Current GenBank Release Notes

GBREL.TXT          Genetic Sequence Data Bank
                         August 15 2018

               NCBI-GenBank Flat File Release 227.0

                    Distribution Release Notes

 208831050 loci, 260806936411 bases, from 208831050 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://www.ncbi.nlm.nih.gov/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 227.0
1.2 Cutoff Date
1.3 Important Changes in Release 227.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 227.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://www.ncbi.nlm.nih.gov/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 227.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

  Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:

	ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/

  Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.

1.2 Cutoff Date

  This full release, 227.0, incorporates data processed by the INSDC databases
as of Monday August 13 2018 at approximately 1:33AM EDT. For more recent data,
users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotide' database (see Section 6.4 of this document).

1.3 Important Changes in Release 227.0

1.3.1 Suppression of nearly two million sequence records for 36 genomes

  A submission of 36 unannotated nematode-related genomes to our colleagues
at the European Nucleotide Archive was recently suppressed by their submitter.
The genomes in question will be annotated and resubmitted by the Wellcome
Trust Sanger Institute, as WGS projects rather than traditional sequences
utilizing nucleotide accessions of the "2+6" format.

  This large-scale suppression has resulted in a net *decrease* in the
number of sequences and basepairs for the non-WGS/TSA/TLS portion of GenBank.
Since this is the first-ever such decrease, providing some details about
the genomes involved seems appropriate. A total of 36 distinct accession
number ranges are involved, with 1,962,764 accessions (see below for the
specific ranges and organism names). Although well over one million sequence
records are new for GenBank 227.0, the overall number of records declined
by 944,000, and the overall number of basepairs declined by 3.15 Gbp. These
decreases can be seen in Table 1, Section 2.2.8, "Growth of GenBank".

Suppressed accession ranges:

LK871857-LK903566
LK903567-LK927529
LK939141-LK945524
LK945525-LK964159
LK964160-LK978188
LK978189-LK979538
LK979539-LK985316
LK996042-LK999920
LL000001-LL188369
LL188370-LL233095
LL233096-LL319178
LL319179-LL361183
LL361184-LL515692
LL569982-LL710275
LL710276-LL718353
LL718354-LL748444
LL748445-LL876845
LL876846-LL900200
LL900201-LL956978
LL956979-LL999047
LM000001-LM013520
LM013521-LM035856
LM035857-LM065041
LM065042-LM125181
LM125182-LM149318
LM149319-LM211379
LM211380-LM378689
LM383430-LM397339
LM397340-LM413551
LM413552-LM433383
LM433384-LM462758
LM462759-LM523157
LM530258-LM537325
LM537584-LM583055
LM583056-LM607978
LM676446-LM992843

Suppressed organism names:

Angiostrongylus cantonensis
Angiostrongylus costaricensis
Anisakis simplex
Ascaris lumbricoides
Brugia pahangi
Brugia timori
Cylicostephanus goldi
Dibothriocephalus latus
Dracunculus medinensis
Echinostoma caproni
Elaeophora elaphi
Enterobius vermicularis
Gongylonema pulchrum
Haemonchus placei
Heligmosomoides polygyrus
Hydatigera taeniaeformis
Hymenolepis diminuta
Hymenolepis nana
Mesocestoides corti
Nippostrongylus brasiliensis
Onchocerca flexuosa
Parascaris equorum
Protopolystoma xenopodis
Schistocephalus solidus
Schistosoma curassoni
Schistosoma margrebowiei
Schistosoma mattheei
Schistosoma rodhaini
Soboliphyme baturini
Strongylus vulgaris
Syphacia muris
Taenia asiatica
Thelazia callipaeda
Toxocara canis
Trichobilharzia regenti
Wuchereria bancrofti

  Suppression of genomes leads to their removal from BLAST databases at the
NCBI. The new, annotated versions of these genomes are expected to be
distributed by the ENA fairly soon, at which point they will become BLAST-able
once again, and available via our standard WGS mechanisms.

1.3.2 Organizational changes

  The total number of sequence data files increased by 2 with this release:

  - the BCT division is now composed of 520 files (+28)
  - the CON division is now composed of 369 files (+4)
  - the GSS division is now composed of 308 files (+2)
  - the INV division is now composed of 108 files (-60)
  - the PAT division is now composed of 337 files (+2)
  - the PLN division is now composed of 198 files (+24)
  - the PRI division is now composed of  59 files (+1)
  - the VRL division is now composed of  57 files (+1)

  The decrease in the number of INV-division files is a consequence of the
suppression of the thirty-six genomes described in Section 1.3.1 of these
release notes.

1.3.3 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for 130
of the GSS flatfiles in Release 227.0. Consider gbgss179.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                          August 15 2018

                NCBI-GenBank Flat File Release 227.0

                           GSS Sequences (Part 1)

   87375 loci,    64103840 bases, from    87375 reported sequences
   
  Here, the filename and part number in the header is "1", though the file
has been renamed as "179" based on the number of files dumped from the other
system. Files gbgss179.seq.gz through gbgss308.seq.gz are affected. We hope
to resolve this discrepancy at some point, but the priority is certainly
much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 Changes to nucleotide and protein accession formats

  The accession format used for Whole Genome Shotgun (WGS), Transcriptome
Shotgun Assembly (TSA), and Targeted Locus Study (TLS) sequencing projects
consists of a four-letter Project Code prefix, a two-digit Assembly-Version
number, followed by 6, 7, or 8 digits (depending on the number of sequences
in the project).

  By the end of 2018 the INSDC members plan to expand this format, using
a six-letter Project Code prefix, two-digit Assembly-Version number, followed
by 7, 8, or 9 digits. An example of such an accession is AAAAAA020000001 .

  Non-WGS/TLS/TSA nucleotide sequences currently make use of a "2+6"
accession format, consisting of a two-letter prefix followed by six digits.
This format will be expanded to make use of eight digits, allowing accession
ranges that have been exhausted (eg: JG000001-JG999999) to be "re-opened"
(eg: JG00000001-JG99999999).

  Protein sequences currently make use of a "3+5" accession format, consisting
of a three-letter prefix followed by five digits. This format will be expanded
to make use of seven digits, allowing exhausted protein accession ranges such
as EZZ00001-EZZ99999 to be re-opened as EZZ0000001-EZZ9999999.

  The earliest date on which these new accessions will appear for GenBank
sequences is December 15th 2018.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the ENA and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the ENA and DDBJ databases.
BankIt may be used with any modern web browser. You can access BankIt
from GenBank's home page:   

	http://www.ncbi.nlm.nih.gov/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov .

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 3168 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct413.seq - Bacterial sequence entries, part 413.
351. gbbct414.seq - Bacterial sequence entries, part 414.
352. gbbct415.seq - Bacterial sequence entries, part 415.
353. gbbct416.seq - Bacterial sequence entries, part 416.
354. gbbct417.seq - Bacterial sequence entries, part 417.
355. gbbct418.seq - Bacterial sequence entries, part 418.
356. gbbct419.seq - Bacterial sequence entries, part 419.
357. gbbct42.seq - Bacterial sequence entries, part 42.
358. gbbct420.seq - Bacterial sequence entries, part 420.
359. gbbct421.seq - Bacterial sequence entries, part 421.
360. gbbct422.seq - Bacterial sequence entries, part 422.
361. gbbct423.seq - Bacterial sequence entries, part 423.
362. gbbct424.seq - Bacterial sequence entries, part 424.
363. gbbct425.seq - Bacterial sequence entries, part 425.
364. gbbct426.seq - Bacterial sequence entries, part 426.
365. gbbct427.seq - Bacterial sequence entries, part 427.
366. gbbct428.seq - Bacterial sequence entries, part 428.
367. gbbct429.seq - Bacterial sequence entries, part 429.
368. gbbct43.seq - Bacterial sequence entries, part 43.
369. gbbct430.seq - Bacterial sequence entries, part 430.
370. gbbct431.seq - Bacterial sequence entries, part 431.
371. gbbct432.seq - Bacterial sequence entries, part 432.
372. gbbct433.seq - Bacterial sequence entries, part 433.
373. gbbct434.seq - Bacterial sequence entries, part 434.
374. gbbct435.seq - Bacterial sequence entries, part 435.
375. gbbct436.seq - Bacterial sequence entries, part 436.
376. gbbct437.seq - Bacterial sequence entries, part 437.
377. gbbct438.seq - Bacterial sequence entries, part 438.
378. gbbct439.seq - Bacterial sequence entries, part 439.
379. gbbct44.seq - Bacterial sequence entries, part 44.
380. gbbct440.seq - Bacterial sequence entries, part 440.
381. gbbct441.seq - Bacterial sequence entries, part 441.
382. gbbct442.seq - Bacterial sequence entries, part 442.
383. gbbct443.seq - Bacterial sequence entries, part 443.
384. gbbct444.seq - Bacterial sequence entries, part 444.
385. gbbct445.seq - Bacterial sequence entries, part 445.
386. gbbct446.seq - Bacterial sequence entries, part 446.
387. gbbct447.seq - Bacterial sequence entries, part 447.
388. gbbct448.seq - Bacterial sequence entries, part 448.
389. gbbct449.seq - Bacterial sequence entries, part 449.
390. gbbct45.seq - Bacterial sequence entries, part 45.
391. gbbct450.seq - Bacterial sequence entries, part 450.
392. gbbct451.seq - Bacterial sequence entries, part 451.
393. gbbct452.seq - Bacterial sequence entries, part 452.
394. gbbct453.seq - Bacterial sequence entries, part 453.
395. gbbct454.seq - Bacterial sequence entries, part 454.
396. gbbct455.seq - Bacterial sequence entries, part 455.
397. gbbct456.seq - Bacterial sequence entries, part 456.
398. gbbct457.seq - Bacterial sequence entries, part 457.
399. gbbct458.seq - Bacterial sequence entries, part 458.
400. gbbct459.seq - Bacterial sequence entries, part 459.
401. gbbct46.seq - Bacterial sequence entries, part 46.
402. gbbct460.seq - Bacterial sequence entries, part 460.
403. gbbct461.seq - Bacterial sequence entries, part 461.
404. gbbct462.seq - Bacterial sequence entries, part 462.
405. gbbct463.seq - Bacterial sequence entries, part 463.
406. gbbct464.seq - Bacterial sequence entries, part 464.
407. gbbct465.seq - Bacterial sequence entries, part 465.
408. gbbct466.seq - Bacterial sequence entries, part 466.
409. gbbct467.seq - Bacterial sequence entries, part 467.
410. gbbct468.seq - Bacterial sequence entries, part 468.
411. gbbct469.seq - Bacterial sequence entries, part 469.
412. gbbct47.seq - Bacterial sequence entries, part 47.
413. gbbct470.seq - Bacterial sequence entries, part 470.
414. gbbct471.seq - Bacterial sequence entries, part 471.
415. gbbct472.seq - Bacterial sequence entries, part 472.
416. gbbct473.seq - Bacterial sequence entries, part 473.
417. gbbct474.seq - Bacterial sequence entries, part 474.
418. gbbct475.seq - Bacterial sequence entries, part 475.
419. gbbct476.seq - Bacterial sequence entries, part 476.
420. gbbct477.seq - Bacterial sequence entries, part 477.
421. gbbct478.seq - Bacterial sequence entries, part 478.
422. gbbct479.seq - Bacterial sequence entries, part 479.
423. gbbct48.seq - Bacterial sequence entries, part 48.
424. gbbct480.seq - Bacterial sequence entries, part 480.
425. gbbct481.seq - Bacterial sequence entries, part 481.
426. gbbct482.seq - Bacterial sequence entries, part 482.
427. gbbct483.seq - Bacterial sequence entries, part 483.
428. gbbct484.seq - Bacterial sequence entries, part 484.
429. gbbct485.seq - Bacterial sequence entries, part 485.
430. gbbct486.seq - Bacterial sequence entries, part 486.
431. gbbct487.seq - Bacterial sequence entries, part 487.
432. gbbct488.seq - Bacterial sequence entries, part 488.
433. gbbct489.seq - Bacterial sequence entries, part 489.
434. gbbct49.seq - Bacterial sequence entries, part 49.
435. gbbct490.seq - Bacterial sequence entries, part 490.
436. gbbct491.seq - Bacterial sequence entries, part 491.
437. gbbct492.seq - Bacterial sequence entries, part 492.
438. gbbct493.seq - Bacterial sequence entries, part 493.
439. gbbct494.seq - Bacterial sequence entries, part 494.
440. gbbct495.seq - Bacterial sequence entries, part 495.
441. gbbct496.seq - Bacterial sequence entries, part 496.
442. gbbct497.seq - Bacterial sequence entries, part 497.
443. gbbct498.seq - Bacterial sequence entries, part 498.
444. gbbct499.seq - Bacterial sequence entries, part 499.
445. gbbct5.seq - Bacterial sequence entries, part 5.
446. gbbct50.seq - Bacterial sequence entries, part 50.
447. gbbct500.seq - Bacterial sequence entries, part 500.
448. gbbct501.seq - Bacterial sequence entries, part 501.
449. gbbct502.seq - Bacterial sequence entries, part 502.
450. gbbct503.seq - Bacterial sequence entries, part 503.
451. gbbct504.seq - Bacterial sequence entries, part 504.
452. gbbct505.seq - Bacterial sequence entries, part 505.
453. gbbct506.seq - Bacterial sequence entries, part 506.
454. gbbct507.seq - Bacterial sequence entries, part 507.
455. gbbct508.seq - Bacterial sequence entries, part 508.
456. gbbct509.seq - Bacterial sequence entries, part 509.
457. gbbct51.seq - Bacterial sequence entries, part 51.
458. gbbct510.seq - Bacterial sequence entries, part 510.
459. gbbct511.seq - Bacterial sequence entries, part 511.
460. gbbct512.seq - Bacterial sequence entries, part 512.
461. gbbct513.seq - Bacterial sequence entries, part 513.
462. gbbct514.seq - Bacterial sequence entries, part 514.
463. gbbct515.seq - Bacterial sequence entries, part 515.
464. gbbct516.seq - Bacterial sequence entries, part 516.
465. gbbct517.seq - Bacterial sequence entries, part 517.
466. gbbct518.seq - Bacterial sequence entries, part 518.
467. gbbct519.seq - Bacterial sequence entries, part 519.
468. gbbct52.seq - Bacterial sequence entries, part 52.
469. gbbct520.seq - Bacterial sequence entries, part 520.
470. gbbct53.seq - Bacterial sequence entries, part 53.
471. gbbct54.seq - Bacterial sequence entries, part 54.
472. gbbct55.seq - Bacterial sequence entries, part 55.
473. gbbct56.seq - Bacterial sequence entries, part 56.
474. gbbct57.seq - Bacterial sequence entries, part 57.
475. gbbct58.seq - Bacterial sequence entries, part 58.
476. gbbct59.seq - Bacterial sequence entries, part 59.
477. gbbct6.seq - Bacterial sequence entries, part 6.
478. gbbct60.seq - Bacterial sequence entries, part 60.
479. gbbct61.seq - Bacterial sequence entries, part 61.
480. gbbct62.seq - Bacterial sequence entries, part 62.
481. gbbct63.seq - Bacterial sequence entries, part 63.
482. gbbct64.seq - Bacterial sequence entries, part 64.
483. gbbct65.seq - Bacterial sequence entries, part 65.
484. gbbct66.seq - Bacterial sequence entries, part 66.
485. gbbct67.seq - Bacterial sequence entries, part 67.
486. gbbct68.seq - Bacterial sequence entries, part 68.
487. gbbct69.seq - Bacterial sequence entries, part 69.
488. gbbct7.seq - Bacterial sequence entries, part 7.
489. gbbct70.seq - Bacterial sequence entries, part 70.
490. gbbct71.seq - Bacterial sequence entries, part 71.
491. gbbct72.seq - Bacterial sequence entries, part 72.
492. gbbct73.seq - Bacterial sequence entries, part 73.
493. gbbct74.seq - Bacterial sequence entries, part 74.
494. gbbct75.seq - Bacterial sequence entries, part 75.
495. gbbct76.seq - Bacterial sequence entries, part 76.
496. gbbct77.seq - Bacterial sequence entries, part 77.
497. gbbct78.seq - Bacterial sequence entries, part 78.
498. gbbct79.seq - Bacterial sequence entries, part 79.
499. gbbct8.seq - Bacterial sequence entries, part 8.
500. gbbct80.seq - Bacterial sequence entries, part 80.
501. gbbct81.seq - Bacterial sequence entries, part 81.
502. gbbct82.seq - Bacterial sequence entries, part 82.
503. gbbct83.seq - Bacterial sequence entries, part 83.
504. gbbct84.seq - Bacterial sequence entries, part 84.
505. gbbct85.seq - Bacterial sequence entries, part 85.
506. gbbct86.seq - Bacterial sequence entries, part 86.
507. gbbct87.seq - Bacterial sequence entries, part 87.
508. gbbct88.seq - Bacterial sequence entries, part 88.
509. gbbct89.seq - Bacterial sequence entries, part 89.
510. gbbct9.seq - Bacterial sequence entries, part 9.
511. gbbct90.seq - Bacterial sequence entries, part 90.
512. gbbct91.seq - Bacterial sequence entries, part 91.
513. gbbct92.seq - Bacterial sequence entries, part 92.
514. gbbct93.seq - Bacterial sequence entries, part 93.
515. gbbct94.seq - Bacterial sequence entries, part 94.
516. gbbct95.seq - Bacterial sequence entries, part 95.
517. gbbct96.seq - Bacterial sequence entries, part 96.
518. gbbct97.seq - Bacterial sequence entries, part 97.
519. gbbct98.seq - Bacterial sequence entries, part 98.
520. gbbct99.seq - Bacterial sequence entries, part 99.
521. gbchg.txt - Accession numbers of entries updated since the previous release.
522. gbcon1.seq - Constructed sequence entries, part 1.
523. gbcon10.seq - Constructed sequence entries, part 10.
524. gbcon100.seq - Constructed sequence entries, part 100.
525. gbcon101.seq - Constructed sequence entries, part 101.
526. gbcon102.seq - Constructed sequence entries, part 102.
527. gbcon103.seq - Constructed sequence entries, part 103.
528. gbcon104.seq - Constructed sequence entries, part 104.
529. gbcon105.seq - Constructed sequence entries, part 105.
530. gbcon106.seq - Constructed sequence entries, part 106.
531. gbcon107.seq - Constructed sequence entries, part 107.
532. gbcon108.seq - Constructed sequence entries, part 108.
533. gbcon109.seq - Constructed sequence entries, part 109.
534. gbcon11.seq - Constructed sequence entries, part 11.
535. gbcon110.seq - Constructed sequence entries, part 110.
536. gbcon111.seq - Constructed sequence entries, part 111.
537. gbcon112.seq - Constructed sequence entries, part 112.
538. gbcon113.seq - Constructed sequence entries, part 113.
539. gbcon114.seq - Constructed sequence entries, part 114.
540. gbcon115.seq - Constructed sequence entries, part 115.
541. gbcon116.seq - Constructed sequence entries, part 116.
542. gbcon117.seq - Constructed sequence entries, part 117.
543. gbcon118.seq - Constructed sequence entries, part 118.
544. gbcon119.seq - Constructed sequence entries, part 119.
545. gbcon12.seq - Constructed sequence entries, part 12.
546. gbcon120.seq - Constructed sequence entries, part 120.
547. gbcon121.seq - Constructed sequence entries, part 121.
548. gbcon122.seq - Constructed sequence entries, part 122.
549. gbcon123.seq - Constructed sequence entries, part 123.
550. gbcon124.seq - Constructed sequence entries, part 124.
551. gbcon125.seq - Constructed sequence entries, part 125.
552. gbcon126.seq - Constructed sequence entries, part 126.
553. gbcon127.seq - Constructed sequence entries, part 127.
554. gbcon128.seq - Constructed sequence entries, part 128.
555. gbcon129.seq - Constructed sequence entries, part 129.
556. gbcon13.seq - Constructed sequence entries, part 13.
557. gbcon130.seq - Constructed sequence entries, part 130.
558. gbcon131.seq - Constructed sequence entries, part 131.
559. gbcon132.seq - Constructed sequence entries, part 132.
560. gbcon133.seq - Constructed sequence entries, part 133.
561. gbcon134.seq - Constructed sequence entries, part 134.
562. gbcon135.seq - Constructed sequence entries, part 135.
563. gbcon136.seq - Constructed sequence entries, part 136.
564. gbcon137.seq - Constructed sequence entries, part 137.
565. gbcon138.seq - Constructed sequence entries, part 138.
566. gbcon139.seq - Constructed sequence entries, part 139.
567. gbcon14.seq - Constructed sequence entries, part 14.
568. gbcon140.seq - Constructed sequence entries, part 140.
569. gbcon141.seq - Constructed sequence entries, part 141.
570. gbcon142.seq - Constructed sequence entries, part 142.
571. gbcon143.seq - Constructed sequence entries, part 143.
572. gbcon144.seq - Constructed sequence entries, part 144.
573. gbcon145.seq - Constructed sequence entries, part 145.
574. gbcon146.seq - Constructed sequence entries, part 146.
575. gbcon147.seq - Constructed sequence entries, part 147.
576. gbcon148.seq - Constructed sequence entries, part 148.
577. gbcon149.seq - Constructed sequence entries, part 149.
578. gbcon15.seq - Constructed sequence entries, part 15.
579. gbcon150.seq - Constructed sequence entries, part 150.
580. gbcon151.seq - Constructed sequence entries, part 151.
581. gbcon152.seq - Constructed sequence entries, part 152.
582. gbcon153.seq - Constructed sequence entries, part 153.
583. gbcon154.seq - Constructed sequence entries, part 154.
584. gbcon155.seq - Constructed sequence entries, part 155.
585. gbcon156.seq - Constructed sequence entries, part 156.
586. gbcon157.seq - Constructed sequence entries, part 157.
587. gbcon158.seq - Constructed sequence entries, part 158.
588. gbcon159.seq - Constructed sequence entries, part 159.
589. gbcon16.seq - Constructed sequence entries, part 16.
590. gbcon160.seq - Constructed sequence entries, part 160.
591. gbcon161.seq - Constructed sequence entries, part 161.
592. gbcon162.seq - Constructed sequence entries, part 162.
593. gbcon163.seq - Constructed sequence entries, part 163.
594. gbcon164.seq - Constructed sequence entries, part 164.
595. gbcon165.seq - Constructed sequence entries, part 165.
596. gbcon166.seq - Constructed sequence entries, part 166.
597. gbcon167.seq - Constructed sequence entries, part 167.
598. gbcon168.seq - Constructed sequence entries, part 168.
599. gbcon169.seq - Constructed sequence entries, part 169.
600. gbcon17.seq - Constructed sequence entries, part 17.
601. gbcon170.seq - Constructed sequence entries, part 170.
602. gbcon171.seq - Constructed sequence entries, part 171.
603. gbcon172.seq - Constructed sequence entries, part 172.
604. gbcon173.seq - Constructed sequence entries, part 173.
605. gbcon174.seq - Constructed sequence entries, part 174.
606. gbcon175.seq - Constructed sequence entries, part 175.
607. gbcon176.seq - Constructed sequence entries, part 176.
608. gbcon177.seq - Constructed sequence entries, part 177.
609. gbcon178.seq - Constructed sequence entries, part 178.
610. gbcon179.seq - Constructed sequence entries, part 179.
611. gbcon18.seq - Constructed sequence entries, part 18.
612. gbcon180.seq - Constructed sequence entries, part 180.
613. gbcon181.seq - Constructed sequence entries, part 181.
614. gbcon182.seq - Constructed sequence entries, part 182.
615. gbcon183.seq - Constructed sequence entries, part 183.
616. gbcon184.seq - Constructed sequence entries, part 184.
617. gbcon185.seq - Constructed sequence entries, part 185.
618. gbcon186.seq - Constructed sequence entries, part 186.
619. gbcon187.seq - Constructed sequence entries, part 187.
620. gbcon188.seq - Constructed sequence entries, part 188.
621. gbcon189.seq - Constructed sequence entries, part 189.
622. gbcon19.seq - Constructed sequence entries, part 19.
623. gbcon190.seq - Constructed sequence entries, part 190.
624. gbcon191.seq - Constructed sequence entries, part 191.
625. gbcon192.seq - Constructed sequence entries, part 192.
626. gbcon193.seq - Constructed sequence entries, part 193.
627. gbcon194.seq - Constructed sequence entries, part 194.
628. gbcon195.seq - Constructed sequence entries, part 195.
629. gbcon196.seq - Constructed sequence entries, part 196.
630. gbcon197.seq - Constructed sequence entries, part 197.
631. gbcon198.seq - Constructed sequence entries, part 198.
632. gbcon199.seq - Constructed sequence entries, part 199.
633. gbcon2.seq - Constructed sequence entries, part 2.
634. gbcon20.seq - Constructed sequence entries, part 20.
635. gbcon200.seq - Constructed sequence entries, part 200.
636. gbcon201.seq - Constructed sequence entries, part 201.
637. gbcon202.seq - Constructed sequence entries, part 202.
638. gbcon203.seq - Constructed sequence entries, part 203.
639. gbcon204.seq - Constructed sequence entries, part 204.
640. gbcon205.seq - Constructed sequence entries, part 205.
641. gbcon206.seq - Constructed sequence entries, part 206.
642. gbcon207.seq - Constructed sequence entries, part 207.
643. gbcon208.seq - Constructed sequence entries, part 208.
644. gbcon209.seq - Constructed sequence entries, part 209.
645. gbcon21.seq - Constructed sequence entries, part 21.
646. gbcon210.seq - Constructed sequence entries, part 210.
647. gbcon211.seq - Constructed sequence entries, part 211.
648. gbcon212.seq - Constructed sequence entries, part 212.
649. gbcon213.seq - Constructed sequence entries, part 213.
650. gbcon214.seq - Constructed sequence entries, part 214.
651. gbcon215.seq - Constructed sequence entries, part 215.
652. gbcon216.seq - Constructed sequence entries, part 216.
653. gbcon217.seq - Constructed sequence entries, part 217.
654. gbcon218.seq - Constructed sequence entries, part 218.
655. gbcon219.seq - Constructed sequence entries, part 219.
656. gbcon22.seq - Constructed sequence entries, part 22.
657. gbcon220.seq - Constructed sequence entries, part 220.
658. gbcon221.seq - Constructed sequence entries, part 221.
659. gbcon222.seq - Constructed sequence entries, part 222.
660. gbcon223.seq - Constructed sequence entries, part 223.
661. gbcon224.seq - Constructed sequence entries, part 224.
662. gbcon225.seq - Constructed sequence entries, part 225.
663. gbcon226.seq - Constructed sequence entries, part 226.
664. gbcon227.seq - Constructed sequence entries, part 227.
665. gbcon228.seq - Constructed sequence entries, part 228.
666. gbcon229.seq - Constructed sequence entries, part 229.
667. gbcon23.seq - Constructed sequence entries, part 23.
668. gbcon230.seq - Constructed sequence entries, part 230.
669. gbcon231.seq - Constructed sequence entries, part 231.
670. gbcon232.seq - Constructed sequence entries, part 232.
671. gbcon233.seq - Constructed sequence entries, part 233.
672. gbcon234.seq - Constructed sequence entries, part 234.
673. gbcon235.seq - Constructed sequence entries, part 235.
674. gbcon236.seq - Constructed sequence entries, part 236.
675. gbcon237.seq - Constructed sequence entries, part 237.
676. gbcon238.seq - Constructed sequence entries, part 238.
677. gbcon239.seq - Constructed sequence entries, part 239.
678. gbcon24.seq - Constructed sequence entries, part 24.
679. gbcon240.seq - Constructed sequence entries, part 240.
680. gbcon241.seq - Constructed sequence entries, part 241.
681. gbcon242.seq - Constructed sequence entries, part 242.
682. gbcon243.seq - Constructed sequence entries, part 243.
683. gbcon244.seq - Constructed sequence entries, part 244.
684. gbcon245.seq - Constructed sequence entries, part 245.
685. gbcon246.seq - Constructed sequence entries, part 246.
686. gbcon247.seq - Constructed sequence entries, part 247.
687. gbcon248.seq - Constructed sequence entries, part 248.
688. gbcon249.seq - Constructed sequence entries, part 249.
689. gbcon25.seq - Constructed sequence entries, part 25.
690. gbcon250.seq - Constructed sequence entries, part 250.
691. gbcon251.seq - Constructed sequence entries, part 251.
692. gbcon252.seq - Constructed sequence entries, part 252.
693. gbcon253.seq - Constructed sequence entries, part 253.
694. gbcon254.seq - Constructed sequence entries, part 254.
695. gbcon255.seq - Constructed sequence entries, part 255.
696. gbcon256.seq - Constructed sequence entries, part 256.
697. gbcon257.seq - Constructed sequence entries, part 257.
698. gbcon258.seq - Constructed sequence entries, part 258.
699. gbcon259.seq - Constructed sequence entries, part 259.
700. gbcon26.seq - Constructed sequence entries, part 26.
701. gbcon260.seq - Constructed sequence entries, part 260.
702. gbcon261.seq - Constructed sequence entries, part 261.
703. gbcon262.seq - Constructed sequence entries, part 262.
704. gbcon263.seq - Constructed sequence entries, part 263.
705. gbcon264.seq - Constructed sequence entries, part 264.
706. gbcon265.seq - Constructed sequence entries, part 265.
707. gbcon266.seq - Constructed sequence entries, part 266.
708. gbcon267.seq - Constructed sequence entries, part 267.
709. gbcon268.seq - Constructed sequence entries, part 268.
710. gbcon269.seq - Constructed sequence entries, part 269.
711. gbcon27.seq - Constructed sequence entries, part 27.
712. gbcon270.seq - Constructed sequence entries, part 270.
713. gbcon271.seq - Constructed sequence entries, part 271.
714. gbcon272.seq - Constructed sequence entries, part 272.
715. gbcon273.seq - Constructed sequence entries, part 273.
716. gbcon274.seq - Constructed sequence entries, part 274.
717. gbcon275.seq - Constructed sequence entries, part 275.
718. gbcon276.seq - Constructed sequence entries, part 276.
719. gbcon277.seq - Constructed sequence entries, part 277.
720. gbcon278.seq - Constructed sequence entries, part 278.
721. gbcon279.seq - Constructed sequence entries, part 279.
722. gbcon28.seq - Constructed sequence entries, part 28.
723. gbcon280.seq - Constructed sequence entries, part 280.
724. gbcon281.seq - Constructed sequence entries, part 281.
725. gbcon282.seq - Constructed sequence entries, part 282.
726. gbcon283.seq - Constructed sequence entries, part 283.
727. gbcon284.seq - Constructed sequence entries, part 284.
728. gbcon285.seq - Constructed sequence entries, part 285.
729. gbcon286.seq - Constructed sequence entries, part 286.
730. gbcon287.seq - Constructed sequence entries, part 287.
731. gbcon288.seq - Constructed sequence entries, part 288.
732. gbcon289.seq - Constructed sequence entries, part 289.
733. gbcon29.seq - Constructed sequence entries, part 29.
734. gbcon290.seq - Constructed sequence entries, part 290.
735. gbcon291.seq - Constructed sequence entries, part 291.
736. gbcon292.seq - Constructed sequence entries, part 292.
737. gbcon293.seq - Constructed sequence entries, part 293.
738. gbcon294.seq - Constructed sequence entries, part 294.
739. gbcon295.seq - Constructed sequence entries, part 295.
740. gbcon296.seq - Constructed sequence entries, part 296.
741. gbcon297.seq - Constructed sequence entries, part 297.
742. gbcon298.seq - Constructed sequence entries, part 298.
743. gbcon299.seq - Constructed sequence entries, part 299.
744. gbcon3.seq - Constructed sequence entries, part 3.
745. gbcon30.seq - Constructed sequence entries, part 30.
746. gbcon300.seq - Constructed sequence entries, part 300.
747. gbcon301.seq - Constructed sequence entries, part 301.
748. gbcon302.seq - Constructed sequence entries, part 302.
749. gbcon303.seq - Constructed sequence entries, part 303.
750. gbcon304.seq - Constructed sequence entries, part 304.
751. gbcon305.seq - Constructed sequence entries, part 305.
752. gbcon306.seq - Constructed sequence entries, part 306.
753. gbcon307.seq - Constructed sequence entries, part 307.
754. gbcon308.seq - Constructed sequence entries, part 308.
755. gbcon309.seq - Constructed sequence entries, part 309.
756. gbcon31.seq - Constructed sequence entries, part 31.
757. gbcon310.seq - Constructed sequence entries, part 310.
758. gbcon311.seq - Constructed sequence entries, part 311.
759. gbcon312.seq - Constructed sequence entries, part 312.
760. gbcon313.seq - Constructed sequence entries, part 313.
761. gbcon314.seq - Constructed sequence entries, part 314.
762. gbcon315.seq - Constructed sequence entries, part 315.
763. gbcon316.seq - Constructed sequence entries, part 316.
764. gbcon317.seq - Constructed sequence entries, part 317.
765. gbcon318.seq - Constructed sequence entries, part 318.
766. gbcon319.seq - Constructed sequence entries, part 319.
767. gbcon32.seq - Constructed sequence entries, part 32.
768. gbcon320.seq - Constructed sequence entries, part 320.
769. gbcon321.seq - Constructed sequence entries, part 321.
770. gbcon322.seq - Constructed sequence entries, part 322.
771. gbcon323.seq - Constructed sequence entries, part 323.
772. gbcon324.seq - Constructed sequence entries, part 324.
773. gbcon325.seq - Constructed sequence entries, part 325.
774. gbcon326.seq - Constructed sequence entries, part 326.
775. gbcon327.seq - Constructed sequence entries, part 327.
776. gbcon328.seq - Constructed sequence entries, part 328.
777. gbcon329.seq - Constructed sequence entries, part 329.
778. gbcon33.seq - Constructed sequence entries, part 33.
779. gbcon330.seq - Constructed sequence entries, part 330.
780. gbcon331.seq - Constructed sequence entries, part 331.
781. gbcon332.seq - Constructed sequence entries, part 332.
782. gbcon333.seq - Constructed sequence entries, part 333.
783. gbcon334.seq - Constructed sequence entries, part 334.
784. gbcon335.seq - Constructed sequence entries, part 335.
785. gbcon336.seq - Constructed sequence entries, part 336.
786. gbcon337.seq - Constructed sequence entries, part 337.
787. gbcon338.seq - Constructed sequence entries, part 338.
788. gbcon339.seq - Constructed sequence entries, part 339.
789. gbcon34.seq - Constructed sequence entries, part 34.
790. gbcon340.seq - Constructed sequence entries, part 340.
791. gbcon341.seq - Constructed sequence entries, part 341.
792. gbcon342.seq - Constructed sequence entries, part 342.
793. gbcon343.seq - Constructed sequence entries, part 343.
794. gbcon344.seq - Constructed sequence entries, part 344.
795. gbcon345.seq - Constructed sequence entries, part 345.
796. gbcon346.seq - Constructed sequence entries, part 346.
797. gbcon347.seq - Constructed sequence entries, part 347.
798. gbcon348.seq - Constructed sequence entries, part 348.
799. gbcon349.seq - Constructed sequence entries, part 349.
800. gbcon35.seq - Constructed sequence entries, part 35.
801. gbcon350.seq - Constructed sequence entries, part 350.
802. gbcon351.seq - Constructed sequence entries, part 351.
803. gbcon352.seq - Constructed sequence entries, part 352.
804. gbcon353.seq - Constructed sequence entries, part 353.
805. gbcon354.seq - Constructed sequence entries, part 354.
806. gbcon355.seq - Constructed sequence entries, part 355.
807. gbcon356.seq - Constructed sequence entries, part 356.
808. gbcon357.seq - Constructed sequence entries, part 357.
809. gbcon358.seq - Constructed sequence entries, part 358.
810. gbcon359.seq - Constructed sequence entries, part 359.
811. gbcon36.seq - Constructed sequence entries, part 36.
812. gbcon360.seq - Constructed sequence entries, part 360.
813. gbcon361.seq - Constructed sequence entries, part 361.
814. gbcon362.seq - Constructed sequence entries, part 362.
815. gbcon363.seq - Constructed sequence entries, part 363.
816. gbcon364.seq - Constructed sequence entries, part 364.
817. gbcon365.seq - Constructed sequence entries, part 365.
818. gbcon366.seq - Constructed sequence entries, part 366.
819. gbcon367.seq - Constructed sequence entries, part 367.
820. gbcon368.seq - Constructed sequence entries, part 368.
821. gbcon369.seq - Constructed sequence entries, part 369.
822. gbcon37.seq - Constructed sequence entries, part 37.
823. gbcon38.seq - Constructed sequence entries, part 38.
824. gbcon39.seq - Constructed sequence entries, part 39.
825. gbcon4.seq - Constructed sequence entries, part 4.
826. gbcon40.seq - Constructed sequence entries, part 40.
827. gbcon41.seq - Constructed sequence entries, part 41.
828. gbcon42.seq - Constructed sequence entries, part 42.
829. gbcon43.seq - Constructed sequence entries, part 43.
830. gbcon44.seq - Constructed sequence entries, part 44.
831. gbcon45.seq - Constructed sequence entries, part 45.
832. gbcon46.seq - Constructed sequence entries, part 46.
833. gbcon47.seq - Constructed sequence entries, part 47.
834. gbcon48.seq - Constructed sequence entries, part 48.
835. gbcon49.seq - Constructed sequence entries, part 49.
836. gbcon5.seq - Constructed sequence entries, part 5.
837. gbcon50.seq - Constructed sequence entries, part 50.
838. gbcon51.seq - Constructed sequence entries, part 51.
839. gbcon52.seq - Constructed sequence entries, part 52.
840. gbcon53.seq - Constructed sequence entries, part 53.
841. gbcon54.seq - Constructed sequence entries, part 54.
842. gbcon55.seq - Constructed sequence entries, part 55.
843. gbcon56.seq - Constructed sequence entries, part 56.
844. gbcon57.seq - Constructed sequence entries, part 57.
845. gbcon58.seq - Constructed sequence entries, part 58.
846. gbcon59.seq - Constructed sequence entries, part 59.
847. gbcon6.seq - Constructed sequence entries, part 6.
848. gbcon60.seq - Constructed sequence entries, part 60.
849. gbcon61.seq - Constructed sequence entries, part 61.
850. gbcon62.seq - Constructed sequence entries, part 62.
851. gbcon63.seq - Constructed sequence entries, part 63.
852. gbcon64.seq - Constructed sequence entries, part 64.
853. gbcon65.seq - Constructed sequence entries, part 65.
854. gbcon66.seq - Constructed sequence entries, part 66.
855. gbcon67.seq - Constructed sequence entries, part 67.
856. gbcon68.seq - Constructed sequence entries, part 68.
857. gbcon69.seq - Constructed sequence entries, part 69.
858. gbcon7.seq - Constructed sequence entries, part 7.
859. gbcon70.seq - Constructed sequence entries, part 70.
860. gbcon71.seq - Constructed sequence entries, part 71.
861. gbcon72.seq - Constructed sequence entries, part 72.
862. gbcon73.seq - Constructed sequence entries, part 73.
863. gbcon74.seq - Constructed sequence entries, part 74.
864. gbcon75.seq - Constructed sequence entries, part 75.
865. gbcon76.seq - Constructed sequence entries, part 76.
866. gbcon77.seq - Constructed sequence entries, part 77.
867. gbcon78.seq - Constructed sequence entries, part 78.
868. gbcon79.seq - Constructed sequence entries, part 79.
869. gbcon8.seq - Constructed sequence entries, part 8.
870. gbcon80.seq - Constructed sequence entries, part 80.
871. gbcon81.seq - Constructed sequence entries, part 81.
872. gbcon82.seq - Constructed sequence entries, part 82.
873. gbcon83.seq - Constructed sequence entries, part 83.
874. gbcon84.seq - Constructed sequence entries, part 84.
875. gbcon85.seq - Constructed sequence entries, part 85.
876. gbcon86.seq - Constructed sequence entries, part 86.
877. gbcon87.seq - Constructed sequence entries, part 87.
878. gbcon88.seq - Constructed sequence entries, part 88.
879. gbcon89.seq - Constructed sequence entries, part 89.
880. gbcon9.seq - Constructed sequence entries, part 9.
881. gbcon90.seq - Constructed sequence entries, part 90.
882. gbcon91.seq - Constructed sequence entries, part 91.
883. gbcon92.seq - Constructed sequence entries, part 92.
884. gbcon93.seq - Constructed sequence entries, part 93.
885. gbcon94.seq - Constructed sequence entries, part 94.
886. gbcon95.seq - Constructed sequence entries, part 95.
887. gbcon96.seq - Constructed sequence entries, part 96.
888. gbcon97.seq - Constructed sequence entries, part 97.
889. gbcon98.seq - Constructed sequence entries, part 98.
890. gbcon99.seq - Constructed sequence entries, part 99.
891. gbdel.txt - Accession numbers of entries deleted since the previous release.
892. gbenv1.seq - Environmental sampling sequence entries, part 1.
893. gbenv10.seq - Environmental sampling sequence entries, part 10.
894. gbenv100.seq - Environmental sampling sequence entries, part 100.
895. gbenv101.seq - Environmental sampling sequence entries, part 101.
896. gbenv102.seq - Environmental sampling sequence entries, part 102.
897. gbenv103.seq - Environmental sampling sequence entries, part 103.
898. gbenv11.seq - Environmental sampling sequence entries, part 11.
899. gbenv12.seq - Environmental sampling sequence entries, part 12.
900. gbenv13.seq - Environmental sampling sequence entries, part 13.
901. gbenv14.seq - Environmental sampling sequence entries, part 14.
902. gbenv15.seq - Environmental sampling sequence entries, part 15.
903. gbenv16.seq - Environmental sampling sequence entries, part 16.
904. gbenv17.seq - Environmental sampling sequence entries, part 17.
905. gbenv18.seq - Environmental sampling sequence entries, part 18.
906. gbenv19.seq - Environmental sampling sequence entries, part 19.
907. gbenv2.seq - Environmental sampling sequence entries, part 2.
908. gbenv20.seq - Environmental sampling sequence entries, part 20.
909. gbenv21.seq - Environmental sampling sequence entries, part 21.
910. gbenv22.seq - Environmental sampling sequence entries, part 22.
911. gbenv23.seq - Environmental sampling sequence entries, part 23.
912. gbenv24.seq - Environmental sampling sequence entries, part 24.
913. gbenv25.seq - Environmental sampling sequence entries, part 25.
914. gbenv26.seq - Environmental sampling sequence entries, part 26.
915. gbenv27.seq - Environmental sampling sequence entries, part 27.
916. gbenv28.seq - Environmental sampling sequence entries, part 28.
917. gbenv29.seq - Environmental sampling sequence entries, part 29.
918. gbenv3.seq - Environmental sampling sequence entries, part 3.
919. gbenv30.seq - Environmental sampling sequence entries, part 30.
920. gbenv31.seq - Environmental sampling sequence entries, part 31.
921. gbenv32.seq - Environmental sampling sequence entries, part 32.
922. gbenv33.seq - Environmental sampling sequence entries, part 33.
923. gbenv34.seq - Environmental sampling sequence entries, part 34.
924. gbenv35.seq - Environmental sampling sequence entries, part 35.
925. gbenv36.seq - Environmental sampling sequence entries, part 36.
926. gbenv37.seq - Environmental sampling sequence entries, part 37.
927. gbenv38.seq - Environmental sampling sequence entries, part 38.
928. gbenv39.seq - Environmental sampling sequence entries, part 39.
929. gbenv4.seq - Environmental sampling sequence entries, part 4.
930. gbenv40.seq - Environmental sampling sequence entries, part 40.
931. gbenv41.seq - Environmental sampling sequence entries, part 41.
932. gbenv42.seq - Environmental sampling sequence entries, part 42.
933. gbenv43.seq - Environmental sampling sequence entries, part 43.
934. gbenv44.seq - Environmental sampling sequence entries, part 44.
935. gbenv45.seq - Environmental sampling sequence entries, part 45.
936. gbenv46.seq - Environmental sampling sequence entries, part 46.
937. gbenv47.seq - Environmental sampling sequence entries, part 47.
938. gbenv48.seq - Environmental sampling sequence entries, part 48.
939. gbenv49.seq - Environmental sampling sequence entries, part 49.
940. gbenv5.seq - Environmental sampling sequence entries, part 5.
941. gbenv50.seq - Environmental sampling sequence entries, part 50.
942. gbenv51.seq - Environmental sampling sequence entries, part 51.
943. gbenv52.seq - Environmental sampling sequence entries, part 52.
944. gbenv53.seq - Environmental sampling sequence entries, part 53.
945. gbenv54.seq - Environmental sampling sequence entries, part 54.
946. gbenv55.seq - Environmental sampling sequence entries, part 55.
947. gbenv56.seq - Environmental sampling sequence entries, part 56.
948. gbenv57.seq - Environmental sampling sequence entries, part 57.
949. gbenv58.seq - Environmental sampling sequence entries, part 58.
950. gbenv59.seq - Environmental sampling sequence entries, part 59.
951. gbenv6.seq - Environmental sampling sequence entries, part 6.
952. gbenv60.seq - Environmental sampling sequence entries, part 60.
953. gbenv61.seq - Environmental sampling sequence entries, part 61.
954. gbenv62.seq - Environmental sampling sequence entries, part 62.
955. gbenv63.seq - Environmental sampling sequence entries, part 63.
956. gbenv64.seq - Environmental sampling sequence entries, part 64.
957. gbenv65.seq - Environmental sampling sequence entries, part 65.
958. gbenv66.seq - Environmental sampling sequence entries, part 66.
959. gbenv67.seq - Environmental sampling sequence entries, part 67.
960. gbenv68.seq - Environmental sampling sequence entries, part 68.
961. gbenv69.seq - Environmental sampling sequence entries, part 69.
962. gbenv7.seq - Environmental sampling sequence entries, part 7.
963. gbenv70.seq - Environmental sampling sequence entries, part 70.
964. gbenv71.seq - Environmental sampling sequence entries, part 71.
965. gbenv72.seq - Environmental sampling sequence entries, part 72.
966. gbenv73.seq - Environmental sampling sequence entries, part 73.
967. gbenv74.seq - Environmental sampling sequence entries, part 74.
968. gbenv75.seq - Environmental sampling sequence entries, part 75.
969. gbenv76.seq - Environmental sampling sequence entries, part 76.
970. gbenv77.seq - Environmental sampling sequence entries, part 77.
971. gbenv78.seq - Environmental sampling sequence entries, part 78.
972. gbenv79.seq - Environmental sampling sequence entries, part 79.
973. gbenv8.seq - Environmental sampling sequence entries, part 8.
974. gbenv80.seq - Environmental sampling sequence entries, part 80.
975. gbenv81.seq - Environmental sampling sequence entries, part 81.
976. gbenv82.seq - Environmental sampling sequence entries, part 82.
977. gbenv83.seq - Environmental sampling sequence entries, part 83.
978. gbenv84.seq - Environmental sampling sequence entries, part 84.
979. gbenv85.seq - Environmental sampling sequence entries, part 85.
980. gbenv86.seq - Environmental sampling sequence entries, part 86.
981. gbenv87.seq - Environmental sampling sequence entries, part 87.
982. gbenv88.seq - Environmental sampling sequence entries, part 88.
983. gbenv89.seq - Environmental sampling sequence entries, part 89.
984. gbenv9.seq - Environmental sampling sequence entries, part 9.
985. gbenv90.seq - Environmental sampling sequence entries, part 90.
986. gbenv91.seq - Environmental sampling sequence entries, part 91.
987. gbenv92.seq - Environmental sampling sequence entries, part 92.
988. gbenv93.seq - Environmental sampling sequence entries, part 93.
989. gbenv94.seq - Environmental sampling sequence entries, part 94.
990. gbenv95.seq - Environmental sampling sequence entries, part 95.
991. gbenv96.seq - Environmental sampling sequence entries, part 96.
992. gbenv97.seq - Environmental sampling sequence entries, part 97.
993. gbenv98.seq - Environmental sampling sequence entries, part 98.
994. gbenv99.seq - Environmental sampling sequence entries, part 99.
995. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
996. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
997. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
998. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
999. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
1000. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
1001. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
1002. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
1003. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
1004. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
1005. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
1006. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
1007. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
1008. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
1009. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
1010. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
1011. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
1012. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
1013. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
1014. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
1015. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
1016. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
1017. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
1018. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
1019. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
1020. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
1021. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
1022. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
1023. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
1024. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
1025. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
1026. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
1027. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
1028. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
1029. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
1030. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
1031. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
1032. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
1033. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
1034. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
1035. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
1036. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
1037. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
1038. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
1039. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
1040. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
1041. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
1042. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
1043. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
1044. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
1045. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
1046. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
1047. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
1048. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
1049. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
1050. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
1051. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
1052. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
1053. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
1054. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
1055. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
1056. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
1057. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
1058. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
1059. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
1060. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
1061. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
1062. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
1063. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
1064. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
1065. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
1066. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
1067. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
1068. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
1069. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
1070. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
1071. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
1072. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
1073. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
1074. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
1075. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
1076. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
1077. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
1078. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
1079. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
1080. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
1081. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
1082. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
1083. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
1084. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
1085. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
1086. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
1087. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
1088. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
1089. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
1090. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
1091. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
1092. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
1093. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
1094. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
1095. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
1096. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
1097. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
1098. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
1099. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
1100. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
1101. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
1102. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
1103. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
1104. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
1105. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
1106. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
1107. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
1108. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
1109. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
1110. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
1111. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
1112. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
1113. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
1114. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
1115. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
1116. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
1117. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
1118. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
1119. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
1120. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
1121. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
1122. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
1123. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
1124. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
1125. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
1126. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
1127. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
1128. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
1129. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
1130. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
1131. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
1132. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
1133. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
1134. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
1135. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
1136. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
1137. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
1138. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
1139. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
1140. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
1141. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
1142. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
1143. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
1144. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
1145. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
1146. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
1147. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
1148. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
1149. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
1150. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
1151. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
1152. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
1153. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
1154. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
1155. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
1156. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
1157. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
1158. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
1159. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
1160. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
1161. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
1162. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
1163. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
1164. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
1165. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
1166. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
1167. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
1168. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
1169. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
1170. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
1171. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
1172. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
1173. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
1174. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
1175. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
1176. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
1177. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
1178. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
1179. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
1180. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
1181. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
1182. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
1183. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
1184. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
1185. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
1186. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
1187. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
1188. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
1189. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
1190. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
1191. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
1192. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
1193. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
1194. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
1195. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
1196. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
1197. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
1198. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
1199. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1200. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1201. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1202. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1203. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1204. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1205. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1206. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1207. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1208. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1209. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1210. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1211. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1212. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1213. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1214. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1215. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1216. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1217. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1218. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1219. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1220. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1221. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1222. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1223. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1224. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1225. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1226. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1227. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1228. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1229. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1230. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1231. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1232. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1233. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1234. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1235. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1236. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1237. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1238. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1239. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1240. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1241. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1242. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1243. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1244. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1245. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1246. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1247. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1248. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1249. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1250. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1251. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1252. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1253. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1254. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1255. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1256. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1257. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1258. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1259. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1260. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1261. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1262. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1263. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1264. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1265. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1266. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1267. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1268. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1269. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1270. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1271. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1272. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1273. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1274. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1275. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1276. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1277. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1278. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1279. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1280. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1281. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1282. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1283. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1284. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1285. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1286. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1287. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1288. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1289. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1290. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1291. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1292. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1293. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1294. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1295. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1296. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1297. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1298. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1299. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1300. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1301. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1302. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1303. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1304. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1305. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1306. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1307. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1308. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1309. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1310. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1311. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1312. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1313. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1314. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1315. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1316. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1317. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1318. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1319. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1320. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1321. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1322. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1323. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1324. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1325. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1326. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1327. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1328. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1329. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1330. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1331. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1332. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1333. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1334. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1335. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1336. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1337. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1338. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1339. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1340. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1341. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1342. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1343. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1344. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1345. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1346. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1347. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1348. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1349. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1350. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1351. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1352. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1353. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1354. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1355. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1356. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1357. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1358. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1359. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1360. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1361. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1362. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1363. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1364. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1365. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1366. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1367. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1368. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1369. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1370. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1371. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1372. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1373. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1374. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1375. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1376. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1377. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1378. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1379. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1380. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1381. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1382. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1383. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1384. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1385. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1386. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1387. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1388. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1389. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1390. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1391. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1392. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1393. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1394. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1395. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1396. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1397. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1398. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1399. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1400. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1401. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1402. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1403. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1404. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1405. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1406. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1407. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1408. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1409. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1410. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1411. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1412. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1413. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1414. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1415. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1416. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1417. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1418. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1419. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1420. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1421. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1422. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1423. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1424. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1425. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1426. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1427. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1428. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1429. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1430. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1431. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1432. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1433. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1434. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1435. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1436. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1437. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1438. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1439. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1440. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1441. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1442. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1443. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1444. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1445. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1446. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1447. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1448. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1449. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1450. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1451. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1452. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1453. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1454. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1455. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1456. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1457. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1458. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1459. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1460. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1461. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1462. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1463. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1464. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1465. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1466. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1467. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1468. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1469. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1470. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1471. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1472. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1473. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1474. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1475. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1476. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1477. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1478. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1479. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1480. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1481. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1482. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1483. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1484. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1485. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1486. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1487. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1488. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1489. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1490. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1491. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1492. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1493. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1494. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1495. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1496. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1497. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1498. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1499. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1500. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1501. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1502. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1503. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1504. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1505. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1506. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1507. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1508. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1509. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1510. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1511. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1512. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1513. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1514. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1515. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1516. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1517. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1518. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1519. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1520. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1521. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1522. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1523. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1524. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1525. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1526. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1527. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1528. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1529. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1530. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1531. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1532. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1533. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1534. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1535. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1536. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1537. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1538. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1539. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1540. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1541. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1542. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1543. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1544. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1545. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1546. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1547. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1548. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1549. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1550. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1551. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1552. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1553. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1554. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1555. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1556. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1557. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1558. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1559. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1560. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1561. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1562. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1563. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1564. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1565. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1566. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1567. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1568. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1569. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1570. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1571. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1572. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1573. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1574. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1575. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1576. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1577. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1578. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1579. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1580. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1581. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1582. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1583. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1584. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1585. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1586. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1587. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1588. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1589. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1590. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1591. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1592. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1593. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1594. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1595. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1596. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1597. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1598. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1599. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1600. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1601. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1602. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1603. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1604. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1605. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1606. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1607. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1608. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1609. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1610. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1611. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1612. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1613. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1614. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1615. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1616. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1617. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1618. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1619. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1620. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1621. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1622. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1623. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1624. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1625. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1626. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1627. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1628. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1629. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1630. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1631. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1632. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1633. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1634. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1635. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1636. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1637. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1638. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1639. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1640. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1641. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1642. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1643. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1644. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1645. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1646. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1647. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1648. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1649. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1650. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1651. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1652. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1653. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1654. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1655. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1656. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1657. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1658. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1659. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1660. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1661. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1662. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1663. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1664. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1665. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1666. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1667. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1668. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1669. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1670. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1671. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1672. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1673. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1674. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1675. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1676. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1677. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1678. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1679. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1680. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1681. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1682. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1683. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1684. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1685. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1686. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1687. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1688. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1689. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1690. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1691. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1692. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1693. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1694. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1695. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1696. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1697. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1698. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1699. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1700. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1701. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1702. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1703. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1704. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1705. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1706. gbgss302.seq - GSS (genome survey sequence) sequence entries, part 302.
1707. gbgss303.seq - GSS (genome survey sequence) sequence entries, part 303.
1708. gbgss304.seq - GSS (genome survey sequence) sequence entries, part 304.
1709. gbgss305.seq - GSS (genome survey sequence) sequence entries, part 305.
1710. gbgss306.seq - GSS (genome survey sequence) sequence entries, part 306.
1711. gbgss307.seq - GSS (genome survey sequence) sequence entries, part 307.
1712. gbgss308.seq - GSS (genome survey sequence) sequence entries, part 308.
1713. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1714. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1715. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1716. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1717. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1718. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1719. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1720. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1721. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1722. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1723. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1724. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1725. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1726. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1727. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1728. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1729. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1730. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1731. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1732. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1733. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1734. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1735. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1736. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1737. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1738. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1739. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1740. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1741. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1742. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1743. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1744. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1745. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1746. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1747. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1748. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1749. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1750. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1751. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1752. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1753. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1754. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1755. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1756. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1757. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1758. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1759. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1760. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1761. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1762. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1763. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1764. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1765. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1766. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1767. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1768. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1769. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1770. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1771. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1772. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1773. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1774. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1775. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1776. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1777. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1778. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1779. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1780. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1781. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1782. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1783. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1784. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1785. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1786. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1787. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1788. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1789. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1790. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1791. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1792. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1793. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1794. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1795. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1796. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1797. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1798. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1799. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1800. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1801. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1802. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1803. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1804. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1805. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1806. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1807. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1808. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1809. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1810. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1811. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1812. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1813. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1814. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1815. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1816. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1817. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1818. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1819. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1820. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1821. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1822. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1823. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1824. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1825. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1826. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1827. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1828. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1829. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1830. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1831. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1832. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1833. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1834. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1835. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1836. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1837. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1838. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1839. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1840. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1841. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1842. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1843. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1844. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1845. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1846. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1847. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1848. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1849. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1850. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1851. gbhtg142.seq - HTGS (high throughput genomic sequencing) sequence entries, part 142.
1852. gbhtg143.seq - HTGS (high throughput genomic sequencing) sequence entries, part 143.
1853. gbhtg144.seq - HTGS (high throughput genomic sequencing) sequence entries, part 144.
1854. gbhtg145.seq - HTGS (high throughput genomic sequencing) sequence entries, part 145.
1855. gbhtg146.seq - HTGS (high throughput genomic sequencing) sequence entries, part 146.
1856. gbhtg147.seq - HTGS (high throughput genomic sequencing) sequence entries, part 147.
1857. gbhtg148.seq - HTGS (high throughput genomic sequencing) sequence entries, part 148.
1858. gbhtg149.seq - HTGS (high throughput genomic sequencing) sequence entries, part 149.
1859. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1860. gbhtg150.seq - HTGS (high throughput genomic sequencing) sequence entries, part 150.
1861. gbhtg151.seq - HTGS (high throughput genomic sequencing) sequence entries, part 151.
1862. gbhtg152.seq - HTGS (high throughput genomic sequencing) sequence entries, part 152.
1863. gbhtg153.seq - HTGS (high throughput genomic sequencing) sequence entries, part 153.
1864. gbhtg154.seq - HTGS (high throughput genomic sequencing) sequence entries, part 154.
1865. gbhtg155.seq - HTGS (high throughput genomic sequencing) sequence entries, part 155.
1866. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1867. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1868. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1869. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1870. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1871. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1872. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1873. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1874. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1875. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1876. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1877. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1878. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1879. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1880. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1881. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1882. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1883. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1884. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1885. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1886. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1887. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1888. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1889. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1890. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1891. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1892. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1893. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1894. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1895. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1896. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1897. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1898. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1899. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1900. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1901. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1902. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1903. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1904. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1905. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1906. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1907. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1908. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1909. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1910. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1911. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1912. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1913. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1914. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1915. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1916. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1917. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1918. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1919. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1920. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1921. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1922. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1923. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1924. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1925. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1926. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1927. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1928. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1929. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1930. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1931. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1932. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1933. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1934. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1935. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1936. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1937. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1938. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1939. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1940. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1941. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1942. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1943. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1944. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1945. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1946. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1947. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1948. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1949. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1950. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1951. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1952. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1953. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1954. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1955. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1956. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1957. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1958. gbinv1.seq - Invertebrate sequence entries, part 1.
1959. gbinv10.seq - Invertebrate sequence entries, part 10.
1960. gbinv100.seq - Invertebrate sequence entries, part 100.
1961. gbinv101.seq - Invertebrate sequence entries, part 101.
1962. gbinv102.seq - Invertebrate sequence entries, part 102.
1963. gbinv103.seq - Invertebrate sequence entries, part 103.
1964. gbinv104.seq - Invertebrate sequence entries, part 104.
1965. gbinv105.seq - Invertebrate sequence entries, part 105.
1966. gbinv106.seq - Invertebrate sequence entries, part 106.
1967. gbinv107.seq - Invertebrate sequence entries, part 107.
1968. gbinv108.seq - Invertebrate sequence entries, part 108.
1969. gbinv11.seq - Invertebrate sequence entries, part 11.
1970. gbinv12.seq - Invertebrate sequence entries, part 12.
1971. gbinv13.seq - Invertebrate sequence entries, part 13.
1972. gbinv14.seq - Invertebrate sequence entries, part 14.
1973. gbinv15.seq - Invertebrate sequence entries, part 15.
1974. gbinv16.seq - Invertebrate sequence entries, part 16.
1975. gbinv17.seq - Invertebrate sequence entries, part 17.
1976. gbinv18.seq - Invertebrate sequence entries, part 18.
1977. gbinv19.seq - Invertebrate sequence entries, part 19.
1978. gbinv2.seq - Invertebrate sequence entries, part 2.
1979. gbinv20.seq - Invertebrate sequence entries, part 20.
1980. gbinv21.seq - Invertebrate sequence entries, part 21.
1981. gbinv22.seq - Invertebrate sequence entries, part 22.
1982. gbinv23.seq - Invertebrate sequence entries, part 23.
1983. gbinv24.seq - Invertebrate sequence entries, part 24.
1984. gbinv25.seq - Invertebrate sequence entries, part 25.
1985. gbinv26.seq - Invertebrate sequence entries, part 26.
1986. gbinv27.seq - Invertebrate sequence entries, part 27.
1987. gbinv28.seq - Invertebrate sequence entries, part 28.
1988. gbinv29.seq - Invertebrate sequence entries, part 29.
1989. gbinv3.seq - Invertebrate sequence entries, part 3.
1990. gbinv30.seq - Invertebrate sequence entries, part 30.
1991. gbinv31.seq - Invertebrate sequence entries, part 31.
1992. gbinv32.seq - Invertebrate sequence entries, part 32.
1993. gbinv33.seq - Invertebrate sequence entries, part 33.
1994. gbinv34.seq - Invertebrate sequence entries, part 34.
1995. gbinv35.seq - Invertebrate sequence entries, part 35.
1996. gbinv36.seq - Invertebrate sequence entries, part 36.
1997. gbinv37.seq - Invertebrate sequence entries, part 37.
1998. gbinv38.seq - Invertebrate sequence entries, part 38.
1999. gbinv39.seq - Invertebrate sequence entries, part 39.
2000. gbinv4.seq - Invertebrate sequence entries, part 4.
2001. gbinv40.seq - Invertebrate sequence entries, part 40.
2002. gbinv41.seq - Invertebrate sequence entries, part 41.
2003. gbinv42.seq - Invertebrate sequence entries, part 42.
2004. gbinv43.seq - Invertebrate sequence entries, part 43.
2005. gbinv44.seq - Invertebrate sequence entries, part 44.
2006. gbinv45.seq - Invertebrate sequence entries, part 45.
2007. gbinv46.seq - Invertebrate sequence entries, part 46.
2008. gbinv47.seq - Invertebrate sequence entries, part 47.
2009. gbinv48.seq - Invertebrate sequence entries, part 48.
2010. gbinv49.seq - Invertebrate sequence entries, part 49.
2011. gbinv5.seq - Invertebrate sequence entries, part 5.
2012. gbinv50.seq - Invertebrate sequence entries, part 50.
2013. gbinv51.seq - Invertebrate sequence entries, part 51.
2014. gbinv52.seq - Invertebrate sequence entries, part 52.
2015. gbinv53.seq - Invertebrate sequence entries, part 53.
2016. gbinv54.seq - Invertebrate sequence entries, part 54.
2017. gbinv55.seq - Invertebrate sequence entries, part 55.
2018. gbinv56.seq - Invertebrate sequence entries, part 56.
2019. gbinv57.seq - Invertebrate sequence entries, part 57.
2020. gbinv58.seq - Invertebrate sequence entries, part 58.
2021. gbinv59.seq - Invertebrate sequence entries, part 59.
2022. gbinv6.seq - Invertebrate sequence entries, part 6.
2023. gbinv60.seq - Invertebrate sequence entries, part 60.
2024. gbinv61.seq - Invertebrate sequence entries, part 61.
2025. gbinv62.seq - Invertebrate sequence entries, part 62.
2026. gbinv63.seq - Invertebrate sequence entries, part 63.
2027. gbinv64.seq - Invertebrate sequence entries, part 64.
2028. gbinv65.seq - Invertebrate sequence entries, part 65.
2029. gbinv66.seq - Invertebrate sequence entries, part 66.
2030. gbinv67.seq - Invertebrate sequence entries, part 67.
2031. gbinv68.seq - Invertebrate sequence entries, part 68.
2032. gbinv69.seq - Invertebrate sequence entries, part 69.
2033. gbinv7.seq - Invertebrate sequence entries, part 7.
2034. gbinv70.seq - Invertebrate sequence entries, part 70.
2035. gbinv71.seq - Invertebrate sequence entries, part 71.
2036. gbinv72.seq - Invertebrate sequence entries, part 72.
2037. gbinv73.seq - Invertebrate sequence entries, part 73.
2038. gbinv74.seq - Invertebrate sequence entries, part 74.
2039. gbinv75.seq - Invertebrate sequence entries, part 75.
2040. gbinv76.seq - Invertebrate sequence entries, part 76.
2041. gbinv77.seq - Invertebrate sequence entries, part 77.
2042. gbinv78.seq - Invertebrate sequence entries, part 78.
2043. gbinv79.seq - Invertebrate sequence entries, part 79.
2044. gbinv8.seq - Invertebrate sequence entries, part 8.
2045. gbinv80.seq - Invertebrate sequence entries, part 80.
2046. gbinv81.seq - Invertebrate sequence entries, part 81.
2047. gbinv82.seq - Invertebrate sequence entries, part 82.
2048. gbinv83.seq - Invertebrate sequence entries, part 83.
2049. gbinv84.seq - Invertebrate sequence entries, part 84.
2050. gbinv85.seq - Invertebrate sequence entries, part 85.
2051. gbinv86.seq - Invertebrate sequence entries, part 86.
2052. gbinv87.seq - Invertebrate sequence entries, part 87.
2053. gbinv88.seq - Invertebrate sequence entries, part 88.
2054. gbinv89.seq - Invertebrate sequence entries, part 89.
2055. gbinv9.seq - Invertebrate sequence entries, part 9.
2056. gbinv90.seq - Invertebrate sequence entries, part 90.
2057. gbinv91.seq - Invertebrate sequence entries, part 91.
2058. gbinv92.seq - Invertebrate sequence entries, part 92.
2059. gbinv93.seq - Invertebrate sequence entries, part 93.
2060. gbinv94.seq - Invertebrate sequence entries, part 94.
2061. gbinv95.seq - Invertebrate sequence entries, part 95.
2062. gbinv96.seq - Invertebrate sequence entries, part 96.
2063. gbinv97.seq - Invertebrate sequence entries, part 97.
2064. gbinv98.seq - Invertebrate sequence entries, part 98.
2065. gbinv99.seq - Invertebrate sequence entries, part 99.
2066. gbmam1.seq - Other mammalian sequence entries, part 1.
2067. gbmam10.seq - Other mammalian sequence entries, part 10.
2068. gbmam11.seq - Other mammalian sequence entries, part 11.
2069. gbmam12.seq - Other mammalian sequence entries, part 12.
2070. gbmam13.seq - Other mammalian sequence entries, part 13.
2071. gbmam14.seq - Other mammalian sequence entries, part 14.
2072. gbmam15.seq - Other mammalian sequence entries, part 15.
2073. gbmam16.seq - Other mammalian sequence entries, part 16.
2074. gbmam17.seq - Other mammalian sequence entries, part 17.
2075. gbmam18.seq - Other mammalian sequence entries, part 18.
2076. gbmam19.seq - Other mammalian sequence entries, part 19.
2077. gbmam2.seq - Other mammalian sequence entries, part 2.
2078. gbmam20.seq - Other mammalian sequence entries, part 20.
2079. gbmam21.seq - Other mammalian sequence entries, part 21.
2080. gbmam22.seq - Other mammalian sequence entries, part 22.
2081. gbmam23.seq - Other mammalian sequence entries, part 23.
2082. gbmam24.seq - Other mammalian sequence entries, part 24.
2083. gbmam25.seq - Other mammalian sequence entries, part 25.
2084. gbmam26.seq - Other mammalian sequence entries, part 26.
2085. gbmam27.seq - Other mammalian sequence entries, part 27.
2086. gbmam28.seq - Other mammalian sequence entries, part 28.
2087. gbmam29.seq - Other mammalian sequence entries, part 29.
2088. gbmam3.seq - Other mammalian sequence entries, part 3.
2089. gbmam30.seq - Other mammalian sequence entries, part 30.
2090. gbmam31.seq - Other mammalian sequence entries, part 31.
2091. gbmam32.seq - Other mammalian sequence entries, part 32.
2092. gbmam33.seq - Other mammalian sequence entries, part 33.
2093. gbmam34.seq - Other mammalian sequence entries, part 34.
2094. gbmam35.seq - Other mammalian sequence entries, part 35.
2095. gbmam36.seq - Other mammalian sequence entries, part 36.
2096. gbmam37.seq - Other mammalian sequence entries, part 37.
2097. gbmam38.seq - Other mammalian sequence entries, part 38.
2098. gbmam39.seq - Other mammalian sequence entries, part 39.
2099. gbmam4.seq - Other mammalian sequence entries, part 4.
2100. gbmam40.seq - Other mammalian sequence entries, part 40.
2101. gbmam41.seq - Other mammalian sequence entries, part 41.
2102. gbmam42.seq - Other mammalian sequence entries, part 42.
2103. gbmam43.seq - Other mammalian sequence entries, part 43.
2104. gbmam44.seq - Other mammalian sequence entries, part 44.
2105. gbmam45.seq - Other mammalian sequence entries, part 45.
2106. gbmam46.seq - Other mammalian sequence entries, part 46.
2107. gbmam47.seq - Other mammalian sequence entries, part 47.
2108. gbmam48.seq - Other mammalian sequence entries, part 48.
2109. gbmam49.seq - Other mammalian sequence entries, part 49.
2110. gbmam5.seq - Other mammalian sequence entries, part 5.
2111. gbmam50.seq - Other mammalian sequence entries, part 50.
2112. gbmam51.seq - Other mammalian sequence entries, part 51.
2113. gbmam52.seq - Other mammalian sequence entries, part 52.
2114. gbmam53.seq - Other mammalian sequence entries, part 53.
2115. gbmam54.seq - Other mammalian sequence entries, part 54.
2116. gbmam55.seq - Other mammalian sequence entries, part 55.
2117. gbmam6.seq - Other mammalian sequence entries, part 6.
2118. gbmam7.seq - Other mammalian sequence entries, part 7.
2119. gbmam8.seq - Other mammalian sequence entries, part 8.
2120. gbmam9.seq - Other mammalian sequence entries, part 9.
2121. gbnew.txt - Accession numbers of entries new since the previous release.
2122. gbpat1.seq - Patent sequence entries, part 1.
2123. gbpat10.seq - Patent sequence entries, part 10.
2124. gbpat100.seq - Patent sequence entries, part 100.
2125. gbpat101.seq - Patent sequence entries, part 101.
2126. gbpat102.seq - Patent sequence entries, part 102.
2127. gbpat103.seq - Patent sequence entries, part 103.
2128. gbpat104.seq - Patent sequence entries, part 104.
2129. gbpat105.seq - Patent sequence entries, part 105.
2130. gbpat106.seq - Patent sequence entries, part 106.
2131. gbpat107.seq - Patent sequence entries, part 107.
2132. gbpat108.seq - Patent sequence entries, part 108.
2133. gbpat109.seq - Patent sequence entries, part 109.
2134. gbpat11.seq - Patent sequence entries, part 11.
2135. gbpat110.seq - Patent sequence entries, part 110.
2136. gbpat111.seq - Patent sequence entries, part 111.
2137. gbpat112.seq - Patent sequence entries, part 112.
2138. gbpat113.seq - Patent sequence entries, part 113.
2139. gbpat114.seq - Patent sequence entries, part 114.
2140. gbpat115.seq - Patent sequence entries, part 115.
2141. gbpat116.seq - Patent sequence entries, part 116.
2142. gbpat117.seq - Patent sequence entries, part 117.
2143. gbpat118.seq - Patent sequence entries, part 118.
2144. gbpat119.seq - Patent sequence entries, part 119.
2145. gbpat12.seq - Patent sequence entries, part 12.
2146. gbpat120.seq - Patent sequence entries, part 120.
2147. gbpat121.seq - Patent sequence entries, part 121.
2148. gbpat122.seq - Patent sequence entries, part 122.
2149. gbpat123.seq - Patent sequence entries, part 123.
2150. gbpat124.seq - Patent sequence entries, part 124.
2151. gbpat125.seq - Patent sequence entries, part 125.
2152. gbpat126.seq - Patent sequence entries, part 126.
2153. gbpat127.seq - Patent sequence entries, part 127.
2154. gbpat128.seq - Patent sequence entries, part 128.
2155. gbpat129.seq - Patent sequence entries, part 129.
2156. gbpat13.seq - Patent sequence entries, part 13.
2157. gbpat130.seq - Patent sequence entries, part 130.
2158. gbpat131.seq - Patent sequence entries, part 131.
2159. gbpat132.seq - Patent sequence entries, part 132.
2160. gbpat133.seq - Patent sequence entries, part 133.
2161. gbpat134.seq - Patent sequence entries, part 134.
2162. gbpat135.seq - Patent sequence entries, part 135.
2163. gbpat136.seq - Patent sequence entries, part 136.
2164. gbpat137.seq - Patent sequence entries, part 137.
2165. gbpat138.seq - Patent sequence entries, part 138.
2166. gbpat139.seq - Patent sequence entries, part 139.
2167. gbpat14.seq - Patent sequence entries, part 14.
2168. gbpat140.seq - Patent sequence entries, part 140.
2169. gbpat141.seq - Patent sequence entries, part 141.
2170. gbpat142.seq - Patent sequence entries, part 142.
2171. gbpat143.seq - Patent sequence entries, part 143.
2172. gbpat144.seq - Patent sequence entries, part 144.
2173. gbpat145.seq - Patent sequence entries, part 145.
2174. gbpat146.seq - Patent sequence entries, part 146.
2175. gbpat147.seq - Patent sequence entries, part 147.
2176. gbpat148.seq - Patent sequence entries, part 148.
2177. gbpat149.seq - Patent sequence entries, part 149.
2178. gbpat15.seq - Patent sequence entries, part 15.
2179. gbpat150.seq - Patent sequence entries, part 150.
2180. gbpat151.seq - Patent sequence entries, part 151.
2181. gbpat152.seq - Patent sequence entries, part 152.
2182. gbpat153.seq - Patent sequence entries, part 153.
2183. gbpat154.seq - Patent sequence entries, part 154.
2184. gbpat155.seq - Patent sequence entries, part 155.
2185. gbpat156.seq - Patent sequence entries, part 156.
2186. gbpat157.seq - Patent sequence entries, part 157.
2187. gbpat158.seq - Patent sequence entries, part 158.
2188. gbpat159.seq - Patent sequence entries, part 159.
2189. gbpat16.seq - Patent sequence entries, part 16.
2190. gbpat160.seq - Patent sequence entries, part 160.
2191. gbpat161.seq - Patent sequence entries, part 161.
2192. gbpat162.seq - Patent sequence entries, part 162.
2193. gbpat163.seq - Patent sequence entries, part 163.
2194. gbpat164.seq - Patent sequence entries, part 164.
2195. gbpat165.seq - Patent sequence entries, part 165.
2196. gbpat166.seq - Patent sequence entries, part 166.
2197. gbpat167.seq - Patent sequence entries, part 167.
2198. gbpat168.seq - Patent sequence entries, part 168.
2199. gbpat169.seq - Patent sequence entries, part 169.
2200. gbpat17.seq - Patent sequence entries, part 17.
2201. gbpat170.seq - Patent sequence entries, part 170.
2202. gbpat171.seq - Patent sequence entries, part 171.
2203. gbpat172.seq - Patent sequence entries, part 172.
2204. gbpat173.seq - Patent sequence entries, part 173.
2205. gbpat174.seq - Patent sequence entries, part 174.
2206. gbpat175.seq - Patent sequence entries, part 175.
2207. gbpat176.seq - Patent sequence entries, part 176.
2208. gbpat177.seq - Patent sequence entries, part 177.
2209. gbpat178.seq - Patent sequence entries, part 178.
2210. gbpat179.seq - Patent sequence entries, part 179.
2211. gbpat18.seq - Patent sequence entries, part 18.
2212. gbpat180.seq - Patent sequence entries, part 180.
2213. gbpat181.seq - Patent sequence entries, part 181.
2214. gbpat182.seq - Patent sequence entries, part 182.
2215. gbpat183.seq - Patent sequence entries, part 183.
2216. gbpat184.seq - Patent sequence entries, part 184.
2217. gbpat185.seq - Patent sequence entries, part 185.
2218. gbpat186.seq - Patent sequence entries, part 186.
2219. gbpat187.seq - Patent sequence entries, part 187.
2220. gbpat188.seq - Patent sequence entries, part 188.
2221. gbpat189.seq - Patent sequence entries, part 189.
2222. gbpat19.seq - Patent sequence entries, part 19.
2223. gbpat190.seq - Patent sequence entries, part 190.
2224. gbpat191.seq - Patent sequence entries, part 191.
2225. gbpat192.seq - Patent sequence entries, part 192.
2226. gbpat193.seq - Patent sequence entries, part 193.
2227. gbpat194.seq - Patent sequence entries, part 194.
2228. gbpat195.seq - Patent sequence entries, part 195.
2229. gbpat196.seq - Patent sequence entries, part 196.
2230. gbpat197.seq - Patent sequence entries, part 197.
2231. gbpat198.seq - Patent sequence entries, part 198.
2232. gbpat199.seq - Patent sequence entries, part 199.
2233. gbpat2.seq - Patent sequence entries, part 2.
2234. gbpat20.seq - Patent sequence entries, part 20.
2235. gbpat200.seq - Patent sequence entries, part 200.
2236. gbpat201.seq - Patent sequence entries, part 201.
2237. gbpat202.seq - Patent sequence entries, part 202.
2238. gbpat203.seq - Patent sequence entries, part 203.
2239. gbpat204.seq - Patent sequence entries, part 204.
2240. gbpat205.seq - Patent sequence entries, part 205.
2241. gbpat206.seq - Patent sequence entries, part 206.
2242. gbpat207.seq - Patent sequence entries, part 207.
2243. gbpat208.seq - Patent sequence entries, part 208.
2244. gbpat209.seq - Patent sequence entries, part 209.
2245. gbpat21.seq - Patent sequence entries, part 21.
2246. gbpat210.seq - Patent sequence entries, part 210.
2247. gbpat211.seq - Patent sequence entries, part 211.
2248. gbpat212.seq - Patent sequence entries, part 212.
2249. gbpat213.seq - Patent sequence entries, part 213.
2250. gbpat214.seq - Patent sequence entries, part 214.
2251. gbpat215.seq - Patent sequence entries, part 215.
2252. gbpat216.seq - Patent sequence entries, part 216.
2253. gbpat217.seq - Patent sequence entries, part 217.
2254. gbpat218.seq - Patent sequence entries, part 218.
2255. gbpat219.seq - Patent sequence entries, part 219.
2256. gbpat22.seq - Patent sequence entries, part 22.
2257. gbpat220.seq - Patent sequence entries, part 220.
2258. gbpat221.seq - Patent sequence entries, part 221.
2259. gbpat222.seq - Patent sequence entries, part 222.
2260. gbpat223.seq - Patent sequence entries, part 223.
2261. gbpat224.seq - Patent sequence entries, part 224.
2262. gbpat225.seq - Patent sequence entries, part 225.
2263. gbpat226.seq - Patent sequence entries, part 226.
2264. gbpat227.seq - Patent sequence entries, part 227.
2265. gbpat228.seq - Patent sequence entries, part 228.
2266. gbpat229.seq - Patent sequence entries, part 229.
2267. gbpat23.seq - Patent sequence entries, part 23.
2268. gbpat230.seq - Patent sequence entries, part 230.
2269. gbpat231.seq - Patent sequence entries, part 231.
2270. gbpat232.seq - Patent sequence entries, part 232.
2271. gbpat233.seq - Patent sequence entries, part 233.
2272. gbpat234.seq - Patent sequence entries, part 234.
2273. gbpat235.seq - Patent sequence entries, part 235.
2274. gbpat236.seq - Patent sequence entries, part 236.
2275. gbpat237.seq - Patent sequence entries, part 237.
2276. gbpat238.seq - Patent sequence entries, part 238.
2277. gbpat239.seq - Patent sequence entries, part 239.
2278. gbpat24.seq - Patent sequence entries, part 24.
2279. gbpat240.seq - Patent sequence entries, part 240.
2280. gbpat241.seq - Patent sequence entries, part 241.
2281. gbpat242.seq - Patent sequence entries, part 242.
2282. gbpat243.seq - Patent sequence entries, part 243.
2283. gbpat244.seq - Patent sequence entries, part 244.
2284. gbpat245.seq - Patent sequence entries, part 245.
2285. gbpat246.seq - Patent sequence entries, part 246.
2286. gbpat247.seq - Patent sequence entries, part 247.
2287. gbpat248.seq - Patent sequence entries, part 248.
2288. gbpat249.seq - Patent sequence entries, part 249.
2289. gbpat25.seq - Patent sequence entries, part 25.
2290. gbpat250.seq - Patent sequence entries, part 250.
2291. gbpat251.seq - Patent sequence entries, part 251.
2292. gbpat252.seq - Patent sequence entries, part 252.
2293. gbpat253.seq - Patent sequence entries, part 253.
2294. gbpat254.seq - Patent sequence entries, part 254.
2295. gbpat255.seq - Patent sequence entries, part 255.
2296. gbpat256.seq - Patent sequence entries, part 256.
2297. gbpat257.seq - Patent sequence entries, part 257.
2298. gbpat258.seq - Patent sequence entries, part 258.
2299. gbpat259.seq - Patent sequence entries, part 259.
2300. gbpat26.seq - Patent sequence entries, part 26.
2301. gbpat260.seq - Patent sequence entries, part 260.
2302. gbpat261.seq - Patent sequence entries, part 261.
2303. gbpat262.seq - Patent sequence entries, part 262.
2304. gbpat263.seq - Patent sequence entries, part 263.
2305. gbpat264.seq - Patent sequence entries, part 264.
2306. gbpat265.seq - Patent sequence entries, part 265.
2307. gbpat266.seq - Patent sequence entries, part 266.
2308. gbpat267.seq - Patent sequence entries, part 267.
2309. gbpat268.seq - Patent sequence entries, part 268.
2310. gbpat269.seq - Patent sequence entries, part 269.
2311. gbpat27.seq - Patent sequence entries, part 27.
2312. gbpat270.seq - Patent sequence entries, part 270.
2313. gbpat271.seq - Patent sequence entries, part 271.
2314. gbpat272.seq - Patent sequence entries, part 272.
2315. gbpat273.seq - Patent sequence entries, part 273.
2316. gbpat274.seq - Patent sequence entries, part 274.
2317. gbpat275.seq - Patent sequence entries, part 275.
2318. gbpat276.seq - Patent sequence entries, part 276.
2319. gbpat277.seq - Patent sequence entries, part 277.
2320. gbpat278.seq - Patent sequence entries, part 278.
2321. gbpat279.seq - Patent sequence entries, part 279.
2322. gbpat28.seq - Patent sequence entries, part 28.
2323. gbpat280.seq - Patent sequence entries, part 280.
2324. gbpat281.seq - Patent sequence entries, part 281.
2325. gbpat282.seq - Patent sequence entries, part 282.
2326. gbpat283.seq - Patent sequence entries, part 283.
2327. gbpat284.seq - Patent sequence entries, part 284.
2328. gbpat285.seq - Patent sequence entries, part 285.
2329. gbpat286.seq - Patent sequence entries, part 286.
2330. gbpat287.seq - Patent sequence entries, part 287.
2331. gbpat288.seq - Patent sequence entries, part 288.
2332. gbpat289.seq - Patent sequence entries, part 289.
2333. gbpat29.seq - Patent sequence entries, part 29.
2334. gbpat290.seq - Patent sequence entries, part 290.
2335. gbpat291.seq - Patent sequence entries, part 291.
2336. gbpat292.seq - Patent sequence entries, part 292.
2337. gbpat293.seq - Patent sequence entries, part 293.
2338. gbpat294.seq - Patent sequence entries, part 294.
2339. gbpat295.seq - Patent sequence entries, part 295.
2340. gbpat296.seq - Patent sequence entries, part 296.
2341. gbpat297.seq - Patent sequence entries, part 297.
2342. gbpat298.seq - Patent sequence entries, part 298.
2343. gbpat299.seq - Patent sequence entries, part 299.
2344. gbpat3.seq - Patent sequence entries, part 3.
2345. gbpat30.seq - Patent sequence entries, part 30.
2346. gbpat300.seq - Patent sequence entries, part 300.
2347. gbpat301.seq - Patent sequence entries, part 301.
2348. gbpat302.seq - Patent sequence entries, part 302.
2349. gbpat303.seq - Patent sequence entries, part 303.
2350. gbpat304.seq - Patent sequence entries, part 304.
2351. gbpat305.seq - Patent sequence entries, part 305.
2352. gbpat306.seq - Patent sequence entries, part 306.
2353. gbpat307.seq - Patent sequence entries, part 307.
2354. gbpat308.seq - Patent sequence entries, part 308.
2355. gbpat309.seq - Patent sequence entries, part 309.
2356. gbpat31.seq - Patent sequence entries, part 31.
2357. gbpat310.seq - Patent sequence entries, part 310.
2358. gbpat311.seq - Patent sequence entries, part 311.
2359. gbpat312.seq - Patent sequence entries, part 312.
2360. gbpat313.seq - Patent sequence entries, part 313.
2361. gbpat314.seq - Patent sequence entries, part 314.
2362. gbpat315.seq - Patent sequence entries, part 315.
2363. gbpat316.seq - Patent sequence entries, part 316.
2364. gbpat317.seq - Patent sequence entries, part 317.
2365. gbpat318.seq - Patent sequence entries, part 318.
2366. gbpat319.seq - Patent sequence entries, part 319.
2367. gbpat32.seq - Patent sequence entries, part 32.
2368. gbpat320.seq - Patent sequence entries, part 320.
2369. gbpat321.seq - Patent sequence entries, part 321.
2370. gbpat322.seq - Patent sequence entries, part 322.
2371. gbpat323.seq - Patent sequence entries, part 323.
2372. gbpat324.seq - Patent sequence entries, part 324.
2373. gbpat325.seq - Patent sequence entries, part 325.
2374. gbpat326.seq - Patent sequence entries, part 326.
2375. gbpat327.seq - Patent sequence entries, part 327.
2376. gbpat328.seq - Patent sequence entries, part 328.
2377. gbpat329.seq - Patent sequence entries, part 329.
2378. gbpat33.seq - Patent sequence entries, part 33.
2379. gbpat330.seq - Patent sequence entries, part 330.
2380. gbpat331.seq - Patent sequence entries, part 331.
2381. gbpat332.seq - Patent sequence entries, part 332.
2382. gbpat333.seq - Patent sequence entries, part 333.
2383. gbpat334.seq - Patent sequence entries, part 334.
2384. gbpat335.seq - Patent sequence entries, part 335.
2385. gbpat336.seq - Patent sequence entries, part 336.
2386. gbpat337.seq - Patent sequence entries, part 337.
2387. gbpat34.seq - Patent sequence entries, part 34.
2388. gbpat35.seq - Patent sequence entries, part 35.
2389. gbpat36.seq - Patent sequence entries, part 36.
2390. gbpat37.seq - Patent sequence entries, part 37.
2391. gbpat38.seq - Patent sequence entries, part 38.
2392. gbpat39.seq - Patent sequence entries, part 39.
2393. gbpat4.seq - Patent sequence entries, part 4.
2394. gbpat40.seq - Patent sequence entries, part 40.
2395. gbpat41.seq - Patent sequence entries, part 41.
2396. gbpat42.seq - Patent sequence entries, part 42.
2397. gbpat43.seq - Patent sequence entries, part 43.
2398. gbpat44.seq - Patent sequence entries, part 44.
2399. gbpat45.seq - Patent sequence entries, part 45.
2400. gbpat46.seq - Patent sequence entries, part 46.
2401. gbpat47.seq - Patent sequence entries, part 47.
2402. gbpat48.seq - Patent sequence entries, part 48.
2403. gbpat49.seq - Patent sequence entries, part 49.
2404. gbpat5.seq - Patent sequence entries, part 5.
2405. gbpat50.seq - Patent sequence entries, part 50.
2406. gbpat51.seq - Patent sequence entries, part 51.
2407. gbpat52.seq - Patent sequence entries, part 52.
2408. gbpat53.seq - Patent sequence entries, part 53.
2409. gbpat54.seq - Patent sequence entries, part 54.
2410. gbpat55.seq - Patent sequence entries, part 55.
2411. gbpat56.seq - Patent sequence entries, part 56.
2412. gbpat57.seq - Patent sequence entries, part 57.
2413. gbpat58.seq - Patent sequence entries, part 58.
2414. gbpat59.seq - Patent sequence entries, part 59.
2415. gbpat6.seq - Patent sequence entries, part 6.
2416. gbpat60.seq - Patent sequence entries, part 60.
2417. gbpat61.seq - Patent sequence entries, part 61.
2418. gbpat62.seq - Patent sequence entries, part 62.
2419. gbpat63.seq - Patent sequence entries, part 63.
2420. gbpat64.seq - Patent sequence entries, part 64.
2421. gbpat65.seq - Patent sequence entries, part 65.
2422. gbpat66.seq - Patent sequence entries, part 66.
2423. gbpat67.seq - Patent sequence entries, part 67.
2424. gbpat68.seq - Patent sequence entries, part 68.
2425. gbpat69.seq - Patent sequence entries, part 69.
2426. gbpat7.seq - Patent sequence entries, part 7.
2427. gbpat70.seq - Patent sequence entries, part 70.
2428. gbpat71.seq - Patent sequence entries, part 71.
2429. gbpat72.seq - Patent sequence entries, part 72.
2430. gbpat73.seq - Patent sequence entries, part 73.
2431. gbpat74.seq - Patent sequence entries, part 74.
2432. gbpat75.seq - Patent sequence entries, part 75.
2433. gbpat76.seq - Patent sequence entries, part 76.
2434. gbpat77.seq - Patent sequence entries, part 77.
2435. gbpat78.seq - Patent sequence entries, part 78.
2436. gbpat79.seq - Patent sequence entries, part 79.
2437. gbpat8.seq - Patent sequence entries, part 8.
2438. gbpat80.seq - Patent sequence entries, part 80.
2439. gbpat81.seq - Patent sequence entries, part 81.
2440. gbpat82.seq - Patent sequence entries, part 82.
2441. gbpat83.seq - Patent sequence entries, part 83.
2442. gbpat84.seq - Patent sequence entries, part 84.
2443. gbpat85.seq - Patent sequence entries, part 85.
2444. gbpat86.seq - Patent sequence entries, part 86.
2445. gbpat87.seq - Patent sequence entries, part 87.
2446. gbpat88.seq - Patent sequence entries, part 88.
2447. gbpat89.seq - Patent sequence entries, part 89.
2448. gbpat9.seq - Patent sequence entries, part 9.
2449. gbpat90.seq - Patent sequence entries, part 90.
2450. gbpat91.seq - Patent sequence entries, part 91.
2451. gbpat92.seq - Patent sequence entries, part 92.
2452. gbpat93.seq - Patent sequence entries, part 93.
2453. gbpat94.seq - Patent sequence entries, part 94.
2454. gbpat95.seq - Patent sequence entries, part 95.
2455. gbpat96.seq - Patent sequence entries, part 96.
2456. gbpat97.seq - Patent sequence entries, part 97.
2457. gbpat98.seq - Patent sequence entries, part 98.
2458. gbpat99.seq - Patent sequence entries, part 99.
2459. gbphg1.seq - Phage sequence entries, part 1.
2460. gbphg2.seq - Phage sequence entries, part 2.
2461. gbphg3.seq - Phage sequence entries, part 3.
2462. gbphg4.seq - Phage sequence entries, part 4.
2463. gbphg5.seq - Phage sequence entries, part 5.
2464. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2465. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2466. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2467. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2468. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2469. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2470. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2471. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2472. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2473. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2474. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2475. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2476. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2477. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2478. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2479. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2480. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2481. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2482. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2483. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2484. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2485. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2486. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2487. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2488. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2489. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2490. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2491. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2492. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2493. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2494. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2495. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2496. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2497. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2498. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2499. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2500. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2501. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2502. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2503. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2504. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2505. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2506. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2507. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2508. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2509. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2510. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2511. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2512. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2513. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2514. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2515. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2516. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2517. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2518. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2519. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
2520. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2521. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
2522. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
2523. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
2524. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
2525. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
2526. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
2527. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
2528. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
2529. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
2530. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
2531. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2532. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
2533. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
2534. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
2535. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
2536. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
2537. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
2538. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
2539. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
2540. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
2541. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
2542. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2543. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
2544. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
2545. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
2546. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
2547. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
2548. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
2549. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
2550. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
2551. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
2552. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
2553. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2554. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
2555. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
2556. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
2557. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
2558. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
2559. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
2560. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
2561. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
2562. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
2563. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
2564. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2565. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
2566. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
2567. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
2568. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
2569. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
2570. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
2571. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
2572. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
2573. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
2574. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2575. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2576. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2577. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2578. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2579. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2580. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2581. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2582. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2583. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2584. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2585. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2586. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2587. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
2588. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
2589. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
2590. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
2591. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
2592. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
2593. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
2594. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
2595. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
2596. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
2597. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
2598. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
2599. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
2600. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
2601. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
2602. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
2603. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
2604. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
2605. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
2606. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
2607. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
2608. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
2609. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
2610. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
2611. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
2612. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
2613. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
2614. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
2615. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
2616. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
2617. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
2618. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
2619. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
2620. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
2621. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
2622. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
2623. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
2624. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
2625. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
2626. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
2627. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
2628. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
2629. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
2630. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
2631. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
2632. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
2633. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
2634. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
2635. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
2636. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
2637. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
2638. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
2639. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
2640. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
2641. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
2642. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
2643. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
2644. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
2645. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
2646. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
2647. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
2648. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
2649. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
2650. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
2651. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
2652. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
2653. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
2654. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
2655. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
2656. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
2657. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
2658. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
2659. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
2660. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
2661. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
2662. gbpri1.seq - Primate sequence entries, part 1.
2663. gbpri10.seq - Primate sequence entries, part 10.
2664. gbpri11.seq - Primate sequence entries, part 11.
2665. gbpri12.seq - Primate sequence entries, part 12.
2666. gbpri13.seq - Primate sequence entries, part 13.
2667. gbpri14.seq - Primate sequence entries, part 14.
2668. gbpri15.seq - Primate sequence entries, part 15.
2669. gbpri16.seq - Primate sequence entries, part 16.
2670. gbpri17.seq - Primate sequence entries, part 17.
2671. gbpri18.seq - Primate sequence entries, part 18.
2672. gbpri19.seq - Primate sequence entries, part 19.
2673. gbpri2.seq - Primate sequence entries, part 2.
2674. gbpri20.seq - Primate sequence entries, part 20.
2675. gbpri21.seq - Primate sequence entries, part 21.
2676. gbpri22.seq - Primate sequence entries, part 22.
2677. gbpri23.seq - Primate sequence entries, part 23.
2678. gbpri24.seq - Primate sequence entries, part 24.
2679. gbpri25.seq - Primate sequence entries, part 25.
2680. gbpri26.seq - Primate sequence entries, part 26.
2681. gbpri27.seq - Primate sequence entries, part 27.
2682. gbpri28.seq - Primate sequence entries, part 28.
2683. gbpri29.seq - Primate sequence entries, part 29.
2684. gbpri3.seq - Primate sequence entries, part 3.
2685. gbpri30.seq - Primate sequence entries, part 30.
2686. gbpri31.seq - Primate sequence entries, part 31.
2687. gbpri32.seq - Primate sequence entries, part 32.
2688. gbpri33.seq - Primate sequence entries, part 33.
2689. gbpri34.seq - Primate sequence entries, part 34.
2690. gbpri35.seq - Primate sequence entries, part 35.
2691. gbpri36.seq - Primate sequence entries, part 36.
2692. gbpri37.seq - Primate sequence entries, part 37.
2693. gbpri38.seq - Primate sequence entries, part 38.
2694. gbpri39.seq - Primate sequence entries, part 39.
2695. gbpri4.seq - Primate sequence entries, part 4.
2696. gbpri40.seq - Primate sequence entries, part 40.
2697. gbpri41.seq - Primate sequence entries, part 41.
2698. gbpri42.seq - Primate sequence entries, part 42.
2699. gbpri43.seq - Primate sequence entries, part 43.
2700. gbpri44.seq - Primate sequence entries, part 44.
2701. gbpri45.seq - Primate sequence entries, part 45.
2702. gbpri46.seq - Primate sequence entries, part 46.
2703. gbpri47.seq - Primate sequence entries, part 47.
2704. gbpri48.seq - Primate sequence entries, part 48.
2705. gbpri49.seq - Primate sequence entries, part 49.
2706. gbpri5.seq - Primate sequence entries, part 5.
2707. gbpri50.seq - Primate sequence entries, part 50.
2708. gbpri51.seq - Primate sequence entries, part 51.
2709. gbpri52.seq - Primate sequence entries, part 52.
2710. gbpri53.seq - Primate sequence entries, part 53.
2711. gbpri54.seq - Primate sequence entries, part 54.
2712. gbpri55.seq - Primate sequence entries, part 55.
2713. gbpri56.seq - Primate sequence entries, part 56.
2714. gbpri57.seq - Primate sequence entries, part 57.
2715. gbpri58.seq - Primate sequence entries, part 58.
2716. gbpri59.seq - Primate sequence entries, part 59.
2717. gbpri6.seq - Primate sequence entries, part 6.
2718. gbpri7.seq - Primate sequence entries, part 7.
2719. gbpri8.seq - Primate sequence entries, part 8.
2720. gbpri9.seq - Primate sequence entries, part 9.
2721. gbrel.txt - Release notes (this document).
2722. gbrod1.seq - Rodent sequence entries, part 1.
2723. gbrod10.seq - Rodent sequence entries, part 10.
2724. gbrod11.seq - Rodent sequence entries, part 11.
2725. gbrod12.seq - Rodent sequence entries, part 12.
2726. gbrod13.seq - Rodent sequence entries, part 13.
2727. gbrod14.seq - Rodent sequence entries, part 14.
2728. gbrod15.seq - Rodent sequence entries, part 15.
2729. gbrod16.seq - Rodent sequence entries, part 16.
2730. gbrod17.seq - Rodent sequence entries, part 17.
2731. gbrod18.seq - Rodent sequence entries, part 18.
2732. gbrod19.seq - Rodent sequence entries, part 19.
2733. gbrod2.seq - Rodent sequence entries, part 2.
2734. gbrod20.seq - Rodent sequence entries, part 20.
2735. gbrod21.seq - Rodent sequence entries, part 21.
2736. gbrod22.seq - Rodent sequence entries, part 22.
2737. gbrod23.seq - Rodent sequence entries, part 23.
2738. gbrod24.seq - Rodent sequence entries, part 24.
2739. gbrod25.seq - Rodent sequence entries, part 25.
2740. gbrod26.seq - Rodent sequence entries, part 26.
2741. gbrod27.seq - Rodent sequence entries, part 27.
2742. gbrod28.seq - Rodent sequence entries, part 28.
2743. gbrod29.seq - Rodent sequence entries, part 29.
2744. gbrod3.seq - Rodent sequence entries, part 3.
2745. gbrod30.seq - Rodent sequence entries, part 30.
2746. gbrod31.seq - Rodent sequence entries, part 31.
2747. gbrod4.seq - Rodent sequence entries, part 4.
2748. gbrod5.seq - Rodent sequence entries, part 5.
2749. gbrod6.seq - Rodent sequence entries, part 6.
2750. gbrod7.seq - Rodent sequence entries, part 7.
2751. gbrod8.seq - Rodent sequence entries, part 8.
2752. gbrod9.seq - Rodent sequence entries, part 9.
2753. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
2754. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
2755. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
2756. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
2757. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
2758. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
2759. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
2760. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
2761. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
2762. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
2763. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
2764. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
2765. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
2766. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
2767. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
2768. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
2769. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
2770. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
2771. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
2772. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
2773. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
2774. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
2775. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
2776. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
2777. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
2778. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
2779. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
2780. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
2781. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
2782. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
2783. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
2784. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
2785. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
2786. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
2787. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
2788. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
2789. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
2790. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
2791. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
2792. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
2793. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
2794. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
2795. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
2796. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
2797. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
2798. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2799. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2800. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2801. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2802. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2803. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2804. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2805. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2806. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2807. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2808. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2809. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2810. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2811. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2812. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2813. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2814. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2815. gbtsa128.seq - TSA (transcriptome shotgun assembly) sequence entries, part 128.
2816. gbtsa129.seq - TSA (transcriptome shotgun assembly) sequence entries, part 129.
2817. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2818. gbtsa130.seq - TSA (transcriptome shotgun assembly) sequence entries, part 130.
2819. gbtsa131.seq - TSA (transcriptome shotgun assembly) sequence entries, part 131.
2820. gbtsa132.seq - TSA (transcriptome shotgun assembly) sequence entries, part 132.
2821. gbtsa133.seq - TSA (transcriptome shotgun assembly) sequence entries, part 133.
2822. gbtsa134.seq - TSA (transcriptome shotgun assembly) sequence entries, part 134.
2823. gbtsa135.seq - TSA (transcriptome shotgun assembly) sequence entries, part 135.
2824. gbtsa136.seq - TSA (transcriptome shotgun assembly) sequence entries, part 136.
2825. gbtsa137.seq - TSA (transcriptome shotgun assembly) sequence entries, part 137.
2826. gbtsa138.seq - TSA (transcriptome shotgun assembly) sequence entries, part 138.
2827. gbtsa139.seq - TSA (transcriptome shotgun assembly) sequence entries, part 139.
2828. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2829. gbtsa140.seq - TSA (transcriptome shotgun assembly) sequence entries, part 140.
2830. gbtsa141.seq - TSA (transcriptome shotgun assembly) sequence entries, part 141.
2831. gbtsa142.seq - TSA (transcriptome shotgun assembly) sequence entries, part 142.
2832. gbtsa143.seq - TSA (transcriptome shotgun assembly) sequence entries, part 143.
2833. gbtsa144.seq - TSA (transcriptome shotgun assembly) sequence entries, part 144.
2834. gbtsa145.seq - TSA (transcriptome shotgun assembly) sequence entries, part 145.
2835. gbtsa146.seq - TSA (transcriptome shotgun assembly) sequence entries, part 146.
2836. gbtsa147.seq - TSA (transcriptome shotgun assembly) sequence entries, part 147.
2837. gbtsa148.seq - TSA (transcriptome shotgun assembly) sequence entries, part 148.
2838. gbtsa149.seq - TSA (transcriptome shotgun assembly) sequence entries, part 149.
2839. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2840. gbtsa150.seq - TSA (transcriptome shotgun assembly) sequence entries, part 150.
2841. gbtsa151.seq - TSA (transcriptome shotgun assembly) sequence entries, part 151.
2842. gbtsa152.seq - TSA (transcriptome shotgun assembly) sequence entries, part 152.
2843. gbtsa153.seq - TSA (transcriptome shotgun assembly) sequence entries, part 153.
2844. gbtsa154.seq - TSA (transcriptome shotgun assembly) sequence entries, part 154.
2845. gbtsa155.seq - TSA (transcriptome shotgun assembly) sequence entries, part 155.
2846. gbtsa156.seq - TSA (transcriptome shotgun assembly) sequence entries, part 156.
2847. gbtsa157.seq - TSA (transcriptome shotgun assembly) sequence entries, part 157.
2848. gbtsa158.seq - TSA (transcriptome shotgun assembly) sequence entries, part 158.
2849. gbtsa159.seq - TSA (transcriptome shotgun assembly) sequence entries, part 159.
2850. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2851. gbtsa160.seq - TSA (transcriptome shotgun assembly) sequence entries, part 160.
2852. gbtsa161.seq - TSA (transcriptome shotgun assembly) sequence entries, part 161.
2853. gbtsa162.seq - TSA (transcriptome shotgun assembly) sequence entries, part 162.
2854. gbtsa163.seq - TSA (transcriptome shotgun assembly) sequence entries, part 163.
2855. gbtsa164.seq - TSA (transcriptome shotgun assembly) sequence entries, part 164.
2856. gbtsa165.seq - TSA (transcriptome shotgun assembly) sequence entries, part 165.
2857. gbtsa166.seq - TSA (transcriptome shotgun assembly) sequence entries, part 166.
2858. gbtsa167.seq - TSA (transcriptome shotgun assembly) sequence entries, part 167.
2859. gbtsa168.seq - TSA (transcriptome shotgun assembly) sequence entries, part 168.
2860. gbtsa169.seq - TSA (transcriptome shotgun assembly) sequence entries, part 169.
2861. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2862. gbtsa170.seq - TSA (transcriptome shotgun assembly) sequence entries, part 170.
2863. gbtsa171.seq - TSA (transcriptome shotgun assembly) sequence entries, part 171.
2864. gbtsa172.seq - TSA (transcriptome shotgun assembly) sequence entries, part 172.
2865. gbtsa173.seq - TSA (transcriptome shotgun assembly) sequence entries, part 173.
2866. gbtsa174.seq - TSA (transcriptome shotgun assembly) sequence entries, part 174.
2867. gbtsa175.seq - TSA (transcriptome shotgun assembly) sequence entries, part 175.
2868. gbtsa176.seq - TSA (transcriptome shotgun assembly) sequence entries, part 176.
2869. gbtsa177.seq - TSA (transcriptome shotgun assembly) sequence entries, part 177.
2870. gbtsa178.seq - TSA (transcriptome shotgun assembly) sequence entries, part 178.
2871. gbtsa179.seq - TSA (transcriptome shotgun assembly) sequence entries, part 179.
2872. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2873. gbtsa180.seq - TSA (transcriptome shotgun assembly) sequence entries, part 180.
2874. gbtsa181.seq - TSA (transcriptome shotgun assembly) sequence entries, part 181.
2875. gbtsa182.seq - TSA (transcriptome shotgun assembly) sequence entries, part 182.
2876. gbtsa183.seq - TSA (transcriptome shotgun assembly) sequence entries, part 183.
2877. gbtsa184.seq - TSA (transcriptome shotgun assembly) sequence entries, part 184.
2878. gbtsa185.seq - TSA (transcriptome shotgun assembly) sequence entries, part 185.
2879. gbtsa186.seq - TSA (transcriptome shotgun assembly) sequence entries, part 186.
2880. gbtsa187.seq - TSA (transcriptome shotgun assembly) sequence entries, part 187.
2881. gbtsa188.seq - TSA (transcriptome shotgun assembly) sequence entries, part 188.
2882. gbtsa189.seq - TSA (transcriptome shotgun assembly) sequence entries, part 189.
2883. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
2884. gbtsa190.seq - TSA (transcriptome shotgun assembly) sequence entries, part 190.
2885. gbtsa191.seq - TSA (transcriptome shotgun assembly) sequence entries, part 191.
2886. gbtsa192.seq - TSA (transcriptome shotgun assembly) sequence entries, part 192.
2887. gbtsa193.seq - TSA (transcriptome shotgun assembly) sequence entries, part 193.
2888. gbtsa194.seq - TSA (transcriptome shotgun assembly) sequence entries, part 194.
2889. gbtsa195.seq - TSA (transcriptome shotgun assembly) sequence entries, part 195.
2890. gbtsa196.seq - TSA (transcriptome shotgun assembly) sequence entries, part 196.
2891. gbtsa197.seq - TSA (transcriptome shotgun assembly) sequence entries, part 197.
2892. gbtsa198.seq - TSA (transcriptome shotgun assembly) sequence entries, part 198.
2893. gbtsa199.seq - TSA (transcriptome shotgun assembly) sequence entries, part 199.
2894. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
2895. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
2896. gbtsa200.seq - TSA (transcriptome shotgun assembly) sequence entries, part 200.
2897. gbtsa201.seq - TSA (transcriptome shotgun assembly) sequence entries, part 201.
2898. gbtsa202.seq - TSA (transcriptome shotgun assembly) sequence entries, part 202.
2899. gbtsa203.seq - TSA (transcriptome shotgun assembly) sequence entries, part 203.
2900. gbtsa204.seq - TSA (transcriptome shotgun assembly) sequence entries, part 204.
2901. gbtsa205.seq - TSA (transcriptome shotgun assembly) sequence entries, part 205.
2902. gbtsa206.seq - TSA (transcriptome shotgun assembly) sequence entries, part 206.
2903. gbtsa207.seq - TSA (transcriptome shotgun assembly) sequence entries, part 207.
2904. gbtsa208.seq - TSA (transcriptome shotgun assembly) sequence entries, part 208.
2905. gbtsa209.seq - TSA (transcriptome shotgun assembly) sequence entries, part 209.
2906. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
2907. gbtsa210.seq - TSA (transcriptome shotgun assembly) sequence entries, part 210.
2908. gbtsa211.seq - TSA (transcriptome shotgun assembly) sequence entries, part 211.
2909. gbtsa212.seq - TSA (transcriptome shotgun assembly) sequence entries, part 212.
2910. gbtsa213.seq - TSA (transcriptome shotgun assembly) sequence entries, part 213.
2911. gbtsa214.seq - TSA (transcriptome shotgun assembly) sequence entries, part 214.
2912. gbtsa215.seq - TSA (transcriptome shotgun assembly) sequence entries, part 215.
2913. gbtsa216.seq - TSA (transcriptome shotgun assembly) sequence entries, part 216.
2914. gbtsa217.seq - TSA (transcriptome shotgun assembly) sequence entries, part 217.
2915. gbtsa218.seq - TSA (transcriptome shotgun assembly) sequence entries, part 218.
2916. gbtsa219.seq - TSA (transcriptome shotgun assembly) sequence entries, part 219.
2917. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
2918. gbtsa220.seq - TSA (transcriptome shotgun assembly) sequence entries, part 220.
2919. gbtsa221.seq - TSA (transcriptome shotgun assembly) sequence entries, part 221.
2920. gbtsa222.seq - TSA (transcriptome shotgun assembly) sequence entries, part 222.
2921. gbtsa223.seq - TSA (transcriptome shotgun assembly) sequence entries, part 223.
2922. gbtsa224.seq - TSA (transcriptome shotgun assembly) sequence entries, part 224.
2923. gbtsa225.seq - TSA (transcriptome shotgun assembly) sequence entries, part 225.
2924. gbtsa226.seq - TSA (transcriptome shotgun assembly) sequence entries, part 226.
2925. gbtsa227.seq - TSA (transcriptome shotgun assembly) sequence entries, part 227.
2926. gbtsa228.seq - TSA (transcriptome shotgun assembly) sequence entries, part 228.
2927. gbtsa229.seq - TSA (transcriptome shotgun assembly) sequence entries, part 229.
2928. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
2929. gbtsa230.seq - TSA (transcriptome shotgun assembly) sequence entries, part 230.
2930. gbtsa231.seq - TSA (transcriptome shotgun assembly) sequence entries, part 231.
2931. gbtsa232.seq - TSA (transcriptome shotgun assembly) sequence entries, part 232.
2932. gbtsa233.seq - TSA (transcriptome shotgun assembly) sequence entries, part 233.
2933. gbtsa234.seq - TSA (transcriptome shotgun assembly) sequence entries, part 234.
2934. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
2935. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
2936. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
2937. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
2938. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
2939. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
2940. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
2941. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
2942. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
2943. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
2944. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
2945. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
2946. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
2947. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
2948. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
2949. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
2950. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
2951. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
2952. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
2953. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
2954. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
2955. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
2956. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
2957. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
2958. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
2959. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
2960. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
2961. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
2962. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
2963. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
2964. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
2965. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
2966. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
2967. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
2968. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
2969. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
2970. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
2971. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
2972. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
2973. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
2974. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
2975. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
2976. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
2977. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
2978. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
2979. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
2980. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
2981. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
2982. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
2983. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
2984. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
2985. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
2986. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
2987. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
2988. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
2989. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
2990. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
2991. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
2992. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
2993. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
2994. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
2995. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
2996. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
2997. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
2998. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
2999. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
3000. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
3001. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
3002. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
3003. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
3004. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
3005. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
3006. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
3007. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
3008. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
3009. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
3010. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
3011. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
3012. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
3013. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
3014. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
3015. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
3016. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
3017. gbuna1.seq - Unannotated sequence entries, part 1.
3018. gbvrl1.seq - Viral sequence entries, part 1.
3019. gbvrl10.seq - Viral sequence entries, part 10.
3020. gbvrl11.seq - Viral sequence entries, part 11.
3021. gbvrl12.seq - Viral sequence entries, part 12.
3022. gbvrl13.seq - Viral sequence entries, part 13.
3023. gbvrl14.seq - Viral sequence entries, part 14.
3024. gbvrl15.seq - Viral sequence entries, part 15.
3025. gbvrl16.seq - Viral sequence entries, part 16.
3026. gbvrl17.seq - Viral sequence entries, part 17.
3027. gbvrl18.seq - Viral sequence entries, part 18.
3028. gbvrl19.seq - Viral sequence entries, part 19.
3029. gbvrl2.seq - Viral sequence entries, part 2.
3030. gbvrl20.seq - Viral sequence entries, part 20.
3031. gbvrl21.seq - Viral sequence entries, part 21.
3032. gbvrl22.seq - Viral sequence entries, part 22.
3033. gbvrl23.seq - Viral sequence entries, part 23.
3034. gbvrl24.seq - Viral sequence entries, part 24.
3035. gbvrl25.seq - Viral sequence entries, part 25.
3036. gbvrl26.seq - Viral sequence entries, part 26.
3037. gbvrl27.seq - Viral sequence entries, part 27.
3038. gbvrl28.seq - Viral sequence entries, part 28.
3039. gbvrl29.seq - Viral sequence entries, part 29.
3040. gbvrl3.seq - Viral sequence entries, part 3.
3041. gbvrl30.seq - Viral sequence entries, part 30.
3042. gbvrl31.seq - Viral sequence entries, part 31.
3043. gbvrl32.seq - Viral sequence entries, part 32.
3044. gbvrl33.seq - Viral sequence entries, part 33.
3045. gbvrl34.seq - Viral sequence entries, part 34.
3046. gbvrl35.seq - Viral sequence entries, part 35.
3047. gbvrl36.seq - Viral sequence entries, part 36.
3048. gbvrl37.seq - Viral sequence entries, part 37.
3049. gbvrl38.seq - Viral sequence entries, part 38.
3050. gbvrl39.seq - Viral sequence entries, part 39.
3051. gbvrl4.seq - Viral sequence entries, part 4.
3052. gbvrl40.seq - Viral sequence entries, part 40.
3053. gbvrl41.seq - Viral sequence entries, part 41.
3054. gbvrl42.seq - Viral sequence entries, part 42.
3055. gbvrl43.seq - Viral sequence entries, part 43.
3056. gbvrl44.seq - Viral sequence entries, part 44.
3057. gbvrl45.seq - Viral sequence entries, part 45.
3058. gbvrl46.seq - Viral sequence entries, part 46.
3059. gbvrl47.seq - Viral sequence entries, part 47.
3060. gbvrl48.seq - Viral sequence entries, part 48.
3061. gbvrl49.seq - Viral sequence entries, part 49.
3062. gbvrl5.seq - Viral sequence entries, part 5.
3063. gbvrl50.seq - Viral sequence entries, part 50.
3064. gbvrl51.seq - Viral sequence entries, part 51.
3065. gbvrl52.seq - Viral sequence entries, part 52.
3066. gbvrl53.seq - Viral sequence entries, part 53.
3067. gbvrl54.seq - Viral sequence entries, part 54.
3068. gbvrl55.seq - Viral sequence entries, part 55.
3069. gbvrl56.seq - Viral sequence entries, part 56.
3070. gbvrl57.seq - Viral sequence entries, part 57.
3071. gbvrl6.seq - Viral sequence entries, part 6.
3072. gbvrl7.seq - Viral sequence entries, part 7.
3073. gbvrl8.seq - Viral sequence entries, part 8.
3074. gbvrl9.seq - Viral sequence entries, part 9.
3075. gbvrt1.seq - Other vertebrate sequence entries, part 1.
3076. gbvrt10.seq - Other vertebrate sequence entries, part 10.
3077. gbvrt11.seq - Other vertebrate sequence entries, part 11.
3078. gbvrt12.seq - Other vertebrate sequence entries, part 12.
3079. gbvrt13.seq - Other vertebrate sequence entries, part 13.
3080. gbvrt14.seq - Other vertebrate sequence entries, part 14.
3081. gbvrt15.seq - Other vertebrate sequence entries, part 15.
3082. gbvrt16.seq - Other vertebrate sequence entries, part 16.
3083. gbvrt17.seq - Other vertebrate sequence entries, part 17.
3084. gbvrt18.seq - Other vertebrate sequence entries, part 18.
3085. gbvrt19.seq - Other vertebrate sequence entries, part 19.
3086. gbvrt2.seq - Other vertebrate sequence entries, part 2.
3087. gbvrt20.seq - Other vertebrate sequence entries, part 20.
3088. gbvrt21.seq - Other vertebrate sequence entries, part 21.
3089. gbvrt22.seq - Other vertebrate sequence entries, part 22.
3090. gbvrt23.seq - Other vertebrate sequence entries, part 23.
3091. gbvrt24.seq - Other vertebrate sequence entries, part 24.
3092. gbvrt25.seq - Other vertebrate sequence entries, part 25.
3093. gbvrt26.seq - Other vertebrate sequence entries, part 26.
3094. gbvrt27.seq - Other vertebrate sequence entries, part 27.
3095. gbvrt28.seq - Other vertebrate sequence entries, part 28.
3096. gbvrt29.seq - Other vertebrate sequence entries, part 29.
3097. gbvrt3.seq - Other vertebrate sequence entries, part 3.
3098. gbvrt30.seq - Other vertebrate sequence entries, part 30.
3099. gbvrt31.seq - Other vertebrate sequence entries, part 31.
3100. gbvrt32.seq - Other vertebrate sequence entries, part 32.
3101. gbvrt33.seq - Other vertebrate sequence entries, part 33.
3102. gbvrt34.seq - Other vertebrate sequence entries, part 34.
3103. gbvrt35.seq - Other vertebrate sequence entries, part 35.
3104. gbvrt36.seq - Other vertebrate sequence entries, part 36.
3105. gbvrt37.seq - Other vertebrate sequence entries, part 37.
3106. gbvrt38.seq - Other vertebrate sequence entries, part 38.
3107. gbvrt39.seq - Other vertebrate sequence entries, part 39.
3108. gbvrt4.seq - Other vertebrate sequence entries, part 4.
3109. gbvrt40.seq - Other vertebrate sequence entries, part 40.
3110. gbvrt41.seq - Other vertebrate sequence entries, part 41.
3111. gbvrt42.seq - Other vertebrate sequence entries, part 42.
3112. gbvrt43.seq - Other vertebrate sequence entries, part 43.
3113. gbvrt44.seq - Other vertebrate sequence entries, part 44.
3114. gbvrt45.seq - Other vertebrate sequence entries, part 45.
3115. gbvrt46.seq - Other vertebrate sequence entries, part 46.
3116. gbvrt47.seq - Other vertebrate sequence entries, part 47.
3117. gbvrt48.seq - Other vertebrate sequence entries, part 48.
3118. gbvrt49.seq - Other vertebrate sequence entries, part 49.
3119. gbvrt5.seq - Other vertebrate sequence entries, part 5.
3120. gbvrt50.seq - Other vertebrate sequence entries, part 50.
3121. gbvrt51.seq - Other vertebrate sequence entries, part 51.
3122. gbvrt52.seq - Other vertebrate sequence entries, part 52.
3123. gbvrt53.seq - Other vertebrate sequence entries, part 53.
3124. gbvrt54.seq - Other vertebrate sequence entries, part 54.
3125. gbvrt55.seq - Other vertebrate sequence entries, part 55.
3126. gbvrt56.seq - Other vertebrate sequence entries, part 56.
3127. gbvrt57.seq - Other vertebrate sequence entries, part 57.
3128. gbvrt58.seq - Other vertebrate sequence entries, part 58.
3129. gbvrt59.seq - Other vertebrate sequence entries, part 59.
3130. gbvrt6.seq - Other vertebrate sequence entries, part 6.
3131. gbvrt60.seq - Other vertebrate sequence entries, part 60.
3132. gbvrt61.seq - Other vertebrate sequence entries, part 61.
3133. gbvrt62.seq - Other vertebrate sequence entries, part 62.
3134. gbvrt63.seq - Other vertebrate sequence entries, part 63.
3135. gbvrt64.seq - Other vertebrate sequence entries, part 64.
3136. gbvrt65.seq - Other vertebrate sequence entries, part 65.
3137. gbvrt66.seq - Other vertebrate sequence entries, part 66.
3138. gbvrt67.seq - Other vertebrate sequence entries, part 67.
3139. gbvrt68.seq - Other vertebrate sequence entries, part 68.
3140. gbvrt69.seq - Other vertebrate sequence entries, part 69.
3141. gbvrt7.seq - Other vertebrate sequence entries, part 7.
3142. gbvrt70.seq - Other vertebrate sequence entries, part 70.
3143. gbvrt71.seq - Other vertebrate sequence entries, part 71.
3144. gbvrt72.seq - Other vertebrate sequence entries, part 72.
3145. gbvrt73.seq - Other vertebrate sequence entries, part 73.
3146. gbvrt74.seq - Other vertebrate sequence entries, part 74.
3147. gbvrt75.seq - Other vertebrate sequence entries, part 75.
3148. gbvrt76.seq - Other vertebrate sequence entries, part 76.
3149. gbvrt77.seq - Other vertebrate sequence entries, part 77.
3150. gbvrt78.seq - Other vertebrate sequence entries, part 78.
3151. gbvrt79.seq - Other vertebrate sequence entries, part 79.
3152. gbvrt8.seq - Other vertebrate sequence entries, part 8.
3153. gbvrt80.seq - Other vertebrate sequence entries, part 80.
3154. gbvrt81.seq - Other vertebrate sequence entries, part 81.
3155. gbvrt82.seq - Other vertebrate sequence entries, part 82.
3156. gbvrt83.seq - Other vertebrate sequence entries, part 83.
3157. gbvrt84.seq - Other vertebrate sequence entries, part 84.
3158. gbvrt85.seq - Other vertebrate sequence entries, part 85.
3159. gbvrt86.seq - Other vertebrate sequence entries, part 86.
3160. gbvrt87.seq - Other vertebrate sequence entries, part 87.
3161. gbvrt88.seq - Other vertebrate sequence entries, part 88.
3162. gbvrt89.seq - Other vertebrate sequence entries, part 89.
3163. gbvrt9.seq - Other vertebrate sequence entries, part 9.
3164. gbvrt90.seq - Other vertebrate sequence entries, part 90.
3165. gbvrt91.seq - Other vertebrate sequence entries, part 91.
3166. gbvrt92.seq - Other vertebrate sequence entries, part 92.
3167. gbvrt93.seq - Other vertebrate sequence entries, part 93.
3168. gbvrt94.seq - Other vertebrate sequence entries, part 94.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 227.0 flatfiles require roughly 893 GB (sequence
files only) or 893 GB (including the *.txt files).
The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 249997496     gbbct1.seq
 212440546     gbbct10.seq
 246700558     gbbct100.seq
 249734165     gbbct101.seq
 239894254     gbbct102.seq
 244164482     gbbct103.seq
 245971886     gbbct104.seq
 244824525     gbbct105.seq
 241012420     gbbct106.seq
 241253040     gbbct107.seq
 244632881     gbbct108.seq
 247879337     gbbct109.seq
 102201215     gbbct11.seq
 239483634     gbbct110.seq
 248325996     gbbct111.seq
  58570566     gbbct112.seq
 244950777     gbbct113.seq
 246522126     gbbct114.seq
 240783673     gbbct115.seq
 242512461     gbbct116.seq
 242365577     gbbct117.seq
 242436790     gbbct118.seq
 243237447     gbbct119.seq
 245569080     gbbct12.seq
 244466731     gbbct120.seq
 246861818     gbbct121.seq
 244398726     gbbct122.seq
 239551701     gbbct123.seq
  63029575     gbbct124.seq
 241061325     gbbct125.seq
 241981601     gbbct126.seq
 247957273     gbbct127.seq
 245909858     gbbct128.seq
 243013381     gbbct129.seq
  36856569     gbbct13.seq
 247756066     gbbct130.seq
 244464732     gbbct131.seq
 234838992     gbbct132.seq
 249720387     gbbct133.seq
 179664588     gbbct134.seq
 243058580     gbbct135.seq
 241432484     gbbct136.seq
 243613731     gbbct137.seq
 247595542     gbbct138.seq
 247761924     gbbct139.seq
 248768407     gbbct14.seq
 249431207     gbbct140.seq
 245812764     gbbct141.seq
  45171391     gbbct142.seq
 244041850     gbbct143.seq
 242152958     gbbct144.seq
 245203893     gbbct145.seq
 247853655     gbbct146.seq
 244652635     gbbct147.seq
 248880100     gbbct148.seq
 249626584     gbbct149.seq
 242006339     gbbct15.seq
  19598343     gbbct150.seq
 241276423     gbbct151.seq
 244343477     gbbct152.seq
 242774332     gbbct153.seq
 245452638     gbbct154.seq
 245500577     gbbct155.seq
 247590907     gbbct156.seq
 243111424     gbbct157.seq
 170950313     gbbct158.seq
 246553114     gbbct159.seq
 246259327     gbbct16.seq
 244026129     gbbct160.seq
 240103172     gbbct161.seq
 249050572     gbbct162.seq
 249699467     gbbct163.seq
 243912528     gbbct164.seq
 246742524     gbbct165.seq
 249204333     gbbct166.seq
  44795651     gbbct167.seq
 249568669     gbbct168.seq
 248729365     gbbct169.seq
 240545261     gbbct17.seq
 239513985     gbbct170.seq
 241250633     gbbct171.seq
 246074399     gbbct172.seq
 244339919     gbbct173.seq
 244063631     gbbct174.seq
 248136256     gbbct175.seq
 223539715     gbbct176.seq
 240745573     gbbct177.seq
 234138010     gbbct178.seq
 243391072     gbbct179.seq
 246347532     gbbct18.seq
 244694459     gbbct180.seq
 247838429     gbbct181.seq
 242910838     gbbct182.seq
 249180614     gbbct183.seq
 234991890     gbbct184.seq
 119567256     gbbct185.seq
 249325462     gbbct186.seq
 249672015     gbbct187.seq
 242373605     gbbct188.seq
 242412790     gbbct189.seq
 232454468     gbbct19.seq
 246355346     gbbct190.seq
 245691943     gbbct191.seq
 240050865     gbbct192.seq
 102389320     gbbct193.seq
 241808257     gbbct194.seq
 245486854     gbbct195.seq
 248795134     gbbct196.seq
 245074969     gbbct197.seq
 244622426     gbbct198.seq
 249108333     gbbct199.seq
 242210235     gbbct2.seq
 249111492     gbbct20.seq
 245348790     gbbct200.seq
  50144266     gbbct201.seq
 243951579     gbbct202.seq
 240030157     gbbct203.seq
 249386409     gbbct204.seq
 246053700     gbbct205.seq
 249797544     gbbct206.seq
 248934110     gbbct207.seq
 244373122     gbbct208.seq
 238047005     gbbct209.seq
 246847396     gbbct21.seq
 245764679     gbbct210.seq
 249506141     gbbct211.seq
 248910775     gbbct212.seq
 249942607     gbbct213.seq
 243382666     gbbct214.seq
  60275392     gbbct215.seq
 244265982     gbbct216.seq
 244087800     gbbct217.seq
 249535727     gbbct218.seq
 249845661     gbbct219.seq
 248911455     gbbct22.seq
 247960863     gbbct220.seq
 239314822     gbbct221.seq
 244652962     gbbct222.seq
 229096697     gbbct223.seq
 244729502     gbbct224.seq
 241701301     gbbct225.seq
 242815608     gbbct226.seq
 249349311     gbbct227.seq
 246477462     gbbct228.seq
 246126151     gbbct229.seq
 235558044     gbbct23.seq
 243129989     gbbct230.seq
 248465603     gbbct231.seq
 237996153     gbbct232.seq
 247535076     gbbct233.seq
 154664838     gbbct234.seq
 242952907     gbbct235.seq
 243260145     gbbct236.seq
 246162114     gbbct237.seq
 239795845     gbbct238.seq
 245967505     gbbct239.seq
 244180514     gbbct24.seq
 240086852     gbbct240.seq
 249572907     gbbct241.seq
 238452247     gbbct242.seq
 243049535     gbbct243.seq
 144614030     gbbct244.seq
 249969526     gbbct245.seq
 246026512     gbbct246.seq
 246089708     gbbct247.seq
 245038394     gbbct248.seq
 249767998     gbbct249.seq
 249835702     gbbct25.seq
 249716181     gbbct250.seq
 248077165     gbbct251.seq
 240152972     gbbct252.seq
 247396075     gbbct253.seq
 240850069     gbbct254.seq
 247294495     gbbct255.seq
  71908533     gbbct256.seq
 238304020     gbbct257.seq
 246105675     gbbct258.seq
 237805771     gbbct259.seq
 246759161     gbbct26.seq
 249697142     gbbct260.seq
 247874082     gbbct261.seq
 241945386     gbbct262.seq
 247106462     gbbct263.seq
 241386493     gbbct264.seq
 243977936     gbbct265.seq
 246323614     gbbct266.seq
 249683408     gbbct267.seq
 249836791     gbbct268.seq
  54174534     gbbct269.seq
 248634715     gbbct27.seq
 245075201     gbbct270.seq
 249457309     gbbct271.seq
 248609724     gbbct272.seq
 248731772     gbbct273.seq
 242726271     gbbct274.seq
 246647471     gbbct275.seq
 248003453     gbbct276.seq
 248450617     gbbct277.seq
 248842793     gbbct278.seq
 244544511     gbbct279.seq
 161054827     gbbct28.seq
 241565141     gbbct280.seq
 248651748     gbbct281.seq
 244018249     gbbct282.seq
  77257792     gbbct283.seq
 245804065     gbbct284.seq
 248790766     gbbct285.seq
 249241387     gbbct286.seq
 242191016     gbbct287.seq
 244578090     gbbct288.seq