmam91.seq
 348089741     gbmam92.seq
 373183697     gbmam93.seq
 467160878     gbmam94.seq
 457054237     gbmam95.seq
 483676805     gbmam96.seq
 409916231     gbmam97.seq
 398303011     gbmam98.seq
 372833970     gbmam99.seq
  26779477     gbnew.txt
 499998661     gbpat1.seq
 499999978     gbpat10.seq
 499999036     gbpat100.seq
 499999497     gbpat101.seq
 499997525     gbpat102.seq
 228719622     gbpat103.seq
 500000251     gbpat104.seq
 500000174     gbpat105.seq
 499999692     gbpat106.seq
 335264579     gbpat107.seq
 499999528     gbpat108.seq
 500000102     gbpat109.seq
 499996272     gbpat11.seq
 208433735     gbpat110.seq
 499897873     gbpat111.seq
 499996756     gbpat112.seq
 174096783     gbpat113.seq
 499999978     gbpat114.seq
 499999926     gbpat115.seq
 499999823     gbpat116.seq
   8662512     gbpat117.seq
 499714223     gbpat118.seq
 382785330     gbpat119.seq
 179179865     gbpat12.seq
 499997522     gbpat120.seq
 499993132     gbpat121.seq
 499992686     gbpat122.seq
 499999325     gbpat123.seq
  56311795     gbpat124.seq
 499968107     gbpat125.seq
 499998875     gbpat126.seq
 208432510     gbpat127.seq
 500000260     gbpat128.seq
 499999622     gbpat129.seq
 499890100     gbpat13.seq
  57406289     gbpat130.seq
 499998251     gbpat131.seq
 499999950     gbpat132.seq
 487399623     gbpat133.seq
 499996579     gbpat134.seq
 499999922     gbpat135.seq
  26298866     gbpat136.seq
 499991214     gbpat137.seq
 385133629     gbpat138.seq
 499999418     gbpat139.seq
 499999970     gbpat14.seq
 500000185     gbpat140.seq
 148486191     gbpat141.seq
 499996260     gbpat142.seq
 314466624     gbpat143.seq
 499988381     gbpat144.seq
 499980283     gbpat145.seq
 409538104     gbpat146.seq
 500000154     gbpat147.seq
 499997507     gbpat148.seq
 125951906     gbpat149.seq
  62646503     gbpat15.seq
 499989559     gbpat150.seq
 499996279     gbpat151.seq
 499998857     gbpat152.seq
 499997730     gbpat153.seq
 169830631     gbpat154.seq
 499999599     gbpat155.seq
 425322676     gbpat156.seq
 499999577     gbpat157.seq
 499999764     gbpat158.seq
 499886396     gbpat159.seq
 499999933     gbpat16.seq
 353519491     gbpat160.seq
 499993753     gbpat161.seq
 499999365     gbpat162.seq
 289626204     gbpat163.seq
 499999582     gbpat164.seq
 499999524     gbpat165.seq
 499999123     gbpat166.seq
 101539058     gbpat167.seq
 499994839     gbpat168.seq
 499997500     gbpat169.seq
 499999593     gbpat17.seq
 499998487     gbpat170.seq
 499998725     gbpat171.seq
 301680889     gbpat172.seq
 499979097     gbpat173.seq
 499999422     gbpat174.seq
 499999591     gbpat175.seq
 318458221     gbpat176.seq
 499602355     gbpat177.seq
 499998747     gbpat178.seq
 499999721     gbpat179.seq
 421928438     gbpat18.seq
  13196841     gbpat180.seq
 497266560     gbpat181.seq
 499997880     gbpat182.seq
 499999143     gbpat183.seq
  86829619     gbpat184.seq
 499924155     gbpat185.seq
 499999973     gbpat186.seq
 499996803     gbpat187.seq
  39745949     gbpat188.seq
 499255205     gbpat189.seq
 499853063     gbpat19.seq
 499999078     gbpat190.seq
 499998937     gbpat191.seq
 499999578     gbpat192.seq
  96567997     gbpat193.seq
 499880710     gbpat194.seq
 499997574     gbpat195.seq
 499999338     gbpat196.seq
 499999261     gbpat197.seq
  90172055     gbpat198.seq
 499993364     gbpat199.seq
 499999508     gbpat2.seq
 499999359     gbpat20.seq
 499994277     gbpat200.seq
 499998512     gbpat201.seq
 499999457     gbpat202.seq
   4092526     gbpat203.seq
 499999756     gbpat204.seq
 499999459     gbpat205.seq
 500000244     gbpat206.seq
 478202129     gbpat207.seq
 500000054     gbpat208.seq
 499999577     gbpat209.seq
 499999364     gbpat21.seq
 321705067     gbpat210.seq
 499991396     gbpat211.seq
 499963719     gbpat212.seq
 350635988     gbpat213.seq
 497506292     gbpat214.seq
 499869540     gbpat215.seq
 421452571     gbpat216.seq
 499425936     gbpat217.seq
 499999361     gbpat218.seq
 336263474     gbpat219.seq
 347575820     gbpat22.seq
 499998549     gbpat220.seq
 499998906     gbpat221.seq
 500000051     gbpat222.seq
 337345592     gbpat223.seq
 499999662     gbpat224.seq
 494515367     gbpat225.seq
 341868206     gbpat226.seq
 499999744     gbpat227.seq
 500000159     gbpat228.seq
 366896749     gbpat229.seq
 499879173     gbpat23.seq
 499999946     gbpat230.seq
 499335751     gbpat231.seq
 500000109     gbpat232.seq
 499999394     gbpat233.seq
 199653938     gbpat234.seq
 499998483     gbpat235.seq
 499999784     gbpat236.seq
 500000182     gbpat237.seq
 202199010     gbpat238.seq
 499999639     gbpat239.seq
 499999843     gbpat24.seq
 499997091     gbpat240.seq
 499999375     gbpat241.seq
 187729792     gbpat242.seq
 500000259     gbpat243.seq
 499999167     gbpat244.seq
 499999565     gbpat245.seq
 201733969     gbpat246.seq
 499996615     gbpat25.seq
 499933566     gbpat26.seq
 165909960     gbpat27.seq
 499998447     gbpat28.seq
 500000116     gbpat29.seq
  61226468     gbpat3.seq
 213213665     gbpat30.seq
 499999775     gbpat31.seq
 406024877     gbpat32.seq
 499997860     gbpat33.seq
 499999725     gbpat34.seq
 125451378     gbpat35.seq
 499999299     gbpat36.seq
 499999218     gbpat37.seq
 499999570     gbpat38.seq
 140142486     gbpat39.seq
 499999189     gbpat4.seq
 500000235     gbpat40.seq
 493970786     gbpat41.seq
 494767350     gbpat42.seq
 499999028     gbpat43.seq
 149226143     gbpat44.seq
 499999126     gbpat45.seq
 499999712     gbpat46.seq
 499999867     gbpat47.seq
  87822622     gbpat48.seq
 500000116     gbpat49.seq
 499999544     gbpat5.seq
 499999445     gbpat50.seq
 499999448     gbpat51.seq
 130944871     gbpat52.seq
 499999288     gbpat53.seq
 499999084     gbpat54.seq
 184982482     gbpat55.seq
 499999726     gbpat56.seq
 499999154     gbpat57.seq
 137265710     gbpat58.seq
 499998902     gbpat59.seq
 418805810     gbpat6.seq
 499638184     gbpat60.seq
 429853204     gbpat61.seq
 500000013     gbpat62.seq
 320985245     gbpat63.seq
 499999860     gbpat64.seq
 499999323     gbpat65.seq
 306074126     gbpat66.seq
 499999595     gbpat67.seq
 499997159     gbpat68.seq
 144919043     gbpat69.seq
 499999400     gbpat7.seq
 499999495     gbpat70.seq
 226235202     gbpat71.seq
 499942763     gbpat72.seq
 500000257     gbpat73.seq
 309555677     gbpat74.seq
 499990988     gbpat75.seq
 499996904     gbpat76.seq
 259606120     gbpat77.seq
 499998418     gbpat78.seq
 499997914     gbpat79.seq
 499995930     gbpat8.seq
  36785301     gbpat80.seq
 500000256     gbpat81.seq
 474123180     gbpat82.seq
 499999508     gbpat83.seq
 331587194     gbpat84.seq
 499998223     gbpat85.seq
 312116353     gbpat86.seq
 499997477     gbpat87.seq
 499999821     gbpat88.seq
 499998104     gbpat89.seq
 317202901     gbpat9.seq
 203747250     gbpat90.seq
 499999444     gbpat91.seq
 455869832     gbpat92.seq
 499990717     gbpat93.seq
 252183795     gbpat94.seq
 499999392     gbpat95.seq
 499997367     gbpat96.seq
  82098506     gbpat97.seq
 499999689     gbpat98.seq
 498236426     gbpat99.seq
 499991412     gbphg1.seq
 499941460     gbphg2.seq
 499891925     gbphg3.seq
 499939027     gbphg4.seq
 289243353     gbphg5.seq
 499999939     gbpln1.seq
 268695070     gbpln10.seq
 498973363     gbpln100.seq
 472540038     gbpln101.seq
 453105795     gbpln102.seq
 445429529     gbpln103.seq
 387853287     gbpln104.seq
 496158394     gbpln105.seq
 499810291     gbpln106.seq
 499842026     gbpln107.seq
 278684203     gbpln108.seq
 489314534     gbpln109.seq
 499944471     gbpln11.seq
 493772547     gbpln110.seq
 474363642     gbpln111.seq
 488601472     gbpln112.seq
 498334188     gbpln113.seq
 355339160     gbpln114.seq
     86085     gbpln115.seq
    360410     gbpln116.seq
 164960914     gbpln117.seq
  40081561     gbpln118.seq
  74904960     gbpln119.seq
 498196567     gbpln12.seq
 499998822     gbpln120.seq
 357049167     gbpln121.seq
 499997818     gbpln122.seq
 499997440     gbpln123.seq
 140514251     gbpln124.seq
 499874187     gbpln125.seq
 498656710     gbpln126.seq
 499989748     gbpln127.seq
 287412217     gbpln128.seq
 298393452     gbpln129.seq
 469735020     gbpln13.seq
 211258227     gbpln130.seq
 248504575     gbpln131.seq
 185644515     gbpln132.seq
 997331398     gbpln133.seq
  56505246     gbpln134.seq
 487346847     gbpln135.seq
 473525516     gbpln136.seq
 473209377     gbpln137.seq
 467870557     gbpln138.seq
 168324921     gbpln139.seq
 170594776     gbpln14.seq
 441979306     gbpln140.seq
 460425795     gbpln141.seq
 479222672     gbpln142.seq
  92564056     gbpln143.seq
 609356119     gbpln144.seq
 786074578     gbpln145.seq
 733167229     gbpln146.seq
 736239733     gbpln147.seq
 691575746     gbpln148.seq
 660133963     gbpln149.seq
 496172088     gbpln15.seq
 739031764     gbpln150.seq
 457966450     gbpln151.seq
 215059951     gbpln152.seq
 499998557     gbpln153.seq
  63677409     gbpln154.seq
 499998354     gbpln155.seq
 499999348     gbpln156.seq
 269557816     gbpln157.seq
 499999347     gbpln158.seq
 499999181     gbpln159.seq
 478225239     gbpln16.seq
  90496808     gbpln160.seq
 499999868     gbpln161.seq
 479224559     gbpln162.seq
 499997505     gbpln163.seq
 419080920     gbpln164.seq
 499996234     gbpln165.seq
 388249626     gbpln166.seq
 499998832     gbpln167.seq
 499996231     gbpln168.seq
 499996971     gbpln169.seq
 335223965     gbpln17.seq
  67028572     gbpln170.seq
 499997384     gbpln171.seq
 500000244     gbpln172.seq
 420807868     gbpln173.seq
 499800749     gbpln174.seq
 497368361     gbpln175.seq
 496073591     gbpln176.seq
 278644720     gbpln177.seq
 499803943     gbpln178.seq
 491540887     gbpln179.seq
 418823303     gbpln18.seq
 402785639     gbpln180.seq
 445924319     gbpln181.seq
 499805001     gbpln182.seq
   5557251     gbpln183.seq
 492236428     gbpln184.seq
 226945063     gbpln185.seq
 315788495     gbpln186.seq
 665291577     gbpln187.seq
 860028189     gbpln188.seq
 800605872     gbpln189.seq
 499938071     gbpln19.seq
 794469115     gbpln190.seq
 762933697     gbpln191.seq
 729969959     gbpln192.seq
 808217924     gbpln193.seq
 209124374     gbpln194.seq
 924325157     gbpln195.seq
1201978654     gbpln196.seq
1227268207     gbpln197.seq
1152253241     gbpln198.seq
1115248374     gbpln199.seq
 499963883     gbpln2.seq
 175764556     gbpln20.seq
1125506105     gbpln200.seq
1145303472     gbpln201.seq
 695608615     gbpln202.seq
 494680830     gbpln203.seq
 460644363     gbpln204.seq
 152680390     gbpln205.seq
 463010254     gbpln206.seq
 480459234     gbpln207.seq
 494737040     gbpln208.seq
 446440740     gbpln209.seq
 345803200     gbpln21.seq
 417743779     gbpln210.seq
 250838119     gbpln211.seq
 364689197     gbpln212.seq
 339196729     gbpln213.seq
 386320509     gbpln214.seq
 311828079     gbpln215.seq
 213907446     gbpln216.seq
 547058897     gbpln217.seq
 117077133     gbpln218.seq
 485280656     gbpln219.seq
 384461829     gbpln22.seq
 153216335     gbpln220.seq
 689933987     gbpln221.seq
 887561680     gbpln222.seq
 834970472     gbpln223.seq
 826391913     gbpln224.seq
 792513917     gbpln225.seq
 743209872     gbpln226.seq
 833073712     gbpln227.seq
    564051     gbpln228.seq
 665291577     gbpln229.seq
 204140270     gbpln23.seq
 860028189     gbpln230.seq
 800605872     gbpln231.seq
 794469115     gbpln232.seq
 762933697     gbpln233.seq
 729969959     gbpln234.seq
 808217924     gbpln235.seq
 189117573     gbpln236.seq
 663098252     gbpln237.seq
 855592604     gbpln238.seq
 807031053     gbpln239.seq
  84616321     gbpln24.seq
 793905039     gbpln240.seq
 773303164     gbpln241.seq
 718153248     gbpln242.seq
 804870210     gbpln243.seq
 661762125     gbpln244.seq
 840180304     gbpln245.seq
 796430245     gbpln246.seq
 779180715     gbpln247.seq
 761224530     gbpln248.seq
 725380245     gbpln249.seq
 477735094     gbpln25.seq
 792983451     gbpln250.seq
 652402241     gbpln251.seq
 831209396     gbpln252.seq
 783682955     gbpln253.seq
 775938782     gbpln254.seq
 741958804     gbpln255.seq
 700440901     gbpln256.seq
 788705159     gbpln257.seq
 683172189     gbpln258.seq
 854365289     gbpln259.seq
 499901688     gbpln26.seq
 802776370     gbpln260.seq
 793295936     gbpln261.seq
 769246264     gbpln262.seq
 710912943     gbpln263.seq
 799876839     gbpln264.seq
 635039454     gbpln265.seq
 824184474     gbpln266.seq
 768070182     gbpln267.seq
 758956882     gbpln268.seq
 732189331     gbpln269.seq
 498817745     gbpln27.seq
 706311232     gbpln270.seq
 766293442     gbpln271.seq
 651415133     gbpln272.seq
 830082304     gbpln273.seq
 783385752     gbpln274.seq
 770520351     gbpln275.seq
 753421970     gbpln276.seq
 699441547     gbpln277.seq
 784443196     gbpln278.seq
 702337808     gbpln279.seq
 323729344     gbpln28.seq
 906907390     gbpln280.seq
 844110716     gbpln281.seq
 841780855     gbpln282.seq
 805270043     gbpln283.seq
 764396863     gbpln284.seq
 841492595     gbpln285.seq
 714482811     gbpln286.seq
 916127997     gbpln287.seq
 858459407     gbpln288.seq
 848936990     gbpln289.seq
 499081327     gbpln29.seq
 813129213     gbpln290.seq
 765593150     gbpln291.seq
 862731158     gbpln292.seq
 665885340     gbpln293.seq
 629668050     gbpln294.seq
 814320946     gbpln295.seq
 759349720     gbpln296.seq
 762512207     gbpln297.seq
 724647884     gbpln298.seq
 679679449     gbpln299.seq
 499980329     gbpln3.seq
 497391978     gbpln30.seq
 784312844     gbpln300.seq
 684180819     gbpln301.seq
 873292213     gbpln302.seq
 827422505     gbpln303.seq
 815925825     gbpln304.seq
 779009585     gbpln305.seq
 739747654     gbpln306.seq
 834950434     gbpln307.seq
 663096073     gbpln308.seq
 849628701     gbpln309.seq
 499424594     gbpln31.seq
 803882830     gbpln310.seq
 794420470     gbpln311.seq
 760127459     gbpln312.seq
 714663802     gbpln313.seq
 801095950     gbpln314.seq
 668869887     gbpln315.seq
 854770002     gbpln316.seq
 805931576     gbpln317.seq
 798923954     gbpln318.seq
 766411223     gbpln319.seq
 103293547     gbpln32.seq
 723133936     gbpln320.seq
 803351408     gbpln321.seq
 664176987     gbpln322.seq
 854339916     gbpln323.seq
 803900400     gbpln324.seq
 791449620     gbpln325.seq
 761145205     gbpln326.seq
 715062603     gbpln327.seq
 806379176     gbpln328.seq
 668964953     gbpln329.seq
 496565850     gbpln33.seq
 870939392     gbpln330.seq
 809408813     gbpln331.seq
 801514137     gbpln332.seq
 768794024     gbpln333.seq
 723644689     gbpln334.seq
 815153418     gbpln335.seq
 661177159     gbpln336.seq
 846934671     gbpln337.seq
 794708793     gbpln338.seq
 789781753     gbpln339.seq
 498203430     gbpln34.seq
 764576068     gbpln340.seq
 711115451     gbpln341.seq
 797517245     gbpln342.seq
 691953899     gbpln343.seq
 888406351     gbpln344.seq
 835271741     gbpln345.seq
 823533989     gbpln346.seq
 787819193     gbpln347.seq
 748786657     gbpln348.seq
 838184652     gbpln349.seq
 349198346     gbpln35.seq
 488783635     gbpln350.seq
 439661491     gbpln351.seq
 155752105     gbpln352.seq
 758806100     gbpln353.seq
 898446949     gbpln354.seq
 628489896     gbpln355.seq
1024113089     gbpln356.seq
1032878661     gbpln357.seq
 858694781     gbpln358.seq
 960391204     gbpln359.seq
 454048044     gbpln36.seq
1090094606     gbpln360.seq
 781959143     gbpln361.seq
 946995961     gbpln362.seq
 857542781     gbpln363.seq
 656405285     gbpln364.seq
 907889097     gbpln365.seq
 896386890     gbpln366.seq
 726432335     gbpln367.seq
 798296822     gbpln368.seq
 918393750     gbpln369.seq
 495221716     gbpln37.seq
 584961784     gbpln370.seq
 948865971     gbpln371.seq
 954536271     gbpln372.seq
 819735731     gbpln373.seq
 756588093     gbpln374.seq
 876067119     gbpln375.seq
 625446321     gbpln376.seq
 977801494     gbpln377.seq
 854357980     gbpln378.seq
 807732556     gbpln379.seq
 382012980     gbpln38.seq
 947696453     gbpln380.seq
1067629605     gbpln381.seq
 822222048     gbpln382.seq
 950272996     gbpln383.seq
 845138843     gbpln384.seq
 643846993     gbpln385.seq
 894745096     gbpln386.seq
 893352134     gbpln387.seq
 722578984     gbpln388.seq
 776227316     gbpln389.seq
 498975616     gbpln39.seq
 899750467     gbpln390.seq
 592059964     gbpln391.seq
 933986451     gbpln392.seq
 939527664     gbpln393.seq
 810117922     gbpln394.seq
 765938558     gbpln395.seq
 886537018     gbpln396.seq
 623519964     gbpln397.seq
 996940649     gbpln398.seq
1030190034     gbpln399.seq
 499836712     gbpln4.seq
 472855786     gbpln40.seq
 832828033     gbpln400.seq
 956342979     gbpln401.seq
1134286144     gbpln402.seq
 790513299     gbpln403.seq
 944161893     gbpln404.seq
 860035788     gbpln405.seq
 647268685     gbpln406.seq
 902239623     gbpln407.seq
 611029440     gbpln408.seq
 734907577     gbpln409.seq
 496785962     gbpln41.seq
 787834228     gbpln410.seq
 910724363     gbpln411.seq
 606016896     gbpln412.seq
 961485234     gbpln413.seq
1242775191     gbpln414.seq
 816670128     gbpln415.seq
 636658925     gbpln416.seq
 818591771     gbpln417.seq
 766580884     gbpln418.seq
 752100829     gbpln419.seq
 429867937     gbpln42.seq
 724519993     gbpln420.seq
 690955648     gbpln421.seq
 769738288     gbpln422.seq
 750738544     gbpln423.seq
 872184389     gbpln424.seq
 624480879     gbpln425.seq
 995069022     gbpln426.seq
1012956234     gbpln427.seq
 827074347     gbpln428.seq
 940621783     gbpln429.seq
 478648725     gbpln43.seq
1079418810     gbpln430.seq
 776922106     gbpln431.seq
 938380968     gbpln432.seq
 848757671     gbpln433.seq
 643572913     gbpln434.seq
 891714442     gbpln435.seq
 878638403     gbpln436.seq
 721632671     gbpln437.seq
 779156122     gbpln438.seq
 895553446     gbpln439.seq
  83738349     gbpln44.seq
 604678568     gbpln440.seq
 931006295     gbpln441.seq
 933660027     gbpln442.seq
 810459540     gbpln443.seq
 761872100     gbpln444.seq
 878702815     gbpln445.seq
 627081460     gbpln446.seq
 994320235     gbpln447.seq
 999434327     gbpln448.seq
 823789349     gbpln449.seq
 494333229     gbpln45.seq
 945629782     gbpln450.seq
1062113821     gbpln451.seq
 792298939     gbpln452.seq
 941851700     gbpln453.seq
 850142413     gbpln454.seq
 656955691     gbpln455.seq
 904094753     gbpln456.seq
 900193903     gbpln457.seq
 728906821     gbpln458.seq
 741172650     gbpln459.seq
 475215142     gbpln46.seq
 898719079     gbpln460.seq
 599002526     gbpln461.seq
 937117048     gbpln462.seq
 936021119     gbpln463.seq
 812696702     gbpln464.seq
 746628212     gbpln465.seq
 897168807     gbpln466.seq
 626698501     gbpln467.seq
1007072101     gbpln468.seq
1000831797     gbpln469.seq
 468208544     gbpln47.seq
 841918855     gbpln470.seq
 963426816     gbpln471.seq
1093654114     gbpln472.seq
 791118382     gbpln473.seq
 959940756     gbpln474.seq
 853263842     gbpln475.seq
 648051398     gbpln476.seq
 901282075     gbpln477.seq
 923491092     gbpln478.seq
 732477869     gbpln479.seq
 486857567     gbpln48.seq
 789987733     gbpln480.seq
 926022053     gbpln481.seq
 610840579     gbpln482.seq
 949759032     gbpln483.seq
 955444559     gbpln484.seq
 818480442     gbpln485.seq
 752251380     gbpln486.seq
 897893149     gbpln487.seq
 631111272     gbpln488.seq
1022032953     gbpln489.seq
 272302955     gbpln49.seq
1006306956     gbpln490.seq
 837035085     gbpln491.seq
 966140819     gbpln492.seq
1090560006     gbpln493.seq
 800164754     gbpln494.seq
 959884028     gbpln495.seq
 886916735     gbpln496.seq
 641540050     gbpln497.seq
 910168783     gbpln498.seq
 908785549     gbpln499.seq
 465755793     gbpln5.seq
 172902191     gbpln50.seq
 729527181     gbpln500.seq
 797552105     gbpln501.seq
 910975470     gbpln502.seq
 616026199     gbpln503.seq
 945685366     gbpln504.seq
 953145956     gbpln505.seq
 820081609     gbpln506.seq
 763165947     gbpln507.seq
 870898266     gbpln508.seq
 618200825     gbpln509.seq
 471233536     gbpln51.seq
1009123187     gbpln510.seq
1016689515     gbpln511.seq
 832912303     gbpln512.seq
 952656374     gbpln513.seq
1065835283     gbpln514.seq
 776075044     gbpln515.seq
 935940025     gbpln516.seq
 846831932     gbpln517.seq
 641399988     gbpln518.seq
 892709705     gbpln519.seq
 455042321     gbpln52.seq
 594848385     gbpln520.seq
 720169483     gbpln521.seq
 780564861     gbpln522.seq
 888344689     gbpln523.seq
 610800072     gbpln524.seq
 934713391     gbpln525.seq
1233388213     gbpln526.seq
 807523234     gbpln527.seq
     19542     gbpln528.seq
 757881986     gbpln529.seq
 488809223     gbpln53.seq
 889760627     gbpln530.seq
 635890046     gbpln531.seq
1007873898     gbpln532.seq
1015524558     gbpln533.seq
 836625022     gbpln534.seq
 959076059     gbpln535.seq
1077416379     gbpln536.seq
 789416089     gbpln537.seq
 958430056     gbpln538.seq
 877922843     gbpln539.seq
 355272263     gbpln54.seq
 648665455     gbpln540.seq
 907513209     gbpln541.seq
 904978028     gbpln542.seq
 727024880     gbpln543.seq
 789120540     gbpln544.seq
 898507915     gbpln545.seq
 617229811     gbpln546.seq
 942711764     gbpln547.seq
 964780021     gbpln548.seq
 818917331     gbpln549.seq
 200538454     gbpln55.seq
 755294557     gbpln550.seq
 882064051     gbpln551.seq
 627203691     gbpln552.seq
 993595919     gbpln553.seq
1021497440     gbpln554.seq
 827286497     gbpln555.seq
 962451301     gbpln556.seq
1082256067     gbpln557.seq
 781463827     gbpln558.seq
 919665368     gbpln559.seq
 377219536     gbpln56.seq
 852133929     gbpln560.seq
 645388382     gbpln561.seq
 905574854     gbpln562.seq
 906714977     gbpln563.seq
 718743537     gbpln564.seq
 787529633     gbpln565.seq
 910251919     gbpln566.seq
 608518276     gbpln567.seq
 934541265     gbpln568.seq
 954054955     gbpln569.seq
 375192640     gbpln57.seq
 806443717     gbpln570.seq
 253168281     gbpln571.seq
 654245898     gbpln572.seq
 843080362     gbpln573.seq
 787261705     gbpln574.seq
 773098599     gbpln575.seq
 745082094     gbpln576.seq
 711612756     gbpln577.seq
 801222610     gbpln578.seq
    271464     gbpln579.seq
 386441749     gbpln58.seq
 398651709     gbpln580.seq
 315170317     gbpln581.seq
 306732013     gbpln582.seq
 319872292     gbpln583.seq
 286450423     gbpln584.seq
 220883441     gbpln585.seq
 470283415     gbpln586.seq
 475850186     gbpln587.seq
 499124827     gbpln588.seq
 460644363     gbpln589.seq
 482478614     gbpln59.seq
 359155255     gbpln590.seq
 399402445     gbpln591.seq
 501115666     gbpln592.seq
 413826113     gbpln593.seq
 367000227     gbpln594.seq
 238050627     gbpln595.seq
 352241749     gbpln596.seq
 298781185     gbpln597.seq
 490716477     gbpln598.seq
  86105216     gbpln599.seq
 499991845     gbpln6.seq
 473293925     gbpln60.seq
   9838016     gbpln600.seq
  10182293     gbpln601.seq
 766528189     gbpln602.seq
 422677536     gbpln603.seq
 133574498     gbpln604.seq
 756143249     gbpln605.seq
 878426054     gbpln606.seq
 631056251     gbpln607.seq
 993852367     gbpln608.seq
1020132695     gbpln609.seq
 476593700     gbpln61.seq
 830166807     gbpln610.seq
 955723315     gbpln611.seq
1057964328     gbpln612.seq
 784007552     gbpln613.seq
 947940191     gbpln614.seq
 857511193     gbpln615.seq
 649137171     gbpln616.seq
 903393879     gbpln617.seq
 908180396     gbpln618.seq
 721135945     gbpln619.seq
 434249982     gbpln62.seq
 786739709     gbpln620.seq
 918070756     gbpln621.seq
 603192844     gbpln622.seq
 938102555     gbpln623.seq
 955978436     gbpln624.seq
 813787878     gbpln625.seq
 639701128     gbpln626.seq
 468519366     gbpln627.seq
 499439472     gbpln628.seq
 498565790     gbpln629.seq
 440487400     gbpln63.seq
  20791137     gbpln630.seq
 768129678     gbpln631.seq
 891209633     gbpln632.seq
1017177961     gbpln633.seq
1036708108     gbpln634.seq
 980496603     gbpln635.seq
1096870510     gbpln636.seq
 964601805     gbpln637.seq
 883690282     gbpln638.seq
 879367269     gbpln639.seq
 444203819     gbpln64.seq
 922136688     gbpln640.seq
 805432021     gbpln641.seq
 912345991     gbpln642.seq
 954500353     gbpln643.seq
 944560088     gbpln644.seq
  29543150     gbpln645.seq
 401274849     gbpln646.seq
 499999898     gbpln647.seq
 499754504     gbpln648.seq
 474588653     gbpln649.seq
 189178941     gbpln65.seq
 499998979     gbpln650.seq
 499398136     gbpln651.seq
 499890302     gbpln652.seq
  49398060     gbpln653.seq
 499816794     gbpln654.seq
 499998093     gbpln655.seq
 499998308     gbpln656.seq
 163200770     gbpln657.seq
 499801099     gbpln658.seq
 499997545     gbpln659.seq
 460468033     gbpln66.seq
 499932776     gbpln660.seq
 500000024     gbpln661.seq
 499997043     gbpln662.seq
  14077318     gbpln663.seq
 499912447     gbpln664.seq
 499935668     gbpln665.seq
 499998816     gbpln666.seq
 419298531     gbpln667.seq
 477033429     gbpln668.seq
 679344023     gbpln669.seq
 440542307     gbpln67.seq
 873797632     gbpln670.seq
 820367220     gbpln671.seq
 806296382     gbpln672.seq
 775209384     gbpln673.seq
 744231520     gbpln674.seq
 817156402     gbpln675.seq
 771380170     gbpln676.seq
 913253142     gbpln677.seq
 634934982     gbpln678.seq
1019175188     gbpln679.seq
 452992006     gbpln68.seq
1023638564     gbpln680.seq
 822225605     gbpln681.seq
 961290952     gbpln682.seq
1090804562     gbpln683.seq
 813694518     gbpln684.seq
 962545328     gbpln685.seq
 873725319     gbpln686.seq
 673190932     gbpln687.seq
 905064826     gbpln688.seq
 908590682     gbpln689.seq
 497916786     gbpln69.seq
 742712720     gbpln690.seq
 793279946     gbpln691.seq
 934932909     gbpln692.seq
 640700840     gbpln693.seq
 961568346     gbpln694.seq
 952066709     gbpln695.seq
 827214105     gbpln696.seq
 455119462     gbpln697.seq
 483798258     gbpln698.seq
 408962039     gbpln699.seq
 499991171     gbpln7.seq
 480376128     gbpln70.seq
 329779393     gbpln700.seq
 332794404     gbpln701.seq
 418495189     gbpln702.seq
 443558619     gbpln703.seq
 449429603     gbpln704.seq
 403262216     gbpln705.seq
 477398793     gbpln706.seq
 434139529     gbpln707.seq
 488358692     gbpln708.seq
 482840837     gbpln709.seq
  71745252     gbpln71.seq
 469665157     gbpln710.seq
 228132202     gbpln711.seq
 434627789     gbpln712.seq
 412605137     gbpln713.seq
 486452574     gbpln714.seq
 475648613     gbpln715.seq
 480187598     gbpln716.seq
 445114184     gbpln717.seq
 461854061     gbpln718.seq
 499646071     gbpln719.seq
 470915914     gbpln72.seq
 476206835     gbpln720.seq
 473737289     gbpln721.seq
 467895412     gbpln722.seq
 390847334     gbpln723.seq
 472129613     gbpln73.seq
 477884160     gbpln74.seq
 460004048     gbpln75.seq
 430418757     gbpln76.seq
 441540696     gbpln77.seq
 433637010     gbpln78.seq
 498225038     gbpln79.seq
 225389923     gbpln8.seq
 107501131     gbpln80.seq
 449964742     gbpln81.seq
 422837725     gbpln82.seq
 383453843     gbpln83.seq
 376172115     gbpln84.seq
 326317072     gbpln85.seq
 320571252     gbpln86.seq
 286199716     gbpln87.seq
 277716231     gbpln88.seq
 499733063     gbpln89.seq
 499990067     gbpln9.seq
  63743689     gbpln90.seq
 391026515     gbpln91.seq
 362500946     gbpln92.seq
 390024684     gbpln93.seq
 341773034     gbpln94.seq
 199854530     gbpln95.seq
 483137313     gbpln96.seq
 493806535     gbpln97.seq
 497200072     gbpln98.seq
 492442383     gbpln99.seq
 148373605     gbpri1.seq
 499825465     gbpri10.seq
 499966274     gbpri11.seq
 248882813     gbpri12.seq
 499849548     gbpri13.seq
 352975484     gbpri14.seq
 162642387     gbpri15.seq
 494717022     gbpri16.seq
 499956353     gbpri17.seq
 499952905     gbpri18.seq
 499962231     gbpri19.seq
 499849563     gbpri2.seq
 254317986     gbpri20.seq
 317623183     gbpri21.seq
 301998886     gbpri22.seq
 491209604     gbpri23.seq
 445784104     gbpri24.seq
 381563743     gbpri25.seq
 343179555     gbpri26.seq
 476586505     gbpri27.seq
 474070691     gbpri28.seq
 368091958     gbpri29.seq
 499891257     gbpri3.seq
 499999042     gbpri30.seq
  73664678     gbpri31.seq
 499936200     gbpri32.seq
 445708926     gbpri33.seq
 427945376     gbpri34.seq
 376528667     gbpri35.seq
 483909000     gbpri36.seq
 361487740     gbpri37.seq
 388659484     gbpri38.seq
 448630212     gbpri39.seq
 499855390     gbpri4.seq
 499941391     gbpri40.seq
 307422144     gbpri41.seq
 499999213     gbpri42.seq
 499997229     gbpri43.seq
 253494046     gbpri44.seq
 499994791     gbpri45.seq
 499999165     gbpri46.seq
 316320939     gbpri47.seq
 499978273     gbpri48.seq
 499467182     gbpri49.seq
 499729136     gbpri5.seq
 314294173     gbpri50.seq
 258775295     gbpri51.seq
 499996591     gbpri52.seq
 499999458     gbpri53.seq
 499979415     gbpri54.seq
 255720560     gbpri55.seq
 393528728     gbpri6.seq
 499802910     gbpri7.seq
 499984899     gbpri8.seq
 499967070     gbpri9.seq
    642260     gbrel.txt
 499981989     gbrod1.seq
 499996868     gbrod10.seq
   6033878     gbrod11.seq
 499808129     gbrod12.seq
 203924668     gbrod13.seq
 499994342     gbrod14.seq
 499997569     gbrod15.seq
 499999864     gbrod16.seq
 294669555     gbrod17.seq
 402778539     gbrod18.seq
 485622431     gbrod19.seq
 499802341     gbrod2.seq
 447177606     gbrod20.seq
 401874104     gbrod21.seq
 366906621     gbrod22.seq
 178573599     gbrod23.seq
 488460696     gbrod24.seq
 424418862     gbrod25.seq
 451727059     gbrod26.seq
 499112036     gbrod27.seq
 467946548     gbrod28.seq
 425428799     gbrod29.seq
 499880319     gbrod3.seq
 380509124     gbrod30.seq
 359291146     gbrod31.seq
 441031541     gbrod32.seq
 489661762     gbrod33.seq
 301541840     gbrod34.seq
 245696968     gbrod35.seq
 444533522     gbrod36.seq
 404901396     gbrod37.seq
 350079181     gbrod38.seq
 484303888     gbrod39.seq
 499702715     gbrod4.seq
 464197213     gbrod40.seq
 311672321     gbrod41.seq
 441713729     gbrod42.seq
 398906813     gbrod43.seq
 493373336     gbrod44.seq
 407105696     gbrod45.seq
 117842878     gbrod46.seq
 488265022     gbrod47.seq
 434197329     gbrod48.seq
 412800312     gbrod49.seq
 499960342     gbrod5.seq
 454365663     gbrod50.seq
 382748472     gbrod51.seq
 428038719     gbrod52.seq
 487918369     gbrod53.seq
 440586747     gbrod54.seq
 359290553     gbrod55.seq
 404808846     gbrod56.seq
 258123670     gbrod57.seq
 390007635     gbrod58.seq
 346418766     gbrod59.seq
  80291490     gbrod6.seq
 345548222     gbrod60.seq
 465925928     gbrod61.seq
 403537722     gbrod62.seq
 386823577     gbrod63.seq
 403462511     gbrod64.seq
 391812927     gbrod65.seq
 346719868     gbrod66.seq
 491742089     gbrod67.seq
 445010312     gbrod68.seq
 493387550     gbrod69.seq
 499846851     gbrod7.seq
 300864949     gbrod70.seq
 466768965     gbrod71.seq
 374387663     gbrod72.seq
 350248940     gbrod73.seq
 470230178     gbrod74.seq
 465917437     gbrod75.seq
 493546372     gbrod76.seq
 241665310     gbrod77.seq
 499742719     gbrod8.seq
 499945822     gbrod9.seq
 499998599     gbsts1.seq
 499997655     gbsts10.seq
 433283954     gbsts11.seq
 499997185     gbsts2.seq
  38079720     gbsts3.seq
 499998792     gbsts4.seq
 499996883     gbsts5.seq
 456729482     gbsts6.seq
 499997464     gbsts7.seq
 499999438     gbsts8.seq
  21538013     gbsts9.seq
 300834655     gbsyn1.seq
 484840372     gbsyn10.seq
 420813753     gbsyn11.seq
 490139440     gbsyn12.seq
 343340422     gbsyn13.seq
 372527348     gbsyn14.seq
 417861289     gbsyn15.seq
 448312981     gbsyn16.seq
 416378132     gbsyn17.seq
 453065790     gbsyn18.seq
 263307032     gbsyn19.seq
 343340424     gbsyn2.seq
 484840366     gbsyn20.seq
 420813747     gbsyn21.seq
 498979310     gbsyn22.seq
 497724336     gbsyn23.seq
  50815379     gbsyn24.seq
 499993129     gbsyn25.seq
 499996365     gbsyn26.seq
 499999703     gbsyn27.seq
 244647760     gbsyn28.seq
 345015460     gbsyn29.seq
 372527353     gbsyn3.seq
 417861297     gbsyn4.seq
 448312992     gbsyn5.seq
  81377357     gbsyn6.seq
 470781602     gbsyn7.seq
 317285242     gbsyn8.seq
 263307034     gbsyn9.seq
 499999476     gbtsa1.seq
 500000000     gbtsa10.seq
 499997439     gbtsa100.seq
 499999811     gbtsa101.seq
 499996108     gbtsa102.seq
 404671505     gbtsa103.seq
 499996434     gbtsa104.seq
 499998444     gbtsa105.seq
 499998535     gbtsa106.seq
 473627173     gbtsa107.seq
 499999949     gbtsa108.seq
 499998832     gbtsa109.seq
 499997424     gbtsa11.seq
 236669988     gbtsa110.seq
 499991596     gbtsa111.seq
 499999834     gbtsa112.seq
 499999770     gbtsa113.seq
 499998939     gbtsa114.seq
  34150369     gbtsa115.seq
 499995781     gbtsa116.seq
 499999069     gbtsa117.seq
 499994937     gbtsa118.seq
 470659755     gbtsa119.seq
 280130073     gbtsa12.seq
 499998218     gbtsa120.seq
 499998672     gbtsa121.seq
 499999924     gbtsa122.seq
 280313902     gbtsa123.seq
 499999116     gbtsa124.seq
 499998111     gbtsa125.seq
 499999818     gbtsa126.seq
 423256101     gbtsa127.seq
 499996235     gbtsa13.seq
 499998198     gbtsa14.seq
 152208041     gbtsa15.seq
 499999603     gbtsa16.seq
 499997193     gbtsa17.seq
 258373800     gbtsa18.seq
 499998168     gbtsa19.seq
 499998745     gbtsa2.seq
 499999213     gbtsa20.seq
 500000233     gbtsa21.seq
  67592738     gbtsa22.seq
 499998052     gbtsa23.seq
 499999856     gbtsa24.seq
 499998098     gbtsa25.seq
 277251866     gbtsa26.seq
 499999635     gbtsa27.seq
 499999791     gbtsa28.seq
  71311344     gbtsa29.seq
 146901025     gbtsa3.seq
 499999538     gbtsa30.seq
 499999007     gbtsa31.seq
 158252503     gbtsa32.seq
 499998095     gbtsa33.seq
 499999071     gbtsa34.seq
 499998984     gbtsa35.seq
 489509289     gbtsa36.seq
 499999807     gbtsa37.seq
 499998500     gbtsa38.seq
 499999107     gbtsa39.seq
 499998574     gbtsa4.seq
 227191517     gbtsa40.seq
 499999675     gbtsa41.seq
 499991892     gbtsa42.seq
 500000238     gbtsa43.seq
 175111340     gbtsa44.seq
 499998997     gbtsa45.seq
 499999560     gbtsa46.seq
 354820880     gbtsa47.seq
 499999373     gbtsa48.seq
 499997080     gbtsa49.seq
 499999957     gbtsa5.seq
 292181365     gbtsa50.seq
 499999724     gbtsa51.seq
 499991820     gbtsa52.seq
 394986405     gbtsa53.seq
 499997625     gbtsa54.seq
 499998684     gbtsa55.seq
 500000232     gbtsa56.seq
 344426441     gbtsa57.seq
 499999428     gbtsa58.seq
 499998841     gbtsa59.seq
  50314975     gbtsa6.seq
 499998177     gbtsa60.seq
 224353812     gbtsa61.seq
 499999722     gbtsa62.seq
 500000157     gbtsa63.seq
 259943701     gbtsa64.seq
 499999212     gbtsa65.seq
 465402653     gbtsa66.seq
 499998493     gbtsa67.seq
 499999436     gbtsa68.seq
 499996902     gbtsa69.seq
 499997923     gbtsa7.seq
 165103829     gbtsa70.seq
 499997567     gbtsa71.seq
 500000162     gbtsa72.seq
 499998185     gbtsa73.seq
   2512297     gbtsa74.seq
 499998773     gbtsa75.seq
 499998780     gbtsa76.seq
 131409934     gbtsa77.seq
 500000012     gbtsa78.seq
 500000259     gbtsa79.seq
 499999246     gbtsa8.seq
  33928768     gbtsa80.seq
 499999375     gbtsa81.seq
 499997795     gbtsa82.seq
 499997482     gbtsa83.seq
 499998016     gbtsa84.seq
  45872069     gbtsa85.seq
 499997106     gbtsa86.seq
 499998546     gbtsa87.seq
 499999206     gbtsa88.seq
  81426641     gbtsa89.seq
 270158740     gbtsa9.seq
 499999824     gbtsa90.seq
 389215892     gbtsa91.seq
 499998191     gbtsa92.seq
 499994249     gbtsa93.seq
 499998640     gbtsa94.seq
 208350764     gbtsa95.seq
 499999734     gbtsa96.seq
 499998253     gbtsa97.seq
 499996332     gbtsa98.seq
 230879944     gbtsa99.seq
   6988139     gbuna1.seq
 499987069     gbvrl1.seq
 499998794     gbvrl10.seq
 150321695     gbvrl100.seq
 499953141     gbvrl101.seq
 499960793     gbvrl102.seq
 499946910     gbvrl103.seq
 214543625     gbvrl104.seq
 499956868     gbvrl105.seq
 499974572     gbvrl106.seq
 499994474     gbvrl107.seq
 430275488     gbvrl108.seq
 499934576     gbvrl109.seq
 499997946     gbvrl11.seq
 499974346     gbvrl110.seq
 499953273     gbvrl111.seq
 141266751     gbvrl112.seq
 499996571     gbvrl113.seq
 499940774     gbvrl114.seq
 499941879     gbvrl115.seq
 486728508     gbvrl116.seq
 499940734     gbvrl117.seq
 499977133     gbvrl118.seq
 499933715     gbvrl119.seq
 163448812     gbvrl12.seq
 255154323     gbvrl120.seq
 499937909     gbvrl121.seq
 499973710     gbvrl122.seq
 499978131     gbvrl123.seq
 499922408     gbvrl124.seq
 499979954     gbvrl125.seq
 499969369     gbvrl126.seq
 499946225     gbvrl127.seq
 499984641     gbvrl128.seq
 299365572     gbvrl129.seq
 499997099     gbvrl13.seq
 499962058     gbvrl130.seq
 499975522     gbvrl131.seq
 499984933     gbvrl132.seq
 499965728     gbvrl133.seq
 499976578     gbvrl134.seq
 225739938     gbvrl135.seq
 499977611     gbvrl136.seq
 499973738     gbvrl137.seq
 499972748     gbvrl138.seq
 322559158     gbvrl139.seq
 500000227     gbvrl14.seq
 499982106     gbvrl140.seq
 499975547     gbvrl141.seq
 499968141     gbvrl142.seq
 291475553     gbvrl143.seq
 499949846     gbvrl144.seq
 499933769     gbvrl145.seq
 499983228     gbvrl146.seq
 180054134     gbvrl147.seq
 499978198     gbvrl148.seq
 499985057     gbvrl149.seq
 134079046     gbvrl15.seq
 499982515     gbvrl150.seq
 499984082     gbvrl151.seq
 250466088     gbvrl152.seq
 499952026     gbvrl153.seq
 499947386     gbvrl154.seq
 499960671     gbvrl155.seq
 236516451     gbvrl156.seq
 499977873     gbvrl157.seq
 499967768     gbvrl158.seq
 499954383     gbvrl159.seq
 499995724     gbvrl16.seq
 499941968     gbvrl160.seq
 278377477     gbvrl161.seq
 499950927     gbvrl162.seq
 499940627     gbvrl163.seq
 499954943     gbvrl164.seq
 499963090     gbvrl165.seq
 223251848     gbvrl166.seq
 499944502     gbvrl167.seq
 499950680     gbvrl168.seq
 499953190     gbvrl169.seq
 499998549     gbvrl17.seq
 339478045     gbvrl170.seq
 499993830     gbvrl171.seq
 499934947     gbvrl172.seq
 499985678     gbvrl173.seq
 172688199     gbvrl174.seq
 499962254     gbvrl175.seq
 499965978     gbvrl176.seq
 499990815     gbvrl177.seq
 148140201     gbvrl178.seq
 499951048     gbvrl179.seq
 315373785     gbvrl18.seq
 499953302     gbvrl180.seq
 499952035     gbvrl181.seq
 459055897     gbvrl182.seq
 499942504     gbvrl183.seq
 499947570     gbvrl184.seq
 499954671     gbvrl185.seq
 498686618     gbvrl186.seq
 499990413     gbvrl187.seq
 499992817     gbvrl188.seq
 499951246     gbvrl189.seq
 499999792     gbvrl19.seq
 195260422     gbvrl190.seq
 499952800     gbvrl191.seq
 499986663     gbvrl192.seq
 499984444     gbvrl193.seq
 351511049     gbvrl194.seq
 499965887     gbvrl195.seq
 499937276     gbvrl196.seq
 499960413     gbvrl197.seq
 199747251     gbvrl198.seq
 499995642     gbvrl199.seq
 499985625     gbvrl2.seq
 499995881     gbvrl20.seq
 499970907     gbvrl200.seq
 499960638     gbvrl201.seq
 238485038     gbvrl202.seq
 499963930     gbvrl203.seq
 499972058     gbvrl204.seq
 499962279     gbvrl205.seq
 499980096     gbvrl206.seq
 128444413     gbvrl207.seq
 499977910     gbvrl208.seq
 499980704     gbvrl209.seq
 345421454     gbvrl21.seq
 499949114     gbvrl210.seq
 327060992     gbvrl211.seq
 499981225     gbvrl212.seq
 499980321     gbvrl213.seq
 499973351     gbvrl214.seq
 328693374     gbvrl215.seq
 490193585     gbvrl216.seq
 499992500     gbvrl217.seq
 252523082     gbvrl218.seq
  76688277     gbvrl219.seq
 499995747     gbvrl22.seq
 499994644     gbvrl220.seq
 499965832     gbvrl221.seq
 499992766     gbvrl222.seq
 249246445     gbvrl223.seq
 499997356     gbvrl224.seq
 499968021     gbvrl225.seq
 499975157     gbvrl226.seq
 277362516     gbvrl227.seq
 499986328     gbvrl228.seq
 499980027     gbvrl229.seq
 499998678     gbvrl23.seq
 499966393     gbvrl230.seq
 168156082     gbvrl231.seq
 499975260     gbvrl232.seq
 499961425     gbvrl233.seq
 499971521     gbvrl234.seq
 142698270     gbvrl235.seq
 499994331     gbvrl236.seq
 499995803     gbvrl237.seq
 499991037     gbvrl238.seq
 257487211     gbvrl239.seq
 368977365     gbvrl24.seq
 499977149     gbvrl240.seq
 499988829     gbvrl241.seq
 499978366     gbvrl242.seq
 139136987     gbvrl243.seq
 499971782     gbvrl244.seq
 499992483     gbvrl245.seq
 499968666     gbvrl246.seq
 259142646     gbvrl247.seq
 499993900     gbvrl248.seq
 499972337     gbvrl249.seq
 499997531     gbvrl25.seq
 499989180     gbvrl250.seq
 123572894     gbvrl251.seq
 499970770     gbvrl252.seq
 499994066     gbvrl253.seq
 499994968     gbvrl254.seq
 468067502     gbvrl255.seq
 499990734     gbvrl256.seq
 499988330     gbvrl257.seq
 499996240     gbvrl258.seq
 117898728     gbvrl259.seq
 499998144     gbvrl26.seq
 499981425     gbvrl260.seq
 499995991     gbvrl261.seq
 499976985     gbvrl262.seq
 358748992     gbvrl263.seq
 499994806     gbvrl264.seq
 499976145     gbvrl265.seq
 499997431     gbvrl266.seq
 499999910     gbvrl267.seq
 276718106     gbvrl268.seq
 499962348     gbvrl269.seq
 313286630     gbvrl27.seq
 499989399     gbvrl270.seq
 499993733     gbvrl271.seq
 499981063     gbvrl272.seq
  52572525     gbvrl273.seq
 499984509     gbvrl274.seq
 499996575     gbvrl275.seq
 499977380     gbvrl276.seq
 400878802     gbvrl277.seq
 499965920     gbvrl278.seq
 499974118     gbvrl279.seq
 499865291     gbvrl28.seq
 499974067     gbvrl280.seq
 354396199     gbvrl281.seq
 499975084     gbvrl282.seq
 499977309     gbvrl283.seq
 499974395     gbvrl284.seq
 244521075     gbvrl285.seq
 499966139     gbvrl286.seq
 499996905     gbvrl287.seq
 499963466     gbvrl288.seq
 499997115     gbvrl289.seq
 499998097     gbvrl29.seq
  35598720     gbvrl290.seq
 499989006     gbvrl291.seq
 499977529     gbvrl292.seq
 499979310     gbvrl293.seq
 499968321     gbvrl294.seq
 499993627     gbvrl295.seq
 499998321     gbvrl296.seq
  95942267     gbvrl297.seq
 410761506     gbvrl3.seq
 499945939     gbvrl30.seq
 235662835     gbvrl31.seq
 499998903     gbvrl32.seq
 499995114     gbvrl33.seq
 418646485     gbvrl34.seq
 499997528     gbvrl35.seq
 499998009     gbvrl36.seq
 414678832     gbvrl37.seq
 499996395     gbvrl38.seq
 499964993     gbvrl39.seq
 499997494     gbvrl4.seq
 499949323     gbvrl40.seq
 293939818     gbvrl41.seq
 499981546     gbvrl42.seq
 499975179     gbvrl43.seq
 499998727     gbvrl44.seq
 260540134     gbvrl45.seq
 499999787     gbvrl46.seq
 499942109     gbvrl47.seq
 499945464     gbvrl48.seq
 268297461     gbvrl49.seq
 499999396     gbvrl5.seq
 499959873     gbvrl50.seq
 499936830     gbvrl51.seq
 499989617     gbvrl52.seq
 240561123     gbvrl53.seq
 499996635     gbvrl54.seq
 499989308     gbvrl55.seq
 499984781     gbvrl56.seq
 499991092     gbvrl57.seq
 172337603     gbvrl58.seq
 499987842     gbvrl59.seq
 499998092     gbvrl6.seq
 499967376     gbvrl60.seq
 499958899     gbvrl61.seq
 499997051     gbvrl62.seq
 145793273     gbvrl63.seq
 499997121     gbvrl64.seq
 499936336     gbvrl65.seq
 499972736     gbvrl66.seq
 499996808     gbvrl67.seq
 147718284     gbvrl68.seq
 499945961     gbvrl69.seq
 499982131     gbvrl7.seq
 499972498     gbvrl70.seq
 499946837     gbvrl71.seq
 404362819     gbvrl72.seq
 499987169     gbvrl73.seq
 499977239     gbvrl74.seq
 499968855     gbvrl75.seq
 351999346     gbvrl76.seq
 499992918     gbvrl77.seq
 499968454     gbvrl78.seq
 499981459     gbvrl79.seq
 301488815     gbvrl8.seq
 305731505     gbvrl80.seq
 499953123     gbvrl81.seq
 499955513     gbvrl82.seq
 499974011     gbvrl83.seq
 131030273     gbvrl84.seq
 499946750     gbvrl85.seq
 499973761     gbvrl86.seq
 499970054     gbvrl87.seq
 184714838     gbvrl88.seq
 499986785     gbvrl89.seq
 499998102     gbvrl9.seq
 499999623     gbvrl90.seq
 499938095     gbvrl91.seq
 171048708     gbvrl92.seq
 499947589     gbvrl93.seq
 499997858     gbvrl94.seq
 499939664     gbvrl95.seq
 215279838     gbvrl96.seq
 499978736     gbvrl97.seq
 499939881     gbvrl98.seq
 499996642     gbvrl99.seq
 499954150     gbvrt1.seq
 289935612     gbvrt10.seq
1063697373     gbvrt100.seq
1045817456     gbvrt101.seq
 754876698     gbvrt102.seq
 616753988     gbvrt103.seq
 490283916     gbvrt104.seq
 470651151     gbvrt105.seq
 397152890     gbvrt106.seq
 351566814     gbvrt107.seq
 339881554     gbvrt108.seq
 404716166     gbvrt109.seq
  87348314     gbvrt11.seq
 489465929     gbvrt110.seq
 499108511     gbvrt111.seq
 486719349     gbvrt112.seq
  58362562     gbvrt113.seq
 436489699     gbvrt114.seq
 486735687     gbvrt115.seq
 492786702     gbvrt116.seq
 424170309     gbvrt117.seq
 281367593     gbvrt118.seq
 478264522     gbvrt119.seq
 499776413     gbvrt12.seq
 485840122     gbvrt120.seq
 493662272     gbvrt121.seq
  75046811     gbvrt122.seq
 979125221     gbvrt123.seq
 838606764     gbvrt124.seq
 678362247     gbvrt125.seq
 476490051     gbvrt126.seq
 461393141     gbvrt127.seq
 438814149     gbvrt128.seq
 394334276     gbvrt129.seq
 284656236     gbvrt13.seq
 313818221     gbvrt130.seq
 288999697     gbvrt131.seq
 280186115     gbvrt132.seq
 407765043     gbvrt133.seq
 421856869     gbvrt134.seq
 478932645     gbvrt135.seq
 480028007     gbvrt136.seq
 438022009     gbvrt137.seq
 174441466     gbvrt138.seq
 487902327     gbvrt139.seq
  15637437     gbvrt14.seq
 456814552     gbvrt140.seq
 462308829     gbvrt141.seq
 168813991     gbvrt142.seq
 455915969     gbvrt143.seq
 469542169     gbvrt144.seq
 479148432     gbvrt145.seq
 211438035     gbvrt146.seq
 481255007     gbvrt147.seq
 475910668     gbvrt148.seq
 366785231     gbvrt149.seq
  36032850     gbvrt15.seq
 464881586     gbvrt150.seq
 474452025     gbvrt151.seq
 234874130     gbvrt152.seq
 697335450     gbvrt153.seq
 670835803     gbvrt154.seq
 524090553     gbvrt155.seq
 413420126     gbvrt156.seq
 345317144     gbvrt157.seq
 329841089     gbvrt158.seq
 250750417     gbvrt159.seq
  18507952     gbvrt16.seq
 486600390     gbvrt160.seq
 364885711     gbvrt161.seq
 448395879     gbvrt162.seq
 471877569     gbvrt163.seq
 393642536     gbvrt164.seq
 355134416     gbvrt165.seq
 470602746     gbvrt166.seq
 448657488     gbvrt167.seq
 384724558     gbvrt168.seq
 432320923     gbvrt169.seq
 497676663     gbvrt17.seq
 470227916     gbvrt170.seq
 497676594     gbvrt171.seq
 207882210     gbvrt172.seq
 397267013     gbvrt173.seq
 366771863     gbvrt174.seq
 351249970     gbvrt175.seq
 309532358     gbvrt176.seq
 296271444     gbvrt177.seq
 286321426     gbvrt178.seq
 268164730     gbvrt179.seq
 497173924     gbvrt18.seq
 253329800     gbvrt180.seq
 494939336     gbvrt181.seq
 424426418     gbvrt182.seq
 410896883     gbvrt183.seq
 369957025     gbvrt184.seq
 169574120     gbvrt185.seq
 426847158     gbvrt186.seq
 496824508     gbvrt187.seq
 434394791     gbvrt188.seq
 494363156     gbvrt189.seq
 481350583     gbvrt19.seq
  61896426     gbvrt190.seq
 431425246     gbvrt191.seq
 474666330     gbvrt192.seq
 479195821     gbvrt193.seq
 352877651     gbvrt194.seq
 479851070     gbvrt195.seq
 497038176     gbvrt196.seq
 432867963     gbvrt197.seq
 439843808     gbvrt198.seq
 469531790     gbvrt199.seq
 499840341     gbvrt2.seq
 400795564     gbvrt20.seq
 496015817     gbvrt200.seq
 488626307     gbvrt201.seq
 432135676     gbvrt202.seq
  70119528     gbvrt203.seq
 491056051     gbvrt204.seq
 328508705     gbvrt205.seq
 497328806     gbvrt206.seq
 499238966     gbvrt207.seq
 187508760     gbvrt208.seq
 490842556     gbvrt209.seq
 488197715     gbvrt21.seq
 463385772     gbvrt210.seq
 446788975     gbvrt211.seq
 438416202     gbvrt212.seq
 170595769     gbvrt213.seq
 451342688     gbvrt214.seq
 474563355     gbvrt215.seq
 461335548     gbvrt216.seq
 436658187     gbvrt217.seq
 154682616     gbvrt218.seq
 456837606     gbvrt219.seq
 479291185     gbvrt22.seq
 488930196     gbvrt220.seq
 466502331     gbvrt221.seq
 455725140     gbvrt222.seq
 453475816     gbvrt223.seq
 462276007     gbvrt224.seq
 497473221     gbvrt225.seq
 499283767     gbvrt226.seq
 481742871     gbvrt227.seq
  54779872     gbvrt228.seq
 477445338     gbvrt229.seq
 480798341     gbvrt23.seq
 495314515     gbvrt230.seq
 486008997     gbvrt231.seq
 489200687     gbvrt232.seq
 499533927     gbvrt233.seq
 347467755     gbvrt234.seq
1068402516     gbvrt235.seq
1067356333     gbvrt236.seq
 896844819     gbvrt237.seq
 805318347     gbvrt238.seq
 718662677     gbvrt239.seq
 499274554     gbvrt24.seq
 556944666     gbvrt240.seq
 299728838     gbvrt241.seq
 293507186     gbvrt242.seq
 484357811     gbvrt243.seq
 130768604     gbvrt244.seq
 874873715     gbvrt245.seq
 685858825     gbvrt246.seq
 627564227     gbvrt247.seq
 610271897     gbvrt248.seq
 543871783     gbvrt249.seq
 483255170     gbvrt25.seq
 284797667     gbvrt250.seq
 269299175     gbvrt251.seq
 474717664     gbvrt252.seq
 402979396     gbvrt253.seq
 343325815     gbvrt254.seq
 450550965     gbvrt255.seq
 494368803     gbvrt256.seq
 470715963     gbvrt257.seq
 470514883     gbvrt258.seq
 229630839     gbvrt259.seq
 484153821     gbvrt26.seq
 499996957     gbvrt260.seq
 499996385     gbvrt261.seq
 469738760     gbvrt262.seq
 489937353     gbvrt263.seq
 456891433     gbvrt264.seq
 474231618     gbvrt265.seq
 490948606     gbvrt266.seq
 332441302     gbvrt267.seq
 477156039     gbvrt268.seq
 499226352     gbvrt269.seq
  65325604     gbvrt27.seq
 477696169     gbvrt270.seq
 353039605     gbvrt271.seq
 438196164     gbvrt272.seq
 489809255     gbvrt273.seq
 460938782     gbvrt274.seq
 476280761     gbvrt275.seq
 497596868     gbvrt276.seq
 443693971     gbvrt277.seq
 437233554     gbvrt28.seq
 488520688     gbvrt29.seq
 466371162     gbvrt3.seq
 456456384     gbvrt30.seq
 341830592     gbvrt31.seq
  14151693     gbvrt32.seq
  21383246     gbvrt33.seq
  90967413     gbvrt34.seq
 499908979     gbvrt35.seq
 499997267     gbvrt36.seq
 499999918     gbvrt37.seq
  56876991     gbvrt38.seq
 499999798     gbvrt39.seq
 179100370     gbvrt4.seq
 269765184     gbvrt40.seq
 385151455     gbvrt41.seq
 490595601     gbvrt42.seq
 386502843     gbvrt43.seq
 499998312     gbvrt44.seq
 114203169     gbvrt45.seq
 499998432     gbvrt46.seq
 444774203     gbvrt47.seq
 499999915     gbvrt48.seq
  28726185     gbvrt49.seq
 448778544     gbvrt5.seq
 444168690     gbvrt50.seq
 499998435     gbvrt51.seq
 388058364     gbvrt52.seq
 499999084     gbvrt53.seq
 279896431     gbvrt54.seq
 499997676     gbvrt55.seq
 499791786     gbvrt56.seq
 499537594     gbvrt57.seq
 483747895     gbvrt58.seq
 483022576     gbvrt59.seq
 490703641     gbvrt6.seq
 450977918     gbvrt60.seq
 202128841     gbvrt61.seq
 123737443     gbvrt62.seq
 483315203     gbvrt63.seq
 481925504     gbvrt64.seq
 499999199     gbvrt65.seq
 499926681     gbvrt66.seq
 296494910     gbvrt67.seq
 492181094     gbvrt68.seq
 492375887     gbvrt69.seq
 499120716     gbvrt7.seq
 479677491     gbvrt70.seq
 480814553     gbvrt71.seq
 362168611     gbvrt72.seq
 490950275     gbvrt73.seq
 475405574     gbvrt74.seq
 489430322     gbvrt75.seq
 352376975     gbvrt76.seq
 465372186     gbvrt77.seq
 488788789     gbvrt78.seq
 189348250     gbvrt79.seq
 483670669     gbvrt8.seq
 451948482     gbvrt80.seq
 443703248     gbvrt81.seq
 400719178     gbvrt82.seq
 427517644     gbvrt83.seq
 319264824     gbvrt84.seq
 275756309     gbvrt85.seq
 252640763     gbvrt86.seq
 251496345     gbvrt87.seq
 466369516     gbvrt88.seq
 418722220     gbvrt89.seq
 263759647     gbvrt9.seq
 186091498     gbvrt90.seq
 404212770     gbvrt91.seq
 481131817     gbvrt92.seq
 474827267     gbvrt93.seq
 480710662     gbvrt94.seq
  89576280     gbvrt95.seq
 435880706     gbvrt96.seq
 487966705     gbvrt97.seq
 497561523     gbvrt98.seq
 468911614     gbvrt99.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         101755     185776336
BCT10        101        247874669
BCT100       118        229172914
BCT101       127        232212861
BCT102       90         178403076
BCT103       114        212138354
BCT104       75         222053892
BCT105       112        225347102
BCT106       124        217786851
BCT107       3          5977905
BCT108       246        222256023
BCT109       104        221252195
BCT11        145        242443173
BCT110       100        224644129
BCT111       83         222703364
BCT112       21         86233168
BCT113       68         221578114
BCT114       87         219795809
BCT115       87         223588406
BCT116       80         226303150
BCT117       20         45564131
BCT118       124        217933644
BCT119       53         217706139
BCT12        167        262397135
BCT120       90         227492926
BCT121       57         149506400
BCT122       94         223837173
BCT123       73         221711999
BCT124       113        222996943
BCT125       78         197436829
BCT126       156        218173209
BCT127       84         220629983
BCT128       79         216070642
BCT129       141        228566924
BCT13        6          12749856
BCT130       106        221256144
BCT131       80         221199213
BCT132       92         196245950
BCT133       115        225967887
BCT134       92         220409897
BCT135       158        214217907
BCT136       88         207032597
BCT137       140        220978157
BCT138       63         217844098
BCT139       90         215013764
BCT14        170        237845538
BCT140       125        217101319
BCT141       88         223616604
BCT142       21         65066945
BCT143       174        220602790
BCT144       128        221993348
BCT145       118        216449560
BCT146       170        220678956
BCT147       54         177570665
BCT148       104        218683705
BCT149       113        217389079
BCT15        151        240481452
BCT150       138        222247056
BCT151       109        220993944
BCT152       101        223667628
BCT153       118        156232056
BCT154       95         229134325
BCT155       104        222093509
BCT156       97         225362965
BCT157       116        220401677
BCT158       94         219188969
BCT159       134        220654115
BCT16        199        252481270
BCT160       36         70525291
BCT161       169        220902023
BCT162       100        223727909
BCT163       94         222167747
BCT164       94         214484227
BCT165       71         223304376
BCT166       123        228309968
BCT167       150        228808455
BCT168       80         212893326
BCT169       100        233591727
BCT17        206        229349878
BCT170       96         224405035
BCT171       134        223606319
BCT172       84         220867011
BCT173       24         84218657
BCT174       119        222185746
BCT175       151        231715107
BCT176       72         216080650
BCT177       81         120955479
BCT178       111        216184725
BCT179       156        227708035
BCT18        2          4770723
BCT180       111        220250972
BCT181       89         136614524
BCT182       133        229717687
BCT183       111        208992481
BCT184       108        219925553
BCT185       77         222877345
BCT186       18         29103391
BCT187       98         220152536
BCT188       133        227333368
BCT189       125        230906352
BCT19        136        236547259
BCT190       118        245874590
BCT191       114        233627230
BCT192       32         86501281
BCT193       131        216438017
BCT194       93         226438829
BCT195       108        224087651
BCT196       116        221458112
BCT197       65         122261042
BCT198       127        225144984
BCT199       138        260159052
BCT2         107        227274960
BCT20        113        230295403
BCT200       100        228658169
BCT201       159        214896641
BCT202       66         106598168
BCT203       123        222422665
BCT204       115        218469346
BCT205       89         219209021
BCT206       102        224188280
BCT207       104        209481600
BCT208       97         234475408
BCT209       102        220656832
BCT21        140        223708984
BCT210       100        218053674
BCT211       94         224743372
BCT212       104        226992367
BCT213       107        231904945
BCT214       70         148112573
BCT215       104        221826114
BCT216       108        221051727
BCT217       98         226007841
BCT218       76         270744187
BCT219       75         254647899
BCT22        200        220359484
BCT220       106        225376718
BCT221       176        219971681
BCT222       132        226738257
BCT223       55         106489903
BCT224       324        275336670
BCT225       116        218712797
BCT226       118        218047051
BCT227       45         74298835
BCT228       89         220099828
BCT229       86         226600378
BCT23        24         29385563
BCT230       83         233332678
BCT231       103        224217713
BCT232       24         60324544
BCT233       60         216868170
BCT234       120        221119124
BCT235       86         223426276
BCT236       85         217995381
BCT237       30         67668948
BCT238       157        275025230
BCT239       87         234185848
BCT24        174        220036188
BCT240       96         219765338
BCT241       135        191926241
BCT242       109        262921422
BCT243       72         217635148
BCT244       100        214909619
BCT245       76         205489624
BCT246       139        302417525
BCT247       68         237086992
BCT248       89         216490270
BCT249       136        225170875
BCT25        157        217996559
BCT250       143        277240703
BCT251       36         65426533
BCT252       146        273570514
BCT253       109        252612009
BCT254       35         229012536
BCT255       56         209847636
BCT256       110        218761905
BCT257       130        219578217
BCT258       90         250893937
BCT259       80         203207828
BCT26        52         221902715
BCT260       124        215159011
BCT261       113        223367533
BCT262       144        228597181
BCT263       114        228439247
BCT264       114        231113225
BCT265       120        228230620
BCT266       26         74228471
BCT267       106        218843831
BCT268       82         215186387
BCT269       87         232931079
BCT27        105        237356821
BCT270       98         219566714
BCT271       13         10410673
BCT272       93         235647841
BCT273       104        235928514
BCT274       69         223063860
BCT275       99         208185886
BCT276       119        217748117
BCT277       165        223745463
BCT278       161        212763762
BCT279       133        231781514
BCT28        52         95125656
BCT280       100        227626264
BCT281       123        231590590
BCT282       160        251320587
BCT283       101        227802166
BCT284       122        221777912
BCT285       112        212578426
BCT286       96         229032785
BCT287       123        222518405
BCT288       174        224603753
BCT289       146        214297168
BCT29        81         239594577
BCT290       66         116580172
BCT291       130        226536352
BCT292       105        224013789
BCT293       83         219368049
BCT294       81         216493682
BCT295       103        168153425
BCT296       88         244048892
BCT297       107        228886299
BCT298       83         221517737
BCT299       61         216100377
BCT3         37541      123332243
BCT30        100        222853857
BCT300       75         170636859
BCT301       115        219540003
BCT302       101        218974130
BCT303       124        216924787
BCT304       90         217527347
BCT305       140        185056878
BCT306       124        248813935
BCT307       107        220439447
BCT308       81         229044933
BCT309       63         220852533
BCT31        97         229600245
BCT310       85         172696049
BCT311       128        238885544
BCT312       197        234044756
BCT313       149        219659340
BCT314       120        215711231
BCT315       119        190631862
BCT316       141        246427155
BCT317       167        279237902
BCT318       170        216918027
BCT319       131        219454695
BCT32        126        216152171
BCT320       15         110010139
BCT321       72         228738867
BCT322       128        242193459
BCT323       1242       223734795
BCT324       115        224896454
BCT325       73         187101874
BCT326       101        222185425
BCT327       126        217279454
BCT328       105        212886231
BCT329       130        222884236
BCT33        87         223628495
BCT330       233        231488171
BCT331       188        221578382
BCT332       115        220062307
BCT333       41         85434399
BCT334       123        216507866
BCT335       144        220140457
BCT336       146        218600953
BCT337       124        227417343
BCT338       149        234265173
BCT339       91         238304642
BCT34        112        237222851
BCT340       45         86498994
BCT341       111        224832352
BCT342       159        234833925
BCT343       118        225344370
BCT344       134        231232559
BCT345       61         155047624
BCT346       125        234008897
BCT347       122        226223828
BCT348       77         220312740
BCT349       84         219810323
BCT35        78         216701295
BCT350       55         217536973
BCT351       50         220946014
BCT352       173        224610961
BCT353       3          2825298
BCT354       195        229604129
BCT355       130        250400642
BCT356       142        222978469
BCT357       143        239930821
BCT358       87         243628374
BCT359       84         229185665
BCT36        173        221087703
BCT360       50         217139038
BCT361       44         175383202
BCT362       92         217200838
BCT363       90         231500758
BCT364       117        246538204
BCT365       203        232314981
BCT366       92         220627220
BCT367       120        214832865
BCT368       22         48955354
BCT369       166        261984346
BCT37        463        102794202
BCT370       180        236857563
BCT371       477        233890189
BCT372       139        242904992
BCT373       146        236514918
BCT374       97         227379795
BCT375       52         86072102
BCT376       110        230934388
BCT377       85         220353169
BCT378       92         218533698
BCT379       104        232991105
BCT38        5200       7533877
BCT380       162        222657737
BCT381       42         76520643
BCT382       88         219801256
BCT383       100        226032023
BCT384       156        310068527
BCT385       112        248255848
BCT386       98         283687676
BCT387       79         182479910
BCT388       114        227850421
BCT389       146        217630758
BCT39        10402      13141863
BCT390       105        227003732
BCT391       148        223405170
BCT392       120        225492649
BCT393       113        228111689
BCT394       85         103360782
BCT395       105        226068926
BCT396       143        223058556
BCT397       113        234518747
BCT398       177        218440412
BCT399       29         61315594
BCT4         41293      139254430
BCT40        53922      202025650
BCT400       129        231508633
BCT401       143        217992395
BCT402       140        221014593
BCT403       109        225377333
BCT404       60         159790523
BCT405       108        234695862
BCT406       138        240972634
BCT407       91         305006086
BCT408       97         213066701
BCT409       67         99800639
BCT41        185        214548596
BCT410       120        221718706
BCT411       121        216687071
BCT412       87         221343640
BCT413       93         259722290
BCT414       30         68667546
BCT415       121        215033983
BCT416       119        228238463
BCT417       118        214080125
BCT418       111        222440492
BCT419       8          14459449
BCT42        104        232516945
BCT420       144        219919128
BCT421       107        252494589
BCT422       165        214214629
BCT423       157        206720897
BCT424       238        214458452
BCT425       127        213318904
BCT426       104        217478158
BCT427       110        255776092
BCT428       136        257118794
BCT429       44         107604915
BCT43        116        205561869
BCT430       104        232354566
BCT431       134        236542205
BCT432       110        216989788
BCT433       114        226322790
BCT434       86         179120240
BCT435       154        213693155
BCT436       111        221269896
BCT437       152        220120956
BCT438       97         225592274
BCT439       103        221184160
BCT44        103        222777517
BCT440       302        214942895
BCT441       13         11235012
BCT442       364        210657095
BCT443       110        214726128
BCT444       142        213119125
BCT445       158        217105943
BCT446       168        218983591
BCT447       174        208501241
BCT448       24         45926834
BCT449       161        208257957
BCT45        131        222293417
BCT450       162        212193463
BCT451       114        210605338
BCT452       157        213126972
BCT453       132        209356669
BCT454       131        195243107
BCT455       183        210687290
BCT456       116        210811583
BCT457       136        211510245
BCT458       161        217802986
BCT459       33         52695846
BCT46        123        223122738
BCT460       168        242619762
BCT461       120        224618414
BCT462       137        225114532
BCT463       108        228056033
BCT464       130        222038116
BCT465       135        226318248
BCT466       136        116206201
BCT467       107        232838404
BCT468       107        222331176
BCT469       81         227707449
BCT47        150        224035996
BCT470       95         234188130
BCT471       109        276900176
BCT472       93         194887769
BCT473       124        230097780
BCT474       119        217641315
BCT475       125        220337202
BCT476       188        223112133
BCT477       138        226588520
BCT478       74         139461444
BCT479       107        258561528
BCT48        157        222523995
BCT480       89         212143620
BCT481       158        216707113
BCT482       140        217074444
BCT483       103        225282290
BCT484       132        221285131
BCT485       55         76373529
BCT486       153        254570064
BCT487       123        324975117
BCT488       146        250901786
BCT489       168        231193312
BCT49        103        120901509
BCT490       103        227391066
BCT491       44         136587544
BCT492       99         221181511
BCT493       78         216744669
BCT494       106        237058197
BCT495       122        218820327
BCT496       135        215973173
BCT497       52         62231257
BCT498       130        216065346
BCT499       116        222087369
BCT5         20648      169648440
BCT50        255        227294457
BCT500       138        227688351
BCT501       223        225641574
BCT502       159        128595776
BCT503       133        226910571
BCT504       143        215501748
BCT505       115        245161333
BCT506       133        218420411
BCT507       113        218397373
BCT508       143        181262915
BCT509       127        222414510
BCT51        97         225049518
BCT510       177        214900913
BCT511       139        229085919
BCT512       116        219068031
BCT513       89         130485275
BCT514       148        251704567
BCT515       174        237850274
BCT516       191        210225765
BCT517       121        249972207
BCT518       54         192311109
BCT519       124        232860984
BCT52        105        223456641
BCT520       146        226121334
BCT521       124        228321158
BCT522       97         217908717
BCT523       85         195077841
BCT524       115        216604435
BCT525       119        225008835
BCT526       103        216948181
BCT527       116        225528706
BCT528       78         217338773
BCT529       129        227385316
BCT53        130        225426913
BCT530       160        222067990
BCT531       160        220991096
BCT532       136        221936741
BCT533       124        210548082
BCT534       117        240135398
BCT535       154        229017952
BCT536       149        217774900
BCT537       85         222079398
BCT538       161        193866683
BCT539       115        215447043
BCT54        133        219722042
BCT540       61         208737714
BCT541       60         209982617
BCT542       84         224984489
BCT543       64         199854429
BCT544       68         210819524
BCT545       71         212812398
BCT546       155        225679741
BCT547       150        260219099
BCT548       194        242571616
BCT549       48         126571598
BCT55        107        149028776
BCT550       106        223564250
BCT551       106        220590972
BCT552       114        212633515
BCT553       84         215937422
BCT554       96         111301995
BCT555       121        238759328
BCT556       129        224537672
BCT557       130        220611499
BCT558       123        280622718
BCT559       104        387289395
BCT56        136        223054995
BCT560       77         198902891
BCT561       91         317300604
BCT562       194        223597024
BCT563       119        221819730
BCT564       149        276502385
BCT565       59         56831837
BCT566       108        217448457
BCT567       83         225593113
BCT568       180        271651923
BCT569       92         240469759
BCT57        112        217399067
BCT570       306        215628388
BCT571       103        218153189
BCT572       3          4338004
BCT573       151        260813637
BCT574       126        222051429
BCT575       144        211408275
BCT576       131        210144632
BCT577       25         40157083
BCT578       120        214019483
BCT579       103        217521264
BCT58        131        223635367
BCT580       153        225230137
BCT581       124        218182848
BCT582       182        225109319
BCT583       126        231948035
BCT584       136        227023118
BCT585       115        219330991
BCT586       147        216659927
BCT587       192        236448310
BCT588       65         45380111
BCT589       528        115589384
BCT59        121        221481204
BCT590       1589       2511957
BCT591       3172       5268484
BCT592       6338       7796395
BCT593       12613      14997690
BCT594       25523      27672494
BCT595       50566      54072396
BCT596       148883     156723393
BCT597       14200      193509772
BCT598       3297       203942569
BCT599       2509       213411401
BCT6         2600       37759883
BCT60        138        232661918
BCT600       7215       212675624
BCT601       215        248991489
BCT602       39876      39651493
BCT603       75102      180239641
BCT604       11057      202910557
BCT605       6083       205661265
BCT606       111314     178293294
BCT607       49984      55970182
BCT608       149206     156913692
BCT609       84496      88072043
BCT61        108        225781339
BCT610       144591     151096329
BCT611       25887      25547121
BCT612       132577     167556603
BCT613       31488      43664658
BCT614       116202     178758495
BCT615       7877       17290939
BCT616       32958      53337698
BCT617       30314      251086931
BCT618       6333       288394975
BCT619       5035       225442726
BCT62        38         50860113
BCT620       3847       224092509
BCT621       1442       273316652
BCT622       109        222593498
BCT623       55         216844860
BCT624       70         213822191
BCT625       34         137765382
BCT626       69         224394912
BCT627       364        238323955
BCT628       889        289911825
BCT629       316        85816731
BCT63        94         229475332
BCT630       1274       198668008
BCT631       333        211837174
BCT632       514        379401000
BCT633       883        314043216
BCT634       262        70200635
BCT635       3569       247581755
BCT636       281        301433059
BCT637       334        391121871
BCT638       277        260588329
BCT639       362        393266490
BCT64        117        227983621
BCT640       364        392445913
BCT641       2041       260220601
BCT642       63         145106063
BCT643       86         222746849
BCT644       78         227354684
BCT645       3023       245927078
BCT646       1230       124242115
BCT647       1412       261424764
BCT648       47         241352896
BCT649       45         243003094
BCT65        160        232898310
BCT650       2180       269716913
BCT651       945        54278114
BCT652       2288       268994823
BCT653       83         274582043
BCT654       422        283036369
BCT655       3015       248690235
BCT656       11940      19905132
BCT657       25214      42009696
BCT658       118374     188904291
BCT659       116072     190908636
BCT66        154        221704284
BCT660       114355     195003839
BCT661       106067     198401683
BCT662       59667      275045672
BCT663       24112      106595115
BCT67        128        238275556
BCT68        114        230664549
BCT69        54         123393656
BCT7         1310       133308362
BCT70        300        239582260
BCT71        142        231562727
BCT72        354        225466658
BCT73        111        222896198
BCT74        121        213352666
BCT75        120        227473574
BCT76        98         224926366
BCT77        90         224039666
BCT78        98         225070223
BCT79        58         138528232
BCT8         191        234251938
BCT80        53         211054879
BCT81        45         210584326
BCT82        45         210864282
BCT83        45         212727898
BCT84        76         222861078
BCT85        40         115080869
BCT86        112        227959956
BCT87        129        231316827
BCT88        99         245428056
BCT89        87         223381451
BCT9         133        236750743
BCT90        59         181990919
BCT91        93         237302287
BCT92        103        223843089
BCT93        62         225168570
BCT94        64         140507059
BCT95        97         233623581
BCT96        82         229505918
BCT97        100        238937572
BCT98        24         34605217
BCT99        94         226656782
ENV1         189982     141874265
ENV10        178456     164920818
ENV11        57152      26640414
ENV12        218987     102585490
ENV13        176384     159891705
ENV14        19546      17056865
ENV15        204701     124202139
ENV16        186256     146035798
ENV17        209746     130993231
ENV18        180101     144863491
ENV19        796        1066461
ENV2         151516     160012296
ENV20        155460     156526877
ENV21        250294     68810689
ENV22        87156      20071142
ENV23        220965     118700470
ENV24        255779     108833506
ENV25        205136     126620800
ENV26        26926      25477419
ENV27        152294     158746707
ENV28        201147     103382836
ENV29        68253      51341212
ENV3         63440      140669131
ENV30        213319     108924688
ENV31        170955     153785790
ENV32        135008     163683922
ENV33        11532      15711524
ENV34        179951     128304888
ENV35        218066     118482267
ENV36        78472      41726558
ENV37        143993     98017210
ENV38        100657     112290439
ENV39        130550     80387732
ENV4         124        288213636
ENV40        173944     138871304
ENV41        163506     139638636
ENV42        179622     114228709
ENV43        200986     107353842
ENV44        196376     109569944
ENV45        111544     97796176
ENV46        158076     134833905
ENV47        145098     136814082
ENV48        169088     47785481
ENV49        172201     133129013
ENV5         83         221317267
ENV50        211024     100433123
ENV51        142299     62176825
ENV52        216483     84261105
ENV53        212753     92645382
ENV54        108058     43422622
ENV55        224549     98848323
ENV56        224713     91774335
ENV57        142737     92378187
ENV58        198722     110748981
ENV59        182640     90460144
ENV6         97         218466622
ENV60        191891     114634624
ENV61        31542      19898562
ENV62        129108     185698117
ENV63        216366     133086684
ENV64        228321     99153484
ENV65        61603      26688640
ENV66        194714     112067864
ENV67        125808     173570115
ENV68        66491      229020561
ENV69        116363     150013204
ENV7         63         204534087
ENV70        34566      31201981
ENV8         76         217162029
ENV9         3543       223465574
EST1         152690     59075604
EST10        155841     67142647
EST100       152899     76533320
EST101       145152     99334952
EST102       145149     85361933
EST103       148986     93016088
EST104       7162       4190279
EST105       149683     109460875
EST106       135200     99322475
EST107       136257     97452494
EST108       136284     94853959
EST109       2297       1519204
EST11        163597     69202569
EST110       136920     77327965
EST111       176687     106050647
EST112       194369     119409911
EST113       236609     141475405
EST114       6067       3721593
EST115       229453     127643708
EST116       182810     103717899
EST117       191453     94556126
EST118       2649       2084299
EST119       148614     100292951
EST12        150681     64736406
EST120       154741     119123989
EST121       166284     97913480
EST122       21991      15414601
EST123       130039     82535239
EST124       83544      30919856
EST125       36757      12481811
EST126       84106      31034635
EST127       84264      34515269
EST128       33711      11378339
EST129       85031      32709177
EST13        186777     83515959
EST130       82017      34968192
EST131       83454      35266094
EST132       84118      32965334
EST133       14468      5903340
EST134       83460      51063090
EST135       173570     87539089
EST136       170431     77673475
EST137       146496     92416736
EST138       28531      18072078
EST139       141402     87644345
EST14        104664     47795518
EST140       149169     98038750
EST141       157781     78491749
EST142       180947     92630877
EST143       7809       4568886
EST144       141652     76089203
EST145       151600     73212463
EST146       148400     87046443
EST147       155872     83630976
EST148       11550      6810689
EST149       166186     102136895
EST15        197334     111632923
EST150       202211     107329025
EST151       158885     93296243
EST152       102216     51071043
EST153       156473     79478757
EST154       135311     80239330
EST155       141446     88012873
EST156       166518     86082889
EST157       7780       4492262
EST158       179041     104197304
EST159       218733     94431044
EST16        147209     104729060
EST160       145808     85870166
EST161       161461     87658539
EST162       2839       1376204
EST163       140929     82622383
EST164       133075     84139784
EST165       147192     88180032
EST166       146328     80496361
EST167       20005      10132383
EST168       117769     61073260
EST169       115690     61941713
EST17        156572     83431034
EST170       122419     54128062
EST171       121107     48630686
EST172       29423      11431564
EST173       122215     48678047
EST174       125703     48478095
EST175       165762     83297665
EST176       172200     75566620
EST177       24701      15540946
EST178       147743     104364925
EST179       163429     99358064
EST18        191194     116947343
EST180       205284     116217156
EST181       167204     93396394
EST182       154071     103341968
EST183       134240     92949965
EST184       10672      5956502
EST185       146716     94194269
EST186       155040     80987234
EST187       132019     71137821
EST188       160898     90606768
EST189       13085      8269778
EST19        177368     113036622
EST190       148885     87668246
EST191       153770     95507815
EST192       175569     99208167
EST193       140566     77270225
EST194       4786       3936423
EST195       124062     64332278
EST196       163007     91013981
EST197       172951     99439738
EST198       149782     92961023
EST199       5889       3712675
EST2         157294     60515133
EST20        70789      55560490
EST200       165375     79342395
EST201       122406     84452488
EST202       163682     96504049
EST203       163929     95970518
EST204       13454      6450723
EST205       5847       2580354
EST206       111210     63109502
EST207       151265     87144715
EST208       107039     63439290
EST209       164594     101000156
EST21        194467     109200353
EST210       168495     124867785
EST211       82140      66769831
EST212       186522     95181519
EST213       145766     90574874
EST214       86781      65214858
EST215       141968     85245983
EST216       138009     75166331
EST217       95439      30642625
EST218       146951     86298614
EST219       149234     82714699
EST22        179952     92464056
EST220       141191     94332052
EST221       156023     90298582
EST222       8574       6134787
EST223       162088     99653428
EST224       153953     93687394
EST225       123359     88331915
EST226       145963     90179428
EST227       6829       4133477
EST228       129038     82162969
EST229       127969     89757274
EST23        107158     50417911
EST230       44142      31721114
EST231       156430     83332027
EST232       167399     92029681
EST233       166930     92691512
EST234       158124     88082424
EST235       163896     91508682
EST236       163228     92242200
EST237       166033     91294921
EST238       154891     85088026
EST239       168030     90687163
EST24        191027     61406814
EST240       187909     98489047
EST241       191634     107203138
EST242       168058     100162600
EST243       180324     103395206
EST244       190067     112774100
EST245       186285     113280685
EST246       177967     115370161
EST247       6811       5394835
EST248       140684     86233670
EST249       212621     138844284
EST25        136503     39207107
EST250       226920     111313556
EST251       164069     113913134
EST252       183146     95756964
EST253       198080     98535367
EST254       123002     89272028
EST255       7413       5138730
EST256       140264     82389170
EST257       206392     112826286
EST258       162378     106258913
EST259       93841      92696927
EST26        102353     27615294
EST260       15036      19567679
EST261       147677     99225559
EST262       150896     89821420
EST263       139136     101757825
EST264       216533     99416935
EST265       4224       2642412
EST266       133967     96686403
EST267       130697     91301432
EST268       135677     98281222
EST269       113592     81462502
EST27        201367     85184587
EST270       15575      9827231
EST271       136074     84237789
EST272       126197     86196946
EST273       128323     97050498
EST274       35670      25454263
EST275       126736     89458518
EST276       116536     79046724
EST277       139052     83809497
EST278       145796     114766102
EST279       15486      10949090
EST28        19762      8871029
EST280       125388     117381359
EST281       132658     98908640
EST282       162514     97700191
EST283       165607     104413716
EST284       18919      11863137
EST285       142285     92456214
EST286       169004     115153071
EST287       151628     103870677
EST288       136456     103296234
EST289       3255       2122810
EST29        203774     100081169
EST290       159541     97224651
EST291       222465     90720377
EST292       152865     111339324
EST293       160396     71799076
EST294       10553      1193300
EST295       208919     37982085
EST296       212168     83253851
EST297       150194     115334993
EST298       168070     97736830
EST299       154876     103183719
EST3         156026     54734733
EST30        216500     109030037
EST300       169010     109940649
EST301       149577     109937373
EST302       2047       1383922
EST303       180827     102281924
EST304       178602     93097581
EST305       168947     109496172
EST306       158905     104112356
EST307       2301       1836837
EST308       226903     106725089
EST309       267054     116129355
EST31        154031     67130239
EST310       184680     111793289
EST311       150001     28271688
EST312       229941     100513315
EST313       174951     100179604
EST314       156380     99985549
EST315       158607     94448054
EST316       166394     114093378
EST317       179942     95197248
EST318       143687     97189386
EST319       188156     110324042
EST32        149394     63696383
EST320       187330     49206581
EST321       201871     33888691
EST322       174436     95510933
EST323       14493      9111136
EST324       158346     113326097
EST325       184784     110470367
EST326       167585     97771317
EST327       165651     109621930
EST328       165922     71417216
EST329       127843     80161184
EST33        165216     65708059
EST330       121728     80853125
EST331       146532     101245025
EST332       21820      7774986
EST333       250640     26635193
EST334       254708     23392102
EST335       151991     94206454
EST336       152235     98594976
EST337       151209     99840551
EST338       145953     92202538
EST339       237888     43423594
EST34        147093     64544320
EST340       185435     81237426
EST341       3685       4554017
EST342       169100     99903127
EST343       163706     101006058
EST344       145613     92727936
EST345       189908     103388819
EST346       155979     109699810
EST347       153511     101536377
EST348       1951       738181
EST349       184471     108452053
EST35        162692     70902319
EST350       169885     94645837
EST351       169244     105166052
EST352       178323     59608264
EST353       195038     71941256
EST354       194528     75305704
EST355       197065     74426894
EST356       135405     70508640
EST357       174807     127367579
EST358       148414     85118544
EST359       150556     86650597
EST36        160529     65855877
EST360       121920     95273560
EST361       5392       4286510
EST362       143354     94799931
EST363       155559     94494342
EST364       162147     90154220
EST365       157698     100325120
EST366       21937      9729299
EST367       45656      24624838
EST368       155308     104544223
EST369       138149     97255037
EST37        107946     33684188
EST370       158633     102056658
EST371       152663     109858372
EST372       29680      25288248
EST373       173564     146756127
EST374       163564     85431758
EST375       127677     80996734
EST376       137841     94057317
EST377       51157      35811072
EST378       131619     88276056
EST379       137447     89871154
EST38        99513      30489364
EST380       139754     97233001
EST381       147706     97347466
EST382       49930      40332362
EST383       164182     86552371
EST384       143622     81415127
EST385       144915     86073821
EST386       144157     103713157
EST387       155646     93181756
EST388       138127     87591810
EST389       133463     84875714
EST39        99153      31399537
EST390       19252      11819086
EST391       196902     107235645
EST392       137014     75086496
EST393       92962      54579752
EST394       120675     80303449
EST395       23099      14175362
EST396       131518     83245448
EST397       119611     76575368
EST398       147506     80759467
EST399       210530     82593877
EST4         142938     56345501
EST40        98816      29786630
EST400       29795      12545416
EST401       163649     84380495
EST402       163929     99177970
EST403       159177     95841266
EST404       125973     81299685
EST405       12110      7935207
EST406       129506     86704326
EST407       137484     90244035
EST408       178709     111928688
EST409       154288     93121919
EST41        39232      11598976
EST410       27624      12033186
EST411       166658     91952291
EST412       168866     124921438
EST413       87411      56149482
EST414       69678      41105837
EST415       34129      16802261
EST416       137675     80049361
EST417       82268      49325811
EST418       139989     56900987
EST419       148868     30145031
EST42        101326     31351096
EST420       148732     30447487
EST421       163341     80758198
EST422       25882      13994606
EST423       201236     115851401
EST424       237754     108749660
EST425       220126     107466859
EST426       127110     74510970
EST427       128057     85803248
EST428       131704     80409324
EST429       93228      56881081
EST43        102633     36243427
EST430       173975     110008863
EST431       213048     84735872
EST432       106792     28525649
EST433       184615     112690353
EST434       204033     111425634
EST435       179035     105675035
EST436       197423     116761422
EST437       134572     63148204
EST438       110907     60524263
EST439       162601     108614110
EST44        95475      48218258
EST440       181510     116038684
EST441       107719     85697863
EST442       177578     140349548
EST443       150447     90322050
EST444       53524      34057685
EST445       166324     107087931
EST446       178587     101256659
EST447       42327      24215122
EST448       195649     106687564
EST449       185001     94876024
EST45        121121     52335541
EST450       50898      38182739
EST451       189907     115816753
EST452       180028     118006489
EST453       54560      33977145
EST454       196580     133890456
EST455       219858     123775643
EST456       190422     127148411
EST457       183537     144418305
EST458       204235     155997292
EST459       192543     115419803
EST46        55810      33167886
EST460       161348     96638772
EST461       181276     94409195
EST462       6431       534203
EST463       53496      4381716
EST464       158232     12239421
EST465       144975     12987161
EST466       148608     30079541
EST467       149063     29643665
EST468       7062       1471579
EST469       148744     30417064
EST47        177025     89154453
EST470       141959     81858084
EST471       172661     101046443
EST472       161391     110665984
EST473       16966      12151339
EST474       160825     92803556
EST475       150648     104118732
EST476       133685     93217910
EST477       141794     98144377
EST478       16200      8333478
EST479       157292     103614424
EST48        158153     65086282
EST480       146182     105140040
EST481       161997     97559167
EST482       165888     51070650
EST483       12161      1912433
EST484       160517     40369185
EST485       150820     102164062
EST486       146729     96566812
EST487       170976     112381821
EST488       21618      11698730
EST489       132815     75920561
EST49        162318     92154710
EST490       189716     107933724
EST491       149560     109195909
EST492       53159      36076492
EST493       126855     87064282
EST494       145595     90241943
EST495       148612     89441498
EST496       163476     89081611
EST497       35401      18041794
EST498       151814     92135788
EST499       156202     92091621
EST5         162084     62609780
EST50        154341     80228818
EST500       168500     102052476
EST501       136493     85654450
EST502       15318      8521569
EST503       100266     71178650
EST504       78634      60627274
EST505       97503      64771452
EST506       143451     80482502
EST507       37110      21164449
EST508       121005     73616962
EST509       133540     87501080
EST51        156445     74826582
EST510       135323     79344708
EST511       151987     92808949
EST512       45907      25208082
EST513       155676     85797389
EST514       184723     110532846
EST515       121351     79440998
EST516       178209     94678139
EST517       4744       1765241
EST518       52576      18674859
EST519       183237     101007675
EST52        108164     61167975
EST520       152141     81353891
EST521       22392      13552682
EST522       162316     94446797
EST523       211757     123975299
EST524       29664      19024876
EST525       147952     99622109
EST526       158950     98067836
EST527       134285     87369716
EST528       128632     87802109
EST529       25677      16070670
EST53        153907     88947354
EST530       179560     74468277
EST531       179106     79599662
EST532       198743     83525825
EST533       194768     80467415
EST534       3410       1187658
EST535       178841     95307232
EST536       174407     102458892
EST537       180222     107874027
EST538       171896     103671986
EST539       196696     126518824
EST54        154270     84992271
EST540       186186     103333644
EST541       178871     82793658
EST542       146543     93614807
EST543       206771     125126638
EST544       205624     126733200
EST545       188949     108252864
EST546       208319     121337435
EST547       34072      17688009
EST548       154069     96424819
EST549       187947     117401871
EST55        152206     92261410
EST550       166655     99004821
EST551       133842     98225388
EST552       8915       7253109
EST553       157240     92159075
EST554       170464     84942643
EST555       149142     85090487
EST556       151163     81932683
EST557       11887      7106830
EST558       156643     80037173
EST559       181307     106393559
EST56        149952     69903188
EST560       162508     103050765
EST561       175349     108182397
EST562       3212       2152412
EST563       170744     117107232
EST564       183919     113640256
EST565       129041     83663044
EST566       169422     97775191
EST567       184959     110599310
EST568       36235      23666360
EST569       204465     119127975
EST57        142206     76733001
EST570       269542     91763948
EST571       25664      9425377
EST572       262943     83717893
EST573       157488     57559226
EST574       162301     59144259
EST575       80398      30735657
EST58        151707     83210662
EST59        161195     65790882
EST6         166268     65037604
EST60        144548     70120281
EST61        160487     90001957
EST62        150445     92626088
EST63        150087     99321410
EST64        157735     94528785
EST65        2385       989764
EST66        154805     103452156
EST67        163010     82998212
EST68        166574     84865226
EST69        142254     77775859
EST7         163878     67752199
EST70        148470     82575386
EST71        149056     86144200
EST72        148552     92243283
EST73        150768     87593799
EST74        2764       1628510
EST75        29919      18235506
EST76        186707     102811942
EST77        170458     90758531
EST78        212600     115717827
EST79        179457     103369706
EST8         160928     67797250
EST80        2123       1442005
EST81        196745     121640362
EST82        167573     93355391
EST83        136139     63338951
EST84        128109     62643019
EST85        10989      5630830
EST86        150369     92616311
EST87        154649     96984906
EST88        130211     66324352
EST89        140268     89345585
EST9         169418     69380160
EST90        14364      7448661
EST91        183467     91897835
EST92        204535     119856010
EST93        202005     107978679
EST94        192020     90402851
EST95        204070     87102143
EST96        145888     86970139
EST97        137848     84899384
EST98        158609     76440268
EST99        9280       6073374
GSS1         172832     126575132
GSS10        14980      14463402
GSS100       169231     144356515
GSS101       157749     108935751
GSS102       155985     106347536
GSS103       152502     105561845
GSS104       168005     122783070
GSS105       149804     126570500
GSS106       162066     125204781
GSS107       186623     116025316
GSS108       16058      9820533
GSS109       185735     119778325
GSS11        146494     107085566
GSS110       201336     103953762
GSS111       219954     124091627
GSS112       87417      56990793
GSS113       152238     114271565
GSS114       155173     118809397
GSS115       155139     118869811
GSS116       163366     106680649
GSS117       37173      21505622
GSS118       179780     132238950
GSS119       189809     117152112
GSS12        200835     104101173
GSS120       166036     55081336
GSS121       169957     76572607
GSS122       2295       1480054
GSS123       161723     105208392
GSS124       189169     124964186
GSS125       200745     81604444
GSS126       167188     79936559
GSS127       137268     94431217
GSS128       129855     104605133
GSS129       132043     108777560
GSS13        192062     84601331
GSS130       132451     106048276
GSS131       8056       5958858
GSS132       135214     112032054
GSS133       56598      47104660
GSS134       132584     107786768
GSS135       139149     116140565
GSS136       140043     114408742
GSS137       138251     109584898
GSS138       4155       2820771
GSS139       134784     106426486
GSS14        173265     89245149
GSS140       134049     108003847
GSS141       134400     111531585
GSS142       138188     116474348
GSS143       4675       3643453
GSS144       139468     108106612
GSS145       136810     113648547
GSS146       136898     113473892
GSS147       137299     112649085
GSS148       559        466085
GSS149       137155     110923756
GSS15        167983     83930679
GSS150       134480     106278327
GSS151       133002     107665198
GSS152       138659     116136290
GSS153       1985       1674795
GSS154       127182     92203837
GSS155       174080     105026233
GSS156       184513     110133142
GSS157       162402     108639012
GSS158       177431     102440455
GSS159       197022     129307000
GSS16        160060     81615096
GSS160       201458     133365835
GSS161       200723     134048006
GSS162       179465     125486286
GSS163       198341     136948587
GSS164       196713     139067120
GSS165       196065     138672070
GSS166       174298     134353538
GSS167       144587     97412907
GSS168       138114     80517957
GSS169       165347     73456578
GSS17        156174     85673627
GSS170       130087     57900795
GSS171       163014     141019316
GSS172       170950     113527672
GSS173       80812      52920567
GSS174       191881     129015715
GSS175       196554     117983862
GSS176       28456      14940540
GSS177       180225     98140530
GSS178       181302     123365801
GSS179       178800     126906476
GSS18        152981     95677320
GSS180       181098     127179984
GSS181       19114      12799890
GSS182       165902     130533276
GSS183       170977     155597399
GSS184       219919     123799690
GSS185       216581     103401654
GSS186       17290      8049466
GSS187       210015     95106166
GSS188       156568     134374532
GSS189       6818       6760628
GSS19        153707     72745819
GSS190       125540     102753347
GSS191       122235     93469471
GSS192       156847     154495780
GSS193       167720     158232911
GSS194       131396     104305071
GSS195       149360     107958474
GSS196       170325     141788280
GSS197       174263     119970230
GSS198       20136      11688868
GSS199       181316     133971324
GSS2         173589     107819358
GSS20        106546     59105521
GSS200       184910     120116892
GSS201       180127     93029592
GSS202       172829     121726073
GSS203       189216     117024741
GSS204       189414     116726891
GSS205       21729      12651457
GSS206       200615     129990067
GSS207       215712     142629172
GSS208       217635     140382802
GSS209       166429     136402995
GSS21        132536     64638951
GSS210       152472     108704003
GSS211       159985     120581373
GSS212       160039     145459792
GSS213       158444     140404489
GSS214       160859     145750229
GSS215       162431     144534355
GSS216       163049     142910892
GSS217       159417     122903915
GSS218       168345     139695448
GSS219       161743     115993986
GSS22        125191     56725897
GSS220       180530     88689585
GSS221       2575       1768585
GSS222       251369     52150506
GSS223       262481     40466091
GSS224       262523     40408947
GSS225       122800     38229504
GSS226       253355     52912344
GSS227       182565     86129448
GSS228       188825     55952994
GSS229       154339     118463226
GSS23        134196     73094577
GSS230       177033     144334259
GSS231       160568     145787944
GSS232       159531     147010793
GSS233       174549     109955224
GSS234       238210     57319690
GSS235       198151     101373468
GSS236       229423     39758510
GSS237       119094     74590504
GSS238       174029     112048984
GSS239       147861     90042086
GSS24        143035     74371292
GSS240       140661     84073818
GSS241       159796     149652844
GSS242       5899       5023719
GSS243       112668     95722541
GSS244       180351     149222837
GSS245       172954     122407496
GSS246       201906     127716652
GSS247       188210     120275961
GSS248       166175     94403497
GSS249       159873     84506384
GSS25        12092      5172754
GSS250       156433     119872540
GSS251       203514     148104443
GSS252       14298      9398581
GSS253       171523     67875770
GSS254       176683     96454754
GSS255       195475     152072364
GSS256       199776     154504000
GSS257       7495       6183699
GSS258       197813     157229673
GSS259       197524     124135901
GSS26        140902     65659537
GSS260       194959     142650302
GSS261       611        422080
GSS262       214911     131530338
GSS263       189958     57638710
GSS264       218598     111928830
GSS265       170488     153872948
GSS266       163848     150141940
GSS267       234900     132469628
GSS268       240183     119740511
GSS27        159863     79841194
GSS28        156780     92817384
GSS29        165484     85429638
GSS3         138093     115755641
GSS30        9311       4809210
GSS31        171978     102877480
GSS32        182794     109078835
GSS33        182356     87082611
GSS34        172894     102149372
GSS35        191042     104301903
GSS36        162180     112295088
GSS37        160410     98257518
GSS38        173347     108755067
GSS39        3659       2625600
GSS4         140176     112446360
GSS40        183985     122974505
GSS41        181701     117299100
GSS42        52326      27358639
GSS43        177824     102907428
GSS44        164532     141986785
GSS45        179635     148566932
GSS46        139666     92482471
GSS47        182857     132009511
GSS48        181603     114543261
GSS49        204426     116967916
GSS5         11600      8663177
GSS50        185613     99478458
GSS51        211954     108037045
GSS52        211747     108318359
GSS53        197315     132797049
GSS54        158211     124808059
GSS55        185583     139405028
GSS56        196775     63137269
GSS57        171822     96460264
GSS58        157621     106112242
GSS59        23373      13575160
GSS6         152749     116375726
GSS60        166616     156645100
GSS61        177157     98801574
GSS62        161196     115202462
GSS63        172331     112351434
GSS64        175439     118751394
GSS65        184542     127843483
GSS66        205677     128792296
GSS67        188167     112097249
GSS68        200686     134224634
GSS69        215702     158336970
GSS7         170814     119984140
GSS70        189038     138024221
GSS71        173742     107642623
GSS72        198219     111980277
GSS73        140725     76414851
GSS74        163079     95884017
GSS75        10697      6814502
GSS76        159270     97756741
GSS77        159481     96970229
GSS78        172285     114351414
GSS79        170749     109399099
GSS8         177198     108971414
GSS80        174370     122402741
GSS81        188875     105213057
GSS82        174789     125779909
GSS83        164306     106587290
GSS84        1781       1416018
GSS85        189251     108546104
GSS86        180972     113844730
GSS87        167306     118213440
GSS88        193311     106231618
GSS89        8529       4931343
GSS9         141908     118712459
GSS90        213831     107550639
GSS91        227222     89202095
GSS92        213483     139456408
GSS93        182686     91963194
GSS94        94686      37020965
GSS95        193805     75823638
GSS96        201086     123394316
GSS97        191020     122180795
GSS98        156116     139401502
GSS99        16660      10968419
HTC1         41206      63404125
HTC2         32318      72275691
HTC3         32080      77890442
HTC4         84836      50647832
HTC5         129804     161467165
HTC6         124984     122830042
HTC7         137623     130766468
HTC8         67856      61012150
HTG1         3784       374870703
HTG10        2848       363016285
HTG11        1976       365940103
HTG12        1714       382089084
HTG13        1718       381796340
HTG14        1659       383118453
HTG15        1835       380424998
HTG16        1750       361896240
HTG17        1843       380599315
HTG18        1752       382301790
HTG19        1775       381824019
HTG2         5068       373604329
HTG20        1891       380883515
HTG21        2135       355865123
HTG22        2426       376351102
HTG23        2269       379507879
HTG24        2442       381163865
HTG25        2175       382733656
HTG26        2070       368006459
HTG27        2074       380458182
HTG28        2061       380108509
HTG29        1047       202962639
HTG3         2556       370662362
HTG30        2040       379446758
HTG31        2203       375546591
HTG32        986        170706729
HTG33        2152       379221269
HTG34        2348       376393195
HTG35        1372       195850538
HTG36        2462       370234045
HTG37        2428       372528369
HTG38        1015       169191937
HTG39        2235       381490266
HTG4         2735       369989641
HTG40        2336       385145188
HTG41        1069       180930974
HTG42        2312       384776536
HTG43        2363       384490832
HTG44        906        155597869
HTG45        2500       379735659
HTG46        2319       385244375
HTG47        927        158722850
HTG48        2315       385567657
HTG49        2293       386023883
HTG5         2500       373389217
HTG50        900        149450476
HTG51        2237       385154833
HTG52        2106       380011723
HTG53        657        122585305
HTG54        2010       379525743
HTG55        1981       378955508
HTG56        1184       193581815
HTG57        2144       380658486
HTG58        2686       383430148
HTG59        2973       383248998
HTG6         2          386956
HTG60        884        128257683
HTG61        2959       380503057
HTG62        3012       366231486
HTG63        2990       372824610
HTG64        2953       336850403
HTG65        3178       359117111
HTG66        3179       359260560
HTG67        3186       360427818
HTG68        3128       367889098
HTG69        2913       377859052
HTG7         2327       375791086
HTG70        1846       312468258
HTG71        3415       365492036
HTG72        2071       381329139
HTG73        1668       298160154
HTG74        2088       382520375
HTG75        2244       384445864
HTG76        1669       296247510
HTG77        2201       385233869
HTG78        2249       384504439
HTG79        3219       384192102
HTG8         1500       384347777
HTG80        2166       384708164
HTG81        3033       373087380
HTG82        2044       207008446
HTG9         1582       384062276
INV1         154213     140639721
INV10        14         359428768
INV100       32668      23456901
INV101       148923     103605729
INV102       152237     116426810
INV103       121709     83612043
INV104       154941     113616553
INV105       153634     120496976
INV106       53896      35992137
INV107       152800     109376016
INV108       153466     115495771
INV109       37195      32120588
INV11        9          363281720
INV110       141582     88514594
INV111       147778     93672501
INV112       43741      33359330
INV113       148102     97249100
INV114       139032     81414480
INV115       43124      25561893
INV116       138170     82625343
INV117       137815     82616977
INV118       54035      35678926
INV119       138821     83289431
INV12        52         355336707
INV120       135275     98798449
INV121       75077      58785553
INV122       142018     108087478
INV123       151028     120504454
INV124       156084     118342425
INV125       108425     227325473
INV126       5597       11235688
INV127       183035     236941459
INV128       216228     165877386
INV129       38629      187147326
INV13        14         371434550
INV130       800        42674647
INV131       566        40635863
INV132       8037       115580217
INV133       23329      332915377
INV134       23255      171962006
INV135       68041      305365919
INV136       123287     266863020
INV137       64375      76908791
INV138       180571     237306452
INV139       41592      302727004
INV14        78         134821644
INV140       315        394021049
INV141       1012       100307854
INV142       2059       383654064
INV143       2          41011863
INV144       587        361649714
INV145       8          378508614
INV146       974        354275690
INV147       6          380479040
INV148       2          95552909
INV149       22         390382246
INV15        6          384224499
INV150       10036      362338941
INV151       376        367082002
INV152       3415       40188607
INV153       1          685423969
INV154       1          640667275
INV155       1          639123876
INV156       1          612949391
INV157       1          577192767
INV158       1          641629864
INV159       497        320978344
INV16        14         379706462
INV160       2          371500015
INV161       2          289902239
INV162       2965       358959205
INV163       59277      333080486
INV164       34         383065485
INV165       19         393344928
INV166       14         327270017
INV167       27         393651567
INV168       32         390738662
INV169       24         383706785
INV17        31         388860819
INV170       25         382049854
INV171       31         378115211
INV172       13         297748085
INV173       18         387848160
INV174       24         381271345
INV175       36         390867092
INV176       34         389743485
INV177       26         391141334
INV178       19         292893418
INV179       11         371260264
INV18        11         377131664
INV180       19         391738068
INV181       12         391781067
INV182       13         372901688
INV183       32         389502837
INV184       22         330411078
INV185       29         389284801
INV186       38         387663352
INV187       17         367589223
INV188       12         387517245
INV189       17         362786034
INV19        3          241225934
INV190       10         320557524
INV191       13         376469258
INV192       35         380323776
INV193       26         392110963
INV194       24         388964019
INV195       21         391745060
INV196       22         309540561
INV197       27         392282931
INV198       24         388632304
INV199       12         375724207
INV2         2288       315894747
INV20        3          393880593
INV200       16         393313708
INV201       13         392068811
INV202       10         277290815
INV203       15         358735036
INV204       11         386907833
INV205       16         377160071
INV206       21         392427759
INV207       5          215849302
INV208       15         382505853
INV209       743        382889760
INV21        3          261336042
INV210       26         386022184
INV211       28         394591284
INV212       7          307846652
INV213       4          182170525
INV214       2          342421305
INV215       2          269826459
INV216       18         385786230
INV217       1901       346423963
INV218       8863       319021282
INV219       11615      311682508
INV22        3          322765503
INV220       29288      83527942
INV221       149913     106096942
INV222       152766     93802275
INV223       83278      48478851
INV224       151226     93785487
INV225       151121     109849510
INV226       59386      50359445
INV227       151733     123251115
INV228       150033     121532870
INV229       78177      62525240
INV23        2          265971290
INV230       149609     113833368
INV231       143742     122763996
INV232       76456      96188914
INV233       147549     121983383
INV234       55738      284898016
INV235       2825       377441213
INV236       1774       116577198
INV237       96781      321023124
INV238       217342     232110336
INV239       60949      250981301
INV24        4          328757598
INV240       104213     292697254
INV241       28749      364829410
INV242       1766       378350697
INV243       2736       196647685
INV244       184144     268358078
INV245       1785       378880292
INV246       5583       374469857
INV247       20768      153711624
INV248       288223     205808194
INV249       1224       379793465
INV25        5          378753109
INV250       4515       373876603
INV251       92490      210334617
INV252       391527     140904810
INV253       109733     258294965
INV254       62463      308727005
INV255       4162       375136162
INV256       44629      350112618
INV257       2155       4626806
INV258       298725     199657065
INV259       214334     249067665
INV26        5          371191486
INV260       2226       377046597
INV261       19303      366955288
INV262       16948      41978773
INV263       298408     186907243
INV264       1355       379516794
INV265       3687       378313727
INV266       136930     300095839
INV267       38349      357698579
INV268       664        92151452
INV269       8529       370827851
INV27        4          376987297
INV270       197744     256830145
INV271       359558     128682792
INV272       93023      322972837
INV273       2568       378355489
INV274       61847      343439542
INV275       97302      323328926
INV276       9          121813966
INV277       15         379655485
INV278       6          355188453
INV279       1          239744465
INV28        4          293537168
INV280       1          231634122
INV281       1          221096292
INV282       1          220877407
INV283       1          216720617
INV284       1          210676062
INV285       2          387811394
INV286       2          329972158
INV287       2          302384449
INV288       20         360081608
INV289       9          301825222
INV29        4          373434888
INV290       23         382490317
INV291       23         380735444
INV292       18         387931948
INV293       33         390736486
INV294       780        381140152
INV295       20         391287680
INV296       2          32244328
INV297       27         388830496
INV298       21         386972019
INV299       9          351834369
INV3         104818     182027461
INV30        51         389427388
INV300       5          163634948
INV301       1          292306469
INV302       1          164045107
INV303       2          318230244
INV304       855        391020194
INV305       30         391515590
INV306       25         383908286
INV307       25         388289419
INV308       3          49480870
INV309       25         384967207
INV31        126349     179751708
INV310       26         391482668
INV311       22         392427991
INV312       26         383547221
INV313       26         265978999
INV314       6          371290168
INV315       13         374069663
INV316       19         385560269
INV317       15         373391572
INV318       13         350978987
INV319       22         386100611
INV32        26294      23997508
INV320       24         386055502
INV321       23         389090030
INV322       31         366704932
INV323       12         307588661
INV324       24         393918543
INV325       16         362929629
INV326       8          361035446
INV327       13         369493806
INV328       13         384884009
INV329       18         390461886
INV33        167285     134315159
INV330       22         394170044
INV331       11         336163521
INV332       6          353407420
INV333       7          372089599
INV334       3          84055540
INV335       9          390324178
INV336       19         393988728
INV337       11         137914990
INV338       1          346874609
INV339       1          248688513
INV34        126777     112359706
INV340       1          195213701
INV341       21         389226046
INV342       16         380802157
INV343       17         384888603
INV344       24         390785021
INV345       14         272669524
INV346       19         394017224
INV347       17         391933486
INV348       7          291754234
INV349       2          360067285
INV35        37136      273256295
INV350       1          158111693
INV351       5          390880948
INV352       1          269711166
INV353       1          265788494
INV354       5          389225578
INV355       8          84827761
INV356       32         385162699
INV357       29         391336068
INV358       26         380265073
INV359       8          257485661
INV36        2779       371575686
INV360       20         383534539
INV361       18         388997674
INV362       13         372064491
INV363       12         246225518
INV364       18         394216238
INV365       18         380558243
INV366       10         378653212
INV367       20         286746626
INV368       50         386517834
INV369       41         394290459
INV37        44         370097852
INV370       30         391877099
INV371       23         388833300
INV372       17         384297034
INV373       16         391613329
INV374       12         375795023
INV375       18         391634427
INV376       20         380480634
INV377       22         271076993
INV378       29         389236155
INV379       23         387510109
INV38        24         379270378
INV380       25         393194949
INV381       29         393406758
INV382       10         389413895
INV383       12         256001243
INV384       25         382453876
INV385       25         387644779
INV386       17         390017898
INV387       13         185974631
INV388       1          252586203
INV389       2          382245123
INV39        5          76533839
INV390       1          170640157
INV391       3          172715237
INV392       1          265601162
INV393       1          235131548
INV394       8          377013040
INV395       18         389308576
INV396       6          76294397
INV397       2          316929497
INV398       5          371999024
INV399       13         377525467
INV4         59175      272951428
INV40        32         391299062
INV400       20         380130864
INV401       4          94235370
INV402       20         386111019
INV403       10         330750052
INV404       8          388492156
INV405       29         385235322
INV406       3          68204675
INV407       1          375708846
INV408       147        377882925
INV409       3          72566929
INV41        25         362900281
INV410       18         393806697
INV411       12         375328864
INV412       13         388485421
INV413       17         389690952
INV414       10         355855682
INV415       12         388165924
INV416       5          66893570
INV417       2          334507981
INV418       2          271847796
INV419       9          384970046
INV42        18         380479131
INV420       14         380331769
INV421       17         331062789
INV422       4          353245537
INV423       5          361980503
INV424       1          66459093
INV425       6          375950524
INV426       11         380698960
INV427       13         393299321
INV428       16         371834617
INV429       4          107829629
INV43        19         390062857
INV430       16         390859621
INV431       35         393136677
INV432       18         389411089
INV433       55         348175426
INV434       10         366985680
INV435       18         382945053
INV436       3          55752453
INV437       23         351194891
INV438       4          361297550
INV439       7          382899134
INV44        5          134896453
INV440       16         391635138
INV441       18         314878223
INV442       25         391765795
INV443       7          316364288
INV444       3          332270074
INV445       4          368005921
INV446       23         389089573
INV447       17         270136971
INV448       2          278332741
INV449       6          275271247
INV45        18         373966012
INV450       9          360027838
INV451       12         393015501
INV452       10         354694948
INV453       6          369954565
INV454       6          341098428
INV455       2          109343042
INV456       8          392102027
INV457       24         394471285
INV458       24         378149829
INV459       17         381181448
INV46        24         386582132
INV460       18273      362840417
INV461       1817       22901017
INV47        8          380395300
INV48        19         379365223
INV49        9          138772803
INV5         37248      75696691
INV50        28         391443577
INV51        28         392100242
INV52        45         382097969
INV53        27         372689565
INV54        18         385206419
INV55        12         373566826
INV56        1          94407144
INV57        15         381614547
INV58        29         387067226
INV59        25         384930048
INV6         129056     165736599
INV60        18         381070342
INV61        96945      235212118
INV62        124243     97184245
INV63        28932      319690973
INV64        28941      347133943
INV65        20         388604938
INV66        15         389699299
INV67        16         252138391
INV68        34         391108664
INV69        71         392017627
INV7         207        346774014
INV70        24         388974367
INV71        21         381982755
INV72        20         377528210
INV73        24         388990901
INV74        29         394663938
INV75        27         393364049
INV76        23         381713426
INV77        134        350713408
INV78        4          381900476
INV79        24         389620287
INV8         85         322154899
INV80        33         393229173
INV81        9          344807465
INV82        23         323415557
INV83        32         372768847
INV84        20         384741007
INV85        25         385708546
INV86        29         388680045
INV87        22         323658394
INV88        25         386606940
INV89        22         384360764
INV9         3          136766944
INV90        22         375170777
INV91        31         394116451
INV92        20         281624502
INV93        11         364532943
INV94        14         378464462
INV95        38         390437780
INV96        20         259303673
INV97        35         382133951
INV98        38985      329159366
INV99        150715     102220054
MAM1         32388      323882267
MAM10        26814      24994146
MAM11        13731      20581276
MAM12        3445       7368868
MAM13        107        699953
MAM14        20         277696380
MAM15        1          249270926
MAM16        2          343930246
MAM17        3          325384739
MAM18        1          90795278
MAM19        4          322903327
MAM2         22252      277073294
MAM20        4          298795355
MAM21        6          353843759
MAM22        5          329700903
MAM23        2          289079565
MAM24        3          348530310
MAM25        4          336581445
MAM26        5          375256260
MAM27        6          373952570
MAM28        8          377813420
MAM29        5          379300313
MAM3         2          316219032
MAM30        1          38035513
MAM31        5          285741626
MAM32        5          342804543
MAM33        8          370485433
MAM34        6          316655225
MAM35        4          238884849
MAM36        4          355768297
MAM37        6          355037276
MAM38        7          389945117
MAM39        6          319172640
MAM4         2          376685399
MAM40        5          323047396
MAM41        4          347221982
MAM42        5          288444151
MAM43        5          375232988
MAM44        5          248962388
MAM45        1          277956744
MAM46        1          154038104
MAM47        3          374028897
MAM48        2          298256496
MAM49        3          355148320
MAM5         2          295769989
MAM50        3          355658200
MAM51        3          369352591
MAM52        13         295784090
MAM53        54         7614329
MAM54        215        34073042
MAM55        431        71272130
MAM56        861        68509101
MAM57        1706       2411269
MAM58        6836       6159435
MAM59        110526     193401624
MAM6         2          385026516
MAM60        33096      281546482
MAM61        4          358286156
MAM62        5          387739617
MAM63        5          335893012
MAM64        6          364021592
MAM65        6          304412506
MAM66        10         386743576
MAM67        132617     153996310
MAM68        117910     169519659
MAM69        5794       5151004
MAM7         3          316699161
MAM70        1          716413629
MAM71        1          662751787
MAM72        1          611347268
MAM73        1          464895054
MAM74        1          288121652
MAM75        3          338107697
MAM76        1          223449203
MAM77        1          210645437
MAM78        1          201318998
MAM79        1          197708286
MAM8         5          343489620
MAM80        2          320231256
MAM81        2          293750401
MAM82        3          367535284
MAM83        4          351244600
MAM84        367        269065793
MAM85        1          203623556
MAM86        2          383513587
MAM87        4          383666147
MAM88        5          381503248
MAM89        1376       392321470
MAM9         933        216317382
MAM90        68876      268227944
MAM91        65617      267186288
MAM92        4          274800947
MAM93        4          294612101
MAM94        4          368804057
MAM95        5          360824188
MAM96        3          381844289
MAM97        4          323611747
MAM98        5          314441637
MAM99        8269       281084146
PAT1         420072     157363817
PAT10        304138     130867531
PAT100       352852     189327041
PAT101       310862     206556098
PAT102       261889     226571161
PAT103       130469     96637053
PAT104       304402     217824161
PAT105       276793     236021165
PAT106       255575     243191966
PAT107       219302     91982645
PAT108       185522     168147091
PAT109       194742     145575468
PAT11        235969     217001618
PAT110       98134      56007996
PAT111       244010     110313663
PAT112       143100     226369725
PAT113       78463      27201918
PAT114       88276      271848496
PAT115       224854     124891051
PAT116       225592     104829687
PAT117       1426       4487182
PAT118       247765     75673289
PAT119       230776     33741646
PAT12        83512      75761949
PAT120       94886      123403652
PAT121       98574      119749391
PAT122       81936      115812708
PAT123       203200     107726601
PAT124       26052      9049884
PAT125       203753     100524714
PAT126       183498     80758866
PAT127       117398     19496465
PAT128       249602     208803281
PAT129       386164     114645501
PAT13        242994     211781414
PAT130       52463      7541011
PAT131       283984     180114539
PAT132       123559     298380740
PAT133       110196     303228342
PAT134       393173     122391607
PAT135       290830     158919292
PAT136       12498      8415729
PAT137       287141     182646284
PAT138       409360     14039521
PAT139       496812     33315384
PAT14        328307     148441313
PAT140       525210     7878150
PAT141       153458     3896573
PAT142       377415     123797918
PAT143       245707     106305353
PAT144       259895     238802744
PAT145       4634       392128968
PAT146       190899     207809354
PAT147       308470     120437803
PAT148       140526     153750733
PAT149       6432       91696404
PAT15        63699      1592475
PAT150       177885     181303248
PAT151       71548      185117089
PAT152       75797      115786083
PAT153       75754      115775734
PAT154       46229      38674255
PAT155       245585     68642488
PAT156       201628     63082013
PAT157       264566     57807463
PAT158       309584     83974292
PAT159       458731     54677746
PAT16        197482     165318298
PAT160       227775     118065838
PAT161       360553     132694979
PAT162       287883     50230249
PAT163       154055     4622328
PAT164       229227     77275728
PAT165       228121     72916652
PAT166       281284     18699015
PAT167       64337      7031178
PAT168       153383     170227500
PAT169       73417      134980723
PAT17        217865     141822851
PAT170       74139      123431457
PAT171       137229     84274353
PAT172       175192     2627880
PAT173       234158     99492766
PAT174       198436     145144609
PAT175       229723     110405486
PAT176       105081     67822499
PAT177       80124      122466507
PAT178       260801     46024540
PAT179       294811     4422165
PAT18        217787     104554456
PAT180       7781       116715
PAT181       278538     10765362
PAT182       99590      135915739
PAT183       220910     105875731
PAT184       23917      35278529
PAT185       143999     206566501
PAT186       173285     186742155
PAT187       70129      243259642
PAT188       6542       8869371
PAT189       137168     133366031
PAT19        238917     105580979
PAT190       136594     204924247
PAT191       208575     98959238
PAT192       284104     31395226
PAT193       26280      42269494
PAT194       264589     66935450
PAT195       227269     82111943
PAT196       179588     5746816
PAT197       194343     81150933
PAT198       52350      9088688
PAT199       82690      146051882
PAT2         329685     203025577
PAT20        217523     131791327
PAT200       75930      116106222
PAT201       76058      115438165
PAT202       205771     85563217
PAT203       2801       56020
PAT204       342231     6844620
PAT205       341891     7168782
PAT206       341071     7503562
PAT207       331154     110021550
PAT208       268658     230373189
PAT209       282624     222310160
PAT21        295515     53574820
PAT210       192664     139614235
PAT211       276098     235021090
PAT212       188385     291326630
PAT213       137484     196232251
PAT214       247191     246690030
PAT215       11728      387687504
PAT216       313354     152356909
PAT217       244602     252477336
PAT218       160029     300870611
PAT219       215545     135077252
PAT22        146923     94671628
PAT220       172971     290885692
PAT221       266013     215701160
PAT222       347700     148050871
PAT223       288201     68367608
PAT224       317818     206630332
PAT225       43590      365712261
PAT226       151381     180550783
PAT227       338212     193787787
PAT228       332520     206353769
PAT229       155792     199233054
PAT23        196051     155681695
PAT230       249094     251157045
PAT231       209852     277995521
PAT232       262858     236722257
PAT233       313828     214462099
PAT234       96226      39097643
PAT235       218335     140106906
PAT236       284534     19076352
PAT237       283825     19293837
PAT238       106269     19050125
PAT239       281624     22162860
PAT24        279823     73243712
PAT240       286514     14630240
PAT241       287155     13479675
PAT242       96564      20012546
PAT243       263509     44902329
PAT244       293106     5569014
PAT245       293106     5569014
PAT246       116858     5087505
PAT25        228203     147458659
PAT26        209296     140220815
PAT27        62580      53901225
PAT28        304662     206975876
PAT29        321045     202870000
PAT3         50180      20260693
PAT30        69609      127456994
PAT31        217213     274043600
PAT32        399532     38379558
PAT33        255751     169050096
PAT34        232478     137935647
PAT35        62206      29248681
PAT36        159610     193120910
PAT37        187244     152014323
PAT38        212001     134509397
PAT39        97874      9820233
PAT4         329514     180387010
PAT40        349668     21562100
PAT41        269131     102155190
PAT42        166        390395449
PAT43        7285       386170321
PAT44        91553      5256860
PAT45        304606     19422510
PAT46        304621     19407682
PAT47        188162     183525275
PAT48        31133      33396169
PAT49        100021     274296388
PAT5         261930     200082763
PAT50        347914     22045690
PAT51        356635     6776065
PAT52        92431      1756189
PAT53        351487     15876250
PAT54        360979     6858601
PAT55        133552     2537488
PAT56        360626     6851894
PAT57        359974     6839506
PAT58        125418     2711844
PAT59        535700     100616524
PAT6         217641     164402103
PAT60        111356     330233433
PAT61        289774     158820679
PAT62        481510     50384146
PAT63        225628     89296979
PAT64        254559     194650784
PAT65        328372     204069778
PAT66        171723     140677469
PAT67        349862     190728733
PAT68        612603     75778089
PAT69        132887     40797313
PAT7         247422     122522282
PAT70        484033     127126269
PAT71        126354     109119371
PAT72        150168     307250321
PAT73        318626     211710240
PAT74        51881      214846609
PAT75        189165     289007376
PAT76        317843     207880789
PAT77        123868     129694058
PAT78        342751     192409991
PAT79        362616     180214431
PAT8         224288     103127538
PAT80        20467      17346132
PAT81        311143     212599739
PAT82        414691     138165335
PAT83        481329     57361173
PAT84        327289     49350302
PAT85        456880     82648416
PAT86        157574     115871211
PAT87        167200     186351195
PAT88        316191     151196803
PAT89        224198     179598149
PAT9         153308     78036792
PAT90        160883     40111851
PAT91        548289     10417491
PAT92        499577     9491963
PAT93        509422     32511534
PAT94        211221     45759082
PAT95        257687     203232161
PAT96        388298     141389415
PAT97        39463      44148194
PAT98        361773     186862184
PAT99        415062     154422395
PHG1         8915       216326899
PHG2         4787       222405185
PHG3         5285       216156936
PHG4         7784       238119972
PHG5         3043       129360672
PLN1         135078     172333525
PLN10        18921      157294990
PLN100       57         390189770
PLN101       11         373036233
PLN102       8          357693623
PLN103       6          351635285
PLN104       12         293471641
PLN105       78         341267500
PLN106       131        317758159
PLN107       124        358113214
PLN108       105        219857218
PLN109       196        355571810
PLN11        29377      278503063
PLN110       126        326901077
PLN111       75         366349697
PLN112       10         385724116
PLN113       157        352248206
PLN114       129        280340746
PLN115       37         16871
PLN116       149        79314
PLN117       2469       93786416
PLN118       7181       18795412
PLN119       14346      29953091
PLN12        2658       334144218
PLN120       97723      209408406
PLN121       129424     90009189
PLN122       159024     148267057
PLN123       162827     146545067
PLN124       57542      31436312
PLN125       181658     125729890
PLN126       49813      254579796
PLN127       41637      287857567
PLN128       71877      108803405
PLN129       98644      85504671
PLN13        37         329935405
PLN130       49729      72847341
PLN131       25061      110565816
PLN132       13561      89764040
PLN133       1          774434471
PLN134       8305       28494037
PLN135       1861       361385154
PLN136       5          372618381
PLN137       6          372447772
PLN138       6          368295254
PLN139       2          132503639
PLN14        46         124218893
PLN140       428        311697900
PLN141       8          327823341
PLN142       6          343447962
PLN143       1          66465249
PLN144       1          474651383
PLN145       1          612216829
PLN146       1          571018318
PLN147       1          574020038
PLN148       1          538550714
PLN149       1          514282554
PLN15        9          366014477
PLN150       1          575541767
PLN151       131        336044503
PLN152       12213      142196228
PLN153       175250     124234128
PLN154       23668      15780321
PLN155       148447     156345649
PLN156       149695     145704217
PLN157       86479      71741269
PLN158       154564     132808270
PLN159       163977     118772510
PLN16        2395       340580897
PLN160       24510      26687470
PLN161       147691     134509689
PLN162       125620     155874192
PLN163       167304     121797815
PLN164       116022     120541244
PLN165       134594     149644230
PLN166       102159     121622355
PLN167       135897     149976937
PLN168       126635     163241412
PLN169       120546     166607695
PLN17        1949       233857567
PLN170       20099      18041835
PLN171       124350     164177250
PLN172       112968     173143221
PLN173       85775      158247288
PLN174       118924     172064751
PLN175       110503     185914156
PLN176       12344      317072253
PLN177       18888      190560388
PLN178       19737      363518883
PLN179       10232      333664247
PLN18        3          330514248
PLN180       302        288936846
PLN181       5          324373291
PLN182       1670       369972731
PLN183       1585       2233569
PLN184       1382       387001316
PLN185       8          179149947
PLN186       1282       232633870
PLN187       1          522466905
PLN188       1          675310294
PLN189       1          628753756
PLN19        37         346663474
PLN190       1          624247919
PLN191       1          599018945
PLN192       1          573247234
PLN193       1          634667502
PLN194       8478       149585073
PLN195       1          727344967
PLN196       1          946003158
PLN197       1          965754312
PLN198       1          906459801
PLN199       1          876148008
PLN2         39501      282969556
PLN20        19732      84516164
PLN200       1          885153844
PLN201       1          899925126
PLN202       1          528437893
PLN203       4123       344349404
PLN204       10         362580157
PLN205       4          120184706
PLN206       129        363593727
PLN207       404        366581476
PLN208       9          335385998
PLN209       130        308977848
PLN21        96587      101384517
PLN210       2          317663561
PLN211       1          192140685
PLN212       1          279860179
PLN213       1          259520967
PLN214       2          294703259
PLN215       1          238633233
PLN216       1          162496318
PLN217       1          420743833
PLN218       206        92200731
PLN219       16         383095167
PLN22        113432     117615216
PLN220       32         120825431
PLN221       1          541700351
PLN222       1          696809892
PLN223       1          655542733
PLN224       1          648987779
PLN225       1          622068216
PLN226       1          583456046
PLN227       1          654005093
PLN228       130        298375
PLN229       1          522466905
PLN23        57311      72144580
PLN230       1          675310294
PLN231       1          628753756
PLN232       1          624247919
PLN233       1          599018945
PLN234       1          573247234
PLN235       1          634667502
PLN236       313        95007523
PLN237       1          521073757
PLN238       1          672273650
PLN239       1          634137895
PLN24        28689      28922869
PLN240       1          624121443
PLN241       1          607506942
PLN242       1          564293627
PLN243       1          632401812
PLN244       1          520603772
PLN245       1          661076038
PLN246       1          626572591
PLN247       1          612852138
PLN248       1          598896166
PLN249       1          570629545
PLN25        2648       194594881
PLN250       1          623813090
PLN251       1          513014082
PLN252       1          653624577
PLN253       1          616219606
PLN254       1          610044819
PLN255       1          583417444
PLN256       1          550735148
PLN257       1          620104558
PLN258       1          536602846
PLN259       1          671211297
PLN26        344        254550430
PLN260       1          630677708
PLN261       1          623428415
PLN262       1          604298040
PLN263       1          558526623
PLN264       1          628419988
PLN265       1          500012378
PLN266       1          648922534
PLN267       1          604770208
PLN268       1          597403059
PLN269       1          576456374
PLN27        400        261235914
PLN270       1          556080982
PLN271       1          603311816
PLN272       1          512023576
PLN273       1          652551272
PLN274       1          615767531
PLN275       1          605571303
PLN276       1          592249714
PLN277       1          549757368
PLN278       1          616509610
PLN279       1          550024188
PLN28        198        168828441
PLN280       1          710194481
PLN281       1          661081403
PLN282       1          659460550
PLN283       1          630572514
PLN284       1          598618390
PLN285       1          658974642
PLN286       1          559656399
PLN287       1          717517502
PLN288       1          672450454
PLN289       1          665297378
PLN29        298        258873545
PLN290       1          636785599
PLN291       1          599706080
PLN292       1          675658265
PLN293       1          523168208
PLN294       1          495661851
PLN295       1          640830439
PLN296       1          597781253
PLN297       1          600363860
PLN298       1          570178053
PLN299       1          534998810
PLN3         3695       380523795
PLN30        339        265493888
PLN300       1          616598997
PLN301       1          537457279
PLN302       1          685947972
PLN303       1          649921694
PLN304       1          641099225
PLN305       1          611845738
PLN306       1          581041262
PLN307       1          655783664
PLN308       1          521174834
PLN309       1          667717957
PLN31        485        350911896
PLN310       1          631819663
PLN311       1          624692602
PLN312       1          597351075
PLN313       1          561737938
PLN314       1          629651422
PLN315       1          524514255
PLN316       1          670202054
PLN317       1          631946783
PLN318       1          626743494
PLN319       1          600801835
PLN32        112        80604200
PLN320       1          566971015
PLN321       1          629827058
PLN322       1          522114480
PLN323       1          671530377
PLN324       1          631910401
PLN325       1          622474059
PLN326       1          598240357
PLN327       1          562137082
PLN328       1          633805855
PLN329       1          525723083
PLN33        455        379563194
PLN330       1          684336246
PLN331       1          636053469
PLN332       1          629969872
PLN333       1          604087610
PLN334       1          568600391
PLN335       1          640498578
PLN336       1          519546829
PLN337       1          665715246
PLN338       1          624683667
PLN339       1          621078253
PLN34        127        379253996
PLN340       1          600910593
PLN341       1          558953701
PLN342       1          626840912
PLN343       1          543344542
PLN344       1          697540743
PLN345       1          655862368
PLN346       1          646765634
PLN347       1          618540729
PLN348       1          587963859
PLN349       1          658085510
PLN35        91         241350431
PLN350       439        378681748
PLN351       15         312691008
PLN352       20         111531882
PLN353       1          596211899
PLN354       1          705338699
PLN355       1          493450010
PLN356       1          804285258
PLN357       1          810734643
PLN358       1          673981989
PLN359       1          754496630
PLN36        108        325736871
PLN360       1          855759449
PLN361       1          614042580
PLN362       1          743847818
PLN363       1          673340788
PLN364       1          515668560
PLN365       1          713320806
PLN366       1          703598484
PLN367       1          570159854
PLN368       1          625793224
PLN369       1          721110502
PLN37        17         390428741
PLN370       1          459355444
PLN371       1          745201001
PLN372       1          749284433
PLN373       1          643344672
PLN374       1          595297365
PLN375       1          688905267
PLN376       1          491807393
PLN377       1          769338634
PLN378       1          671568023
PLN379       1          635285330
PLN38        234        283333018
PLN380       1          745618965
PLN381       1          839470345
PLN382       1          646400022
PLN383       1          747589525
PLN384       1          665179885
PLN385       1          506585010
PLN386       1          703962928
PLN387       1          702438406
PLN388       1          568126671
PLN389       1          610851963
PLN39        161        383746871
PLN390       1          707596419
PLN391       1          465558328
PLN392       1          734536914
PLN393       1          738743901
PLN394       1          636778132
PLN395       1          602900890
PLN396       1          697493198
PLN397       1          490518203
PLN398       1          784661008
PLN399       1          810500911
PLN4         3520       387632137
PLN40        65         329728329
PLN400       1          655314739
PLN401       1          752710991
PLN402       1          890847171
PLN403       1          621781073
PLN404       1          743084022
PLN405       1          676741658
PLN406       1          509452426
PLN407       1          710124532
PLN408       1          480767623
PLN409       1          578021311
PLN41        16         386556087
PLN410       1          620140791
PLN411       1          716573881
PLN412       1          476726550
PLN413       1          756324664
PLN414       1          977471539
PLN415       1          642207261
PLN416       1          502612092
PLN417       1          646234737
PLN418       1          605172934
PLN419       1          593744788
PLN42        20         328777414
PLN420       1          571972453
PLN421       1          545472572
PLN422       1          607667504
PLN423       1          590561804
PLN424       1          685720839
PLN425       1          490910922
PLN426       1          782694893
PLN427       1          796420183
PLN428       1          650274702
PLN429       1          739889549
PLN43        6          376299569
PLN430       1          848590828
PLN431       1          610626473
PLN432       1          738023571
PLN433       1          667607564
PLN434       1          506274898
PLN435       1          701434008
PLN436       1          690770133
PLN437       1          567265955
PLN438       1          612987783
PLN439       1          704156067
PLN44        1          65870126
PLN440       1          475327881
PLN441       1          732118298
PLN442       1          733931846
PLN443       1          636796232
PLN444       1          599764323
PLN445       1          691313424
PLN446       1          493357854
PLN447       1          782685093
PLN448       1          786410271
PLN449       1          648139033
PLN45        93         388494695
PLN450       1          744407562
PLN451       1          835583350
PLN452       1          623221719
PLN453       1          741299132
PLN454       1          669032550
PLN455       1          517040482
PLN456       1          711661679
PLN457       1          708205786
PLN458       1          573398137
PLN459       1          583494258
PLN46        15         373888800
PLN460       1          707105489
PLN461       1          471251328
PLN462       1          737453356
PLN463       1          736349413
PLN464       1          639162162
PLN465       1          586755746
PLN466       1          704478343
PLN467       1          492109999
PLN468       1          791475352
PLN469       1          785940626
PLN47        9          363551984
PLN470       1          661246824
PLN471       1          756990402
PLN472       1          858776195
PLN473       1          621195942
PLN474       1          754256086
PLN475       1          670301833
PLN476       1          509263899
PLN477       1          708234589
PLN478       1          725120110
PLN479       1          575129590
PLN48        60         374148929
PLN480       1          620883766
PLN481       1          727285804
PLN482       1          479660269
PLN483       1          745978486
PLN484       1          750160716
PLN485       1          642428577
PLN486       1          591313643
PLN487       1          705330581
PLN488       1          495656580
PLN489       1          803232604
PLN49        14         212654302
PLN490       1          790745243
PLN491       1          657494025
PLN492       1          759305888
PLN493       1          856542542
PLN494       1          628321883
PLN495       1          754364263
PLN496       1          697113365
PLN497       1          504254270
PLN498       1          715354979
PLN499       1          713929667
PLN5         97749      201651968
PLN50        74         124609184
PLN500       1          572943128
PLN501       1          626959190
PLN502       1          715714221
PLN503       1          483823121
PLN504       1          742917797
PLN505       1          748536659
PLN506       1          643784981
PLN507       1          600654286
PLN508       1          685083685
PLN509       1          486317123
PLN51        8          358353307
PLN510       1          794150360
PLN511       1          799857935
PLN512       1          655329108
PLN513       1          749763888
PLN514       1          838116175
PLN515       1          610468321
PLN516       1          736551279
PLN517       1          666328382
PLN518       1          504826275
PLN519       1          702606209
PLN52        3          347496433
PLN520       1          467876140
PLN521       1          566465558
PLN522       1          614421429
PLN523       1          698878671
PLN524       1          480431564
PLN525       1          735408736
PLN526       1          969998116
PLN527       1          635024734
PLN528       10         3368
PLN529       1          595339094
PLN53        4          370651368
PLN530       1          698605642
PLN531       1          499102108
PLN532       1          791748890
PLN533       1          797311483
PLN534       1          656817438
PLN535       1          753360318
PLN536       1          845838138
PLN537       1          619661694
PLN538       1          752772853
PLN539       1          689709469
PLN54        2          271593360
PLN540       1          509595892
PLN541       1          712797596
PLN542       1          710493282
PLN543       1          570643040
PLN544       1          619886155
PLN545       1          705533140
PLN546       1          484551304
PLN547       1          740148362
PLN548       1          757233630
PLN549       1          642499559
PLN55        1          150766190
PLN550       1          594006513
PLN551       1          693261537
PLN552       1          492948387
PLN553       1          781462734
PLN554       1          802944975
PLN555       1          650275864
PLN556       1          756841830
PLN557       1          850623622
PLN558       1          614136911
PLN559       1          723255126
PLN56        2          288204953
PLN560       1          669876730
PLN561       1          507533340
PLN562       1          712168462
PLN563       1          712339524
PLN564       1          564869106
PLN565       1          619418949
PLN566       1          715454519
PLN567       1          478264344
PLN568       1          734693445
PLN569       1          749685439
PLN57        2          286787940
PLN570       1          633598967
PLN571       171        140760852
PLN572       1          516505932
PLN573       1          665585731
PLN574       1          621516506
PLN575       1          610333535
PLN576       1          588218686
PLN577       1          561794515
PLN578       1          632540561
PLN579       118        87991
PLN58        2          295931502
PLN580       1          313789095
PLN581       1          248068439
PLN582       1          241454477
PLN583       1          251811976
PLN584       1          225452224
PLN585       1          173806927
PLN586       2          370152128
PLN587       158        374282142
PLN588       599        391596749
PLN589       10         362580157
PLN59        50         360868274
PLN590       7          281547701
PLN591       1          314258027
PLN592       1          394306295
PLN593       1          325599754
PLN594       1          288763641
PLN595       1          187311108
PLN596       1          277174932
PLN597       1          235078182
PLN598       15         332895745
PLN599       16436      36185494
PLN6         111698     128137537
PLN60        8          373615720
PLN600       5636       1862075
PLN601       5224       2478918
PLN602       1          563502314
PLN603       833        298337632
PLN604       1194       92707173
PLN605       1          594102056
PLN606       1          689851870
PLN607       1          495453186
PLN608       1          780798557
PLN609       1          801256715
PLN61        7          376229618
PLN610       1          651852609
PLN611       1          750843639
PLN612       1          830829764
PLN613       1          615552423
PLN614       1          744588157
PLN615       1          673617499
PLN616       1          509857067
PLN617       1          709773743
PLN618       1          713149757
PLN619       1          566080677
PLN62        6          342806685
PLN620       1          618079260
PLN621       1          720988478
PLN622       1          473592718
PLN623       1          736706236
PLN624       1          750620385
PLN625       1          638686055
PLN626       1          480980714
PLN627       6684       330577769
PLN628       3760       370633860
PLN629       10097      326490424
PLN63        6          347730275
PLN630       1753       12315783
PLN631       1          585266722
PLN632       1          681112512
PLN633       1          775448786
PLN634       1          790338525
PLN635       1          746673839
PLN636       1          836514780
PLN637       1          736872137
PLN638       1          676292951
PLN639       1          669155517
PLN64        6          350661716
PLN640       1          701372996
PLN641       1          615672275
PLN642       1          698614761
PLN643       1          728031845
PLN644       1          722970987
PLN645       12302      8480478
PLN646       94663      142071821
PLN647       109381     181391960
PLN648       90261      195953319
PLN649       80439      197487404
PLN65        43         144640005
PLN650       98733      191430208
PLN651       102166     190112446
PLN652       102707     187692075
PLN653       9106       20385811
PLN654       90795      203008397
PLN655       92008      200806059
PLN656       73452      220871359
PLN657       25316      68913578
PLN658       70815      228971438
PLN659       75285      213946933
PLN66        144        326417895
PLN660       62449      235085744
PLN661       73032      226031411
PLN662       59339      236811082
PLN663       1509       8424612
PLN664       65041      234555688
PLN665       52398      252114575
PLN666       55098      255584684
PLN667       19893      288724789
PLN668       7          376527656
PLN669       1          532083992
PLN67        7          298887356
PLN670       1          684376481
PLN671       1          642597466
PLN672       1          631979072
PLN673       1          607115911
PLN674       1          582960187
PLN675       1          640026769
PLN676       1          608979116
PLN677       1          720972993
PLN678       1          501257520
PLN679       1          804602427
PLN68        6          332369654
PLN680       1          808121247
PLN681       1          649118519
PLN682       1          758906661
PLN683       1          861141126
PLN684       1          642382296
PLN685       1          759893476
PLN686       1          689766370
PLN687       1          531462149
PLN688       1          714517032
PLN689       1          717288350
PLN69        50         340388796
PLN690       1          586345039
PLN691       1          626266972
PLN692       1          738085275
PLN693       1          505809789
PLN694       1          759124079
PLN695       1          751612808
PLN696       1          653055523
PLN697       7          358620060
PLN698       673        378721170
PLN699       1          322486422
PLN7         64150      184784335
PLN70        34         333743749
PLN700       1          260047251
PLN701       1          262402055
PLN702       1          330012911
PLN703       1          349800169
PLN704       1          354403191
PLN705       1          317988395
PLN706       1          376468909
PLN707       297        341997202
PLN708       6          385538869
PLN709       18         375740512
PLN71        1          48961553
PLN710       12         364214839
PLN711       51         171035642
PLN712       38         343074766
PLN713       5          325733636
PLN714       11         384023275
PLN715       10         375480087
PLN716       10         379071384
PLN717       9          351388705
PLN718       125        364494783
PLN719       10         394439500
PLN72        195        309764478
PLN720       10         375932913
PLN721       10         373983960
PLN722       10         369372075
PLN723       36675      234712058
PLN73        6          336790634
PLN74        5          336035871
PLN75        6          326965702
PLN76        5          304407451
PLN77        13         303962775
PLN78        5          284426683
PLN79        8          327303441
PLN8         21749      106849481
PLN80        61         76849044
PLN81        2          355063454
PLN82        1          333667882
PLN83        1          302574826
PLN84        1          296818136
PLN85        1          257455782
PLN86        1          252943167
PLN87        1          225803546
PLN88        1          219123305
PLN89        2          394302667
PLN9         35233      291274408
PLN90        38         30696039
PLN91        15         305289289
PLN92        2          286029496
PLN93        2          307738366
PLN94        2          269669619
PLN95        1          157681923
PLN96        40         376080648
PLN97        33         389701062
PLN98        106        384154506
PLN99        99         346737635
PRI1         23047      60053106
PRI10        2265       387936439
PRI11        4375       381717987
PRI12        2068       191950792
PRI13        2459       391017609
PRI14        17343      243216304
PRI15        27929      79132073
PRI16        96050      166265556
PRI17        11025      363947920
PRI18        3741       383223079
PRI19        15303      353911286
PRI2         23840      319341223
PRI20        2239       172855211
PRI21        1          250749103
PRI22        1          238414537
PRI23        2          387789264
PRI24        2          351926207
PRI25        2          301224727
PRI26        2          270924633
PRI27        3          376243325
PRI28        4          374251276
PRI29        5          290585290
PRI3         2613       370370379
PRI30        42409      314482865
PRI31        18912      23568975
PRI32        53141      193817517
PRI33        4          351860731
PRI34        5          337827736
PRI35        3          297245061
PRI36        3          382019003
PRI37        2          285375381
PRI38        2          306826759
PRI39        2          354172067
PRI4         2409       360399901
PRI40        2          394680893
PRI41        1          242696752
PRI42        12373      364516820
PRI43        113541     183831844
PRI44        53712      103476461
PRI45        74330      199952244
PRI46        54429      215566213
PRI47        34622      144332518
PRI48        69722      214218466
PRI49        97142      191435945
PRI5         2593       353874487
PRI50        1          229594237
PRI51        1          190673448
PRI52        9368       358512524
PRI53        48772      211005842
PRI54        83149      190138078
PRI55        56350      108966914
PRI6         2112       282951291
PRI7         2729       356953890
PRI8         3181       362167571
PRI9         2423       385530941
ROD1         38451      309764896
ROD10        15053      352243468
ROD11        1336       2453179
ROD12        22213      347967024
ROD13        1002       157743814
ROD14        53466      238707384
ROD15        21658      310382782
ROD16        228387     97434634
ROD17        96974      65103533
ROD18        37907      247022749
ROD19        2          383374219
ROD2         1810       346957759
ROD20        2          353017828
ROD21        2          317259772
ROD22        2          289653994
ROD23        1          140975125
ROD24        3          385591618
ROD25        4          335044383
ROD26        5          356599364
ROD27        2          394024503
ROD28        2          369416674
ROD29        2          335852806
ROD3         1885       352024250
ROD30        2          300392300
ROD31        2          283621167
ROD32        3          348161973
ROD33        5          386542915
ROD34        154        237877425
ROD35        1          193958709
ROD36        2          350925653
ROD37        2          319642044
ROD38        2          276360533
ROD39        3          382322699
ROD4         1943       360884621
ROD40        3          366447402
ROD41        84         245931526
ROD42        2          348668775
ROD43        2          314889876
ROD44        3          389462371
ROD45        3          321351180
ROD46        1          93020901
ROD47        5          385423505
ROD48        6          342729329
ROD49        3          325864489
ROD5         1990       363733749
ROD50        4          358685719
ROD51        4          302148481
ROD52        5          337904903
ROD53        6          385168143
ROD54        6          347801590
ROD55        6          283624907
ROD56        63544      197776289
ROD57        1          203594213
ROD58        2          307631349
ROD59        2          273205312
ROD6         306        57843793
ROD60        2          272523522
ROD61        3          367476852
ROD62        3          318205593
ROD63        5          305035074
ROD64        2          318173246
ROD65        2          308990189
ROD66        2          273361793
ROD67        3          387778067
ROD68        3          350884214
ROD69        4          388911322
ROD7         1975       368354297
ROD70        4          237246301
ROD71        2          368078907
ROD72        2          295232279
ROD73        2          276158786
ROD74        3          370764878
ROD75        3          367374895
ROD76        5          389069045
ROD77        20543      154840115
ROD8         1990       369693686
ROD9         1959       368016559
STS1         170456     86853136
STS10        202215     61355397
STS11        167032     59462482
STS2         143554     63344283
STS3         8245       4839643
STS4         108725     63673512
STS5         110379     70040590
STS6         106166     81423611
STS7         122521     86625645
STS8         198742     60873959
STS9         8953       2430879
SYN1         54442      100617525
SYN10        2          382762979
SYN11        2          332214168
SYN12        4          386933112
SYN13        1          271050050
SYN14        2          294093621
SYN15        3          329883353
SYN16        4          353920981
SYN17        2          328712085
SYN18        4          357672913
SYN19        1          207870274
SYN2         1          271050050
SYN20        2          382762979
SYN21        2          332214168
SYN22        8          392789107
SYN23        65440      194407751
SYN24        936        35900024
SYN25        9183       352928592
SYN26        17218      334475810
SYN27        109254     160492762
SYN28        32788      97603171
SYN29        8300       241121672
SYN3         2          294093621
SYN4         3          329883353
SYN5         4          353920981
SYN6         1          64242768
SYN7         3          371658272
SYN8         2          250483958
SYN9         1          207870274
TSA1         233379     79653713
TSA10        168620     151882439
TSA100       63252      114802277
TSA101       79841      41351312
TSA102       82721      28609319
TSA103       67721      19747702
TSA104       84021      22863253
TSA105       84236      21912832
TSA106       84446      20981295
TSA107       134042     46621688
TSA108       155667     149676184
TSA109       183730     101083950
TSA11        157833     129928381
TSA110       47348      107503283
TSA111       136867     166252974
TSA112       166495     124901244
TSA113       97423      237859520
TSA114       99257      234633653
TSA115       12708      5978473
TSA116       134189     172362066
TSA117       127781     180160426
TSA118       129595     177105775
TSA119       121186     168272985
TSA12        96970      81223522
TSA120       161588     123667649
TSA121       122311     187541168
TSA122       147961     145186533
TSA123       94592      61300137
TSA124       136202     168455642
TSA125       159235     124954199
TSA126       156460     125810552
TSA127       123500     121448801
TSA13        144445     166877725
TSA14        183179     128348861
TSA15        63956      19389564
TSA16        207559     109270376
TSA17        186915     104023410
TSA18        49380      65170400
TSA19        154738     149587836
TSA2         222489     88761403
TSA20        216986     100238238
TSA21        205873     104166326
TSA22        22693      12535715
TSA23        158964     127360041
TSA24        173318     148890122
TSA25        214965     83902995
TSA26        105827     75169883
TSA27        172910     71716168
TSA28        221930     89798997
TSA29        26888      19147632
TSA3         74606      22549982
TSA30        203801     105213489
TSA31        180460     145757585
TSA32        69461      30780900
TSA33        188249     126080028
TSA34        147105     171156456
TSA35        162844     143034354
TSA36        150188     161796191
TSA37        167342     152072055
TSA38        141406     134174466
TSA39        170369     157568728
TSA4         200107     117397278
TSA40        68539      95284697
TSA41        171892     122248327
TSA42        190077     128883583
TSA43        179565     129786674
TSA44        74788      42541556
TSA45        179837     148961559
TSA46        157618     110427650
TSA47        134614     95382384
TSA48        185173     132793697
TSA49        208467     104145310
TSA5         215390     134315100
TSA50        79060      109863998
TSA51        193326     109684073
TSA52        179762     119005289
TSA53        111989     117134802
TSA54        155065     135926838
TSA55        161491     91811831
TSA56        130880     143874686
TSA57        137221     81350084
TSA58        155281     162331143
TSA59        162870     156978878
TSA6         15756      19456676
TSA60        193460     121152461
TSA61        58307      95815324
TSA62        173904     118336485
TSA63        151865     162169634
TSA64        60981      124236666
TSA65        201109     152115772
TSA66        185638     143700395
TSA67        163423     121712708
TSA68        182114     137377481
TSA69        170731     97712914
TSA7         193885     54027947
TSA70        40637      38146354
TSA71        119065     123313318
TSA72        131964     141438855
TSA73        151655     115933671
TSA74        830        251943
TSA75        152989     102336522
TSA76        156503     143538644
TSA77        40595      33645981
TSA78        176683     138455592
TSA79        161932     158903820
TSA8         157535     121615138
TSA80        11473      9475196
TSA81        185669     115791752
TSA82        143388     147833423
TSA83        177758     145461495
TSA84        159207     177073302
TSA85        17073      11909470
TSA86        168307     128893220
TSA87        156344     150391937
TSA88        195417     125563889
TSA89        31946      22565095
TSA9         99556      68880314
TSA90        196286     138439609
TSA91        112986     113189975
TSA92        98986      206634893
TSA93        87112      229168164
TSA94        77344      247719367
TSA95        30093      107285833
TSA96        141033     144555977
TSA97        106053     76615758
TSA98        74413      65471527
TSA99        33768      32853514
UNA1         706        4422422
VRL1         132421     138785660
VRL10        44177      308098589
VRL100       2501       67577874
VRL101       7955       223284137
VRL102       8623       221393664
VRL103       8326       222118622
VRL104       3336       95711718
VRL105       7540       222791008
VRL106       8358       222453691
VRL107       7535       222052391
VRL108       7568       190895414
VRL109       7470       222647797
VRL11        115595     146323613
VRL110       7615       221946669
VRL111       7695       222059936
VRL112       2104       62704572
VRL113       7478       222314670
VRL114       7470       221558046
VRL115       7786       222980052
VRL116       7484       216614253
VRL117       7707       219663103
VRL118       7369       218154973
VRL119       8017       221987322
VRL12        22909      79717134
VRL120       3785       112496365
VRL121       7550       221472419
VRL122       7476       222844210
VRL123       7761       223151465
VRL124       7416       219849999
VRL125       7857       218777404
VRL126       7562       222389943
VRL127       7512       220472398
VRL128       7374       218318293
VRL129       5180       154030064
VRL13        114064     144976318
VRL130       12365      369630589
VRL131       12387      370295291
VRL132       12393      370567303
VRL133       12384      370286134
VRL134       12382      370211898
VRL135       5593       167207813
VRL136       12391      370378994
VRL137       12393      370390238
VRL138       12395      370424114
VRL139       7993       238860319
VRL14        112586     147955480
VRL140       12409      370814633
VRL141       12404      370667524
VRL142       12459      371903729
VRL143       5733       170858745
VRL144       7445       221929148
VRL145       7720       222648328
VRL146       7444       221865281
VRL147       2695       80273898
VRL148       7622       223272576
VRL149       7457       222064078
VRL15        26371      44259291
VRL150       7533       222240704
VRL151       8204       221525271
VRL152       3706       109855436
VRL153       7465       220703757
VRL154       7408       219830095
VRL155       7402       219741025
VRL156       3486       103342940
VRL157       7406       219156355
VRL158       7526       222562796
VRL159       7437       219954148
VRL16        91100      158466153
VRL160       7609       223005326
VRL161       4420       123990314
VRL162       7547       221940448
VRL163       7447       221488902
VRL164       7363       218047798
VRL165       7445       221720276
VRL166       3549       99103705
VRL167       7443       221912893
VRL168       7417       220602718
VRL169       7450       220822383
VRL17        96717      150177445
VRL170       5100       151976887
VRL171       7483       221890218
VRL172       7454       221898981
VRL173       7431       219711057
VRL174       2545       75283166
VRL175       7522       221905234
VRL176       7448       222116331
VRL177       7433       220982771
VRL178       2235       65846000
VRL179       7779       222829176
VRL18        60953      99688982
VRL180       7621       223208575
VRL181       7541       223065746
VRL182       6902       203414032
VRL183       7364       218005430
VRL184       7498       222152562
VRL185       7560       223117835
VRL186       7463       221956044
VRL187       7447       221890174
VRL188       7600       222262233
VRL189       7443       221443893
VRL19        92385      166032863
VRL190       2905       86639353
VRL191       7600       221963321
VRL192       7387       219054561
VRL193       7417       220494907
VRL194       5264       156821615
VRL195       7475       222907742
VRL196       7526       222955301
VRL197       7470       221869995
VRL198       3000       89452536
VRL199       7411       219493800
VRL2         126454     151461800
VRL20        91155      163931909
VRL200       7406       219726004
VRL201       7457       222066799
VRL202       3538       105505722
VRL203       7524       223593418
VRL204       7572       224219933
VRL205       7562       222222059
VRL206       7442       221720355
VRL207       1934       57428412
VRL208       7476       222456120
VRL209       7430       221222610
VRL21        53961      120919698
VRL210       7386       219102786
VRL211       4874       145183951
VRL212       7447       221957942
VRL213       7500       223195328
VRL214       7551       224839585
VRL215       5670       168932697
VRL216       12227      365134813
VRL217       12346      368941421
VRL218       6276       187454790
VRL219       1904       56895892
VRL22        83155      172778768
VRL220       12412      370879597
VRL221       12615      376530246
VRL222       12642      377214922
VRL223       6339       188939939
VRL224       12640      377031424
VRL225       12732      379414321
VRL226       12742      379705519
VRL227       7006       208976171
VRL228       12705      378687920
VRL229       12643      377171669
VRL23        86024      167244510
VRL230       12570      374982296
VRL231       4234       126319737
VRL232       12563      374631629
VRL233       12551      374528581
VRL234       12589      375488908
VRL235       3548       106009595
VRL236       12492      372907154
VRL237       12432      371444506
VRL238       12406      370719895
VRL239       6412       191544890
VRL24        69422      118982651
VRL240       12420      370922953
VRL241       12405      370740440
VRL242       12392      370374902
VRL243       3446       102996629
VRL244       12465      372209245
VRL245       12442      371607689
VRL246       12298      368780193
VRL247       6433       192236959
VRL248       12555      374690328
VRL249       12412      370916638
VRL25        82970      167612962
VRL250       12130      362534777
VRL251       3014       90082279
VRL252       12422      371167299
VRL253       12261      366451044
VRL254       12386      370106341
VRL255       11574      345921941
VRL256       12375      369587244
VRL257       12390      369740875
VRL258       12379      370001711
VRL259       2818       84233233
VRL26        83272      167338967
VRL260       12290      367379494
VRL261       12501      373141570
VRL262       12356      369313214
VRL263       8818       263555082
VRL264       12371      369579323
VRL265       12404      370568074
VRL266       12579      375437866
VRL267       12370      369707372
VRL268       6792       202887204
VRL269       12355      369205246
VRL27        50179      111728563
VRL270       12444      371704521
VRL271       12371      369747768
VRL272       12440      371544438
VRL273       1311       39148614
VRL274       12301      367635353
VRL275       12375      369840368
VRL276       12376      369853961
VRL277       9921       296510731
VRL278       12418      371109515
VRL279       12357      369316303
VRL28        88111      185308810
VRL280       12364      369502641
VRL281       8756       261662267
VRL282       12392      370309151
VRL283       12364      369530954
VRL284       12373      369795214
VRL285       6051       180847472
VRL286       12089      361310447
VRL287       11884      355177935
VRL288       12279      366995197
VRL289       12378      369927794
VRL29        48377      280727829
VRL290       887        26470133
VRL291       12440      371679738
VRL292       12231      365563611
VRL293       12376      369889404
VRL294       12358      369342465
VRL295       12278      366914683
VRL296       14444      367310087
VRL297       27397      25986180
VRL3         100302     120921348
VRL30        73441      192964535
VRL31        37205      86057962
VRL32        67817      182251322
VRL33        77055      186602218
VRL34        64757      153079860
VRL35        75258      192324312
VRL36        83563      171914615
VRL37        70799      140767506
VRL38        79541      176258566
VRL39        66533      183367006
VRL4         94614      149040310
VRL40        42077      198047605
VRL41        17991      123523862
VRL42        23638      217841281
VRL43        15564      218605784
VRL44        33942      206634875
VRL45        5241       115706912
VRL46        16119      220005402
VRL47        21960      215318415
VRL48        14448      219125771
VRL49        6382       118311156
VRL5         87219      144400840
VRL50        10452      222238549
VRL51        8531       221114618
VRL52        9529       221351736
VRL53        4217       106332885
VRL54        8169       223861704
VRL55        8722       221054552
VRL56        8218       222584111
VRL57        9287       222003232
VRL58        3338       75517584
VRL59        9764       221544814
VRL6         93293      144785513
VRL60        11905      218690458
VRL61        7739       221634332
VRL62        9466       220988465
VRL63        2295       64209044
VRL64        7489       220957043
VRL65        7748       222119442
VRL66        9094       219438967
VRL67        18415      213026348
VRL68        2326       65464015
VRL69        7706       220617088
VRL7         130391     141296444
VRL70        7520       221225003
VRL71        7997       220761717
VRL72        6343       179711912
VRL73        7801       221593703
VRL74        8115       220534319
VRL75        7561       219663415
VRL76        5853       156139315
VRL77        10992      220124996
VRL78        7645       219870037
VRL79        7780       221943554
VRL8         70174      88335781
VRL80        4760       136479863
VRL81        7419       220685109
VRL82        7493       222623669
VRL83        7740       222610800
VRL84        1970       58355946
VRL85        8205       222105782
VRL86        7738       222158513
VRL87        7421       220933650
VRL88        3047       82307739
VRL89        7500       222451637
VRL9         121328     144536257
VRL90        8547       221639192
VRL91        7564       220862300
VRL92        2888       76460536
VRL93        9182       219110299
VRL94        7927       222117193
VRL95        8169       222785542
VRL96        3580       95598549
VRL97        8835       222602762
VRL98        8807       223134308
VRL99        8078       223658000
VRT1         70024      272630303
VRT10        37396      74041240
VRT100       1          839681426
VRT101       1          825560060
VRT102       1          595904407
VRT103       1          486875112
VRT104       1          387033265
VRT105       1          371528181
VRT106       1          313513962
VRT107       1          277530821
VRT108       1          268302114
VRT109       3          319484498
VRT11        18698      27611025
VRT110       5          386368861
VRT111       7          393936069
VRT112       7          384166854
VRT113       1          46063367
VRT114       7          344525641
VRT115       6          384186008
VRT116       8          388949147
VRT117       332        334400544
VRT118       1          222115097
VRT119       3          377547369
VRT12        5986       380511905
VRT120       10         383496928
VRT121       33         389650655
VRT122       6          59236435
VRT123       1          772932187
VRT124       1          662004353
VRT125       1          535506559
VRT126       1          376147139
VRT127       1          364230008
VRT128       1          346409914
VRT129       1          311292523
VRT13        3363       217068541
VRT130       1          247732340
VRT131       1          228143320
VRT132       1          221182781
VRT133       2          321892640
VRT134       490        332426844
VRT135       12         378048109
VRT136       9          378909870
VRT137       6          345737823
VRT138       2          137693511
VRT139       7          385107928
VRT14        4685       4674270
VRT140       8          360581972
VRT141       10         364952837
VRT142       4          133261911
VRT143       8          359905961
VRT144       5          370674748
VRT145       9          378247816
VRT146       6          166907986
VRT147       14         379842153
VRT148       15         375595384
VRT149       41         289507176
VRT15        1171       26255719
VRT150       11         366984719
VRT151       14         374291772
VRT152       10         185283047
VRT153       1          550518975
VRT154       1          529596002
VRT155       1          413748038
VRT156       1          326378286
VRT157       1          272612222
VRT158       1          260396842
VRT159       1          197956435
VRT16        293        13983146
VRT160       2          384149701
VRT161       2          288058306
VRT162       4          353983664
VRT163       461        371881983
VRT164       2          310725315
VRT165       2          280326572
VRT166       3          371471404
VRT167       3          354148189
VRT168       3          303679844
VRT169       4          341249946
VRT17        37         392789976
VRT170       18         371172209
VRT171       13         392880011
VRT172       13         164097178
VRT173       1          313568160
VRT174       1          289498315
VRT175       1          277254249
VRT176       1          244324502
VRT177       1          233859027
VRT178       1          225974235
VRT179       1          211674833
VRT18        13         392458500
VRT180       1          199962141
VRT181       2          390673241
VRT182       2          334991523
VRT183       2          324316137
VRT184       2          292002398
VRT185       1          133841611
VRT186       3          336899598
VRT187       28         389500106
VRT188       6          332993899
VRT189       6          378599539
VRT19        12         379958897
VRT190       1          47256133
VRT191       6          330076811
VRT192       7          362796652
VRT193       8          365387335
VRT194       20         273534543
VRT195       9          378695651
VRT196       11         392251032
VRT197       205        341394663
VRT198       7          347210350
VRT199       7          370650631
VRT2         72835      271698363
VRT20        11         316368323
VRT200       8          391548385
VRT201       6          385659507
VRT202       7          341110862
VRT203       1          55350661
VRT204       8          387616857
VRT205       3          259325358
VRT206       5          392602723
VRT207       41         394037361
VRT208       3          148003845
VRT209       7          387415360
VRT21        13         385338369
VRT210       7          365756282
VRT211       6          352657526
VRT212       5          346047628
VRT213       2          134650353
VRT214       5          356250620
VRT215       6          374573269
VRT216       6          364137996
VRT217       7          343458516
VRT218       2          121348818
VRT219       7          358240592
VRT22        14         372163844
VRT220       8          383435354
VRT221       8          365970383
VRT222       6          357597984
VRT223       7          355728138
VRT224       8          362648569
VRT225       7          390172982
VRT226       8          391413434
VRT227       8          377681388
VRT228       1          42933508
VRT229       100        376541917
VRT23        14         352781625
VRT230       20         391000381
VRT231       13         383659375
VRT232       58         386123281
VRT233       11         394338841
VRT234       11         274288418
VRT235       1          843366180
VRT236       1          842558404
VRT237       1          707956555
VRT238       1          635713434
VRT239       1          567300182
VRT24        19         384683297
VRT240       1          439630435
VRT241       1          236595445
VRT242       1          231667822
VRT243       2          382351630
VRT244       2          103223822
VRT245       1          690654357
VRT246       1          541439571
VRT247       1          495417988
VRT248       1          481763206
VRT249       1          429350720
VRT25        16         379729070
VRT250       1          224823088
VRT251       1          212589178
VRT252       2          374746477
VRT253       2          318111367
VRT254       32         270969991
VRT255       2          352563619
VRT256       7          386835620
VRT257       4314       352825248
VRT258       19         370712563
VRT259       15988      152796988
VRT26        16         381718727
VRT260       139278     132784901
VRT261       144324     125821160
VRT262       130167     122881005
VRT263       125909     146690412
VRT264       4          360689031
VRT265       5          374381301
VRT266       16         387558511
VRT267       41         262370602
VRT268       14         376657571
VRT269       16         394062851
VRT27        2          51507477
VRT270       16         377073984
VRT271       8          278699154
VRT272       13         345916081
VRT273       3          386677656
VRT274       5          363840571
VRT275       26         375942556
VRT276       11         392818628
VRT277       13210      328615031
VRT28        6          344600068
VRT29        7          384846875
VRT3         9006       334129504
VRT30        7          359521465
VRT31        33         269170512
VRT32        147        10842596
VRT33        586        15797052
VRT34        2343       67436863
VRT35        19198      357652178
VRT36        54157      304795318
VRT37        158544     137280199
VRT38        18620      13607200
VRT39        117694     200746682
VRT4         3          141387178
VRT40        84129      68198782
VRT41        2          304060631
VRT42        6          387303573
VRT43        28         305102738
VRT44        157349     129521513
VRT45        37582      25791417
VRT46        185764     123620850
VRT47        148584     105819123
VRT48        168363     113478362
VRT49        8428       7214021
VRT5         8          354279535
VRT50        133023     105740718
VRT51        156399     117964862
VRT52        142031     87313772
VRT53        188518     120085542
VRT54        103239     61379831
VRT55        157539     119288745
VRT56        156218     131114520
VRT57        131        390011129
VRT58        354        376724869
VRT59        1698       374024838
VRT6         11         387350249
VRT60        93605      262107503
VRT61        145106     21008965
VRT62        75789      25336814
VRT63        13375      365641119
VRT64        20         379347618
VRT65        270        393447049
VRT66        3067       391133617
VRT67        3471       230588304
VRT68        6925       378855996
VRT69        16         388667304
VRT7         11         393947221
VRT70        16         378559418
VRT71        12         379509384
VRT72        7          285874095
VRT73        12         387522266
VRT74        18         375242791
VRT75        16         386329687
VRT76        229        277860126
VRT77        17         367327734
VRT78        15         385834222
VRT79        7          149460915
VRT8         30744      333424138
VRT80        1          356776219
VRT81        1          350268637
VRT82        1          316334699
VRT83        1          337490635
VRT84        1          252032905
VRT85        1          217689105
VRT86        1          199443007
VRT87        1          198537509
VRT88        2          368166310
VRT89        2          330550494
VRT9         74977      70647525
VRT90        1          146904662
VRT91        3          319096504
VRT92        7          379783228
VRT93        11         374771935
VRT94        13         379441801
VRT95        3          70710155
VRT96        16         344076996
VRT97        10         385210617
VRT98        15         392781064
VRT99        22         370094349

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 246.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:

Entries        Bases   Species

1942631 172374560512   Triticum aestivum
1347430  97059428399   Hordeum vulgare subsp. vulgare
2103947  62652312853   Severe acute respiratory syndrome coronavirus 2
27433309 27485246612   Homo sapiens
147559   12328080997   Escherichia coli
1730239  10890050390   Danio rerio
10029378 10457857680   Mus musculus
23086     9981496996   Triticum turgidum subsp. durum
4219629   7410687772   Zea mays
21017     6808933226   Klebsiella pneumoniae
21523     6749236152   Secale cereale
2202019   6547392443   Rattus norvegicus
1471018   5775119082   Canis lupus familiaris
2241138   5451759433   Bos taurus
54        5178626132   Rhinatrema bivittatum
3307172   5082928954   Sus scrofa
1932      4991586515   Bufo bufo
17        4548077046   Microcaecilia unicolor
29708     4348333235   Hordeum vulgare subsp. spontaneum
10359     4262000520   Macrobrachium nipponense

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377
   219   Apr 2017   231824951552   200877884
   220   Jun 2017   234997362623   201663568
   221   Aug 2017   240343378258   203180606
   222   Oct 2017   244914705468   203953682
   223   Dec 2017   249722163594   206293625
   224   Feb 2018   253630708098   207040555
   225   Apr 2018   260189141631   208452303
   226   Jun 2018   263957884539   209775348
   227   Aug 2018   260806936411   208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
   228   Oct 2018   279668290132   209656636
   229   Dec 2018   285688542186   211281415
   230   Feb 2019   303709510632   212260377
   231   Apr 2019   321680566570   212775414
   232   Jun 2019   329835282370   213383758
   233   Aug 2019   366733917629   213865349
   234   Oct 2019   386197018538   216763706
   235   Dec 2019   388417258009   215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
   236   Feb 2020   399376854872   216214215
   237   Apr 2020   415770027949   216531829
   238   Jun 2020   427823258901   217122233
   239   Aug 2020   654057069549   218642238
   240   Oct 2020   698688094046   219055207
   241   Dec 2020   723003822007   221467827
   242   Feb 2021   776291211106   226241476
   243   Apr 2021   832400799511   227123201
   244   Jun 2021   866009790959   227888889
   245   Aug 2021   940513260726   231982592
   246   Oct 2021  1014763752113   233642893
   
  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397
  219    Apr 2017  2035032639807   451840147
  220    Jun 2017  2164683993369   487891767
  221    Aug 2017  2242294609510   499965722
  222    Oct 2017  2318156361999   508825331
  223    Dec 2017  2466098053327   551063065
  224    Feb 2018  2608532210351   564286852
  225    Apr 2018  2784740996536   621379029
  226    Jun 2018  2944617324086   639804105
  227    Aug 2018  3204855013281   665309765
  228    Oct 2018  3444172142207   722438528
  229    Dec 2018  3656719423096   773773190
  230    Feb 2019  4164513961679   945019312
  231    Apr 2019  4421986382065   993732214
  232    Jun 2019  4847677297950  1022913321
  233    Aug 2019  5585922333160  1075272215
  234    Oct 2019  5985250251028  1097629174
  235    Dec 2019  6277551200690  1127023870
  236    Feb 2020  6968991265752  1206720688
  237    Apr 2020  7788133221338  1267547429
  238    Jun 2020  8114046262158  1302852615
  239    Aug 2020  8841649410652  1408122887
  240    Oct 2020  9215815569509  1432874252
  241    Dec 2020 11830842428018  1517995689
  242    Feb 2021 12270717209612  1563938043
  243    Apr 2021 12732048052023  1590670459
  244    Jun 2021 13442974346437  1632796606
  245    Aug 2021 13888187863722  1653427055
  246    Oct 2021 14599101574547  1721064101

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485
  219    Apr 2017   149038907599   165068542
  220    Jun 2017   158112969073   176812130
  221    Aug 2017   167045663417   186777106
  222    Oct 2017   172909268535   192754804
  223    Dec 2017   181394660188   201559502
  224    Feb 2018   193940551226   214324264
  225    Apr 2018   205232396043   227364990
  226    Jun 2018   216556686631   238788334
  227    Aug 2018   225520004678   249295386
  228    Oct 2018   235875573598   259927414
  229    Dec 2018   248592892188   274845473
  230    Feb 2019   263936885705   294772430
  231    Apr 2019   277118019688   311247136
  232    Jun 2019   285390240861   319927264
  233    Aug 2019   294727165179   331347807
  234    Oct 2019   305371891408   342811151
  235    Dec 2019   325433016129   367193844
  236    Feb 2020   340994289065   386644871
  237    Apr 2020   349692751528   396392280
  238    Jun 2020   359947709062   409725050
  239    Aug 2020   366968951160   417524567
  240    Oct 2020   382996662270   435968379
  241    Dec 2020   392206975386   446397378
  242    Feb 2021   407605409948   463151000
  243    Apr 2021   425076483459   481154920
  244    Jun 2021   436594941165   494641358
  245    Aug 2021   440578422611   498305045
  246    Oct 2021   449891016597   508319391

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349
  219    Apr 2017      636923295     1438349  (unchanged)
  220    Jun 2017      824191338     1628475
  221    Aug 2017      824191338     1628475  (unchanged)
  222    Oct 2017     2993818315     9479460
  223    Dec 2017     4458042616    12695198
  224    Feb 2018     4531966831    12819978
  225    Apr 2018     5612769448    14782654
  226    Jun 2018     5896511468    15393041
  227    Aug 2018     6077824493    15822538
  228    Oct 2018     8435112913    20752288
  229    Dec 2018     8511829281    20924588
  230    Feb 2019     9146836085    23259929
  231    Apr 2019     9623321565    24240761
  232    Jun 2019    10182427815    25530139
  233    Aug 2019    10531800829    26363945
  234    Oct 2019    10848455369    27460978
  235    Dec 2019    11280596614    28227180
  236    Feb 2020    13669678196    34037371
  237    Apr 2020    24615270313    65521132
  238    Jun 2020    27500635128    75063181
  239    Aug 2020    27825059498    75682157
  240    Oct 2020    28814798868    78177358
  241    Dec 2020    33036509446    88039152
  242    Feb 2021    33634122995    90130561
  243    Apr 2021    37998534461   102395753
  244    Jun 2021    38198113354   102662929
  245    Aug 2021    39930167315   106995218
  246    Oct 2021    40168874815   107569935

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          October 15 2021

                NCBI-GenBank Flat File Release 246.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

  NOTE : Presentation of GI sequence identifiers in the GenBank
  flatfile format was discontinued as of March 2017.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

3.4.4.1 : Important notice about parsing the LOCUS line

  Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.

  Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.

  Consider this LOCUS line for a typical complete bacterial genome:

LOCUS       CP032762             5868661 bp    DNA     circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:

LOCUS       AZZZAA02123456789 9999999999 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:

LOCUS       AZZZAA0212345678910000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:

LOCUS       AZZZAA02123456789 10000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.

3.4.4.2 : Data elements of the LOCUS line

  The data elements of the LOCUS line format and their typical/historical
column positions are as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus Name (usually identical to the Accession Number)
29-29      space
30-40      Sequence Length, right-justified
41-41      space
42-43      'bp'
44-44      space
45-47      Strandedness : spaces (if not known), ss- (single-stranded),
           ds- (double-stranded), or ms- (mixed-stranded)
48-53      Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      Molecule Topology : 'linear' followed by two spaces,
           or 'circular'
64-64      space
65-67      Division Code
68-68      space
69-79      Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.

  The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :

LOCUS       HUMPDNRC                 273 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S125 polymorphic dinucleotide repeat.
ACCESSION   L10620

LOCUS       HUMPDNRG                 169 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S114 polymorphic dinucleotide repeat.
ACCESSION   L10624

  But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:

LOCUS       AF035771                1357 bp    mRNA    linear   PRI 30-JUN-1998
DEFINITION  Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
            complete cds.
ACCESSION   AF035771
	    
  The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1
            ^^^^^^^^^^
            Compound  
            Accession.Version
            Number

  A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.

  GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://www.ncbi.nlm.nih.gov/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://www.ncbi.nlm.nih.gov/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://www.ncbi.nlm.nih.gov/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://www.ncbi.nlm.nih.gov/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:

	http://www.insdc.org/documents/feature-table

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.2

3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

  The list of valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.3

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       KZ271580              141308 bp    DNA     linear   CON 17-AUG-2017
DEFINITION  Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
            O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION   KZ271580 LQNL01000000
VERSION     KZ271580.1
DBLINK      BioProject: PRJNA230512
            BioSample: SAMN04226856
KEYWORDS    WGS; HIGH_QUALITY_DRAFT.
...
     mRNA            complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /product="hypothetical protein"
     CDS             complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="OZC04795.1"
                     /db_xref="GI:1233056989"
                     /translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
                     SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
                     ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
                     TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
                     LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
                     HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
                     LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
                     IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
                     YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
                     AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
                     IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG      join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
            gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Scaffold/CON-division join() sequence


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.

  The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov .

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Sayers E, Cavanaugh M, Clark K, Ostell J, Pruitt K,
   Karsch-Mizrachi I, "GenBank", Nucleic Acids Research,
   Volume 47, Issue D1, January 2019, pp. D94-D99

   PMID:  30365038
   PMCID: PMC6323954
   DOI:   10.1093/nar/gky989

  The following statement is an example of how one might cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'

  (1) Sayers, E. et al, Nucleic Acids Res. 47(D1):D94-D99 (2019)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: Simply direct your web browser of choice to:

	 http://www.ncbi.nlm.nih.gov/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 218.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Larry Chlumsky, Karen Clark, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Augustus Tilley, Beverly Underwood, Simone Walker
	and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
	Sergiy Gotvyanskyy, Eugene Gribov, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh, Alex Kotliarov,
	Frank Ludwig, Anatoly Mnev, Vasuki Palanigobu,
	Anton Perkov, Andriy Petrow, Sergey Petrunin, Wenyao Shi, Denis Sinyakov,
	Thomas Smith, Vladimir Soussov, Elena Starchenko, Hanzhen Sun,
	Andrei Vereshchagin, Jewen Xiao, Eugene Yaschenko, Liwei Zhou

Database Administration
	Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
	Benjamin Slade, Constantin Vasilyev

Customer Support
	Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
	Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	Steve Sherry : Acting Director, NCBI
	Kim Pruitt   : Branch Chief, NCBI/IEB

Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
Support Center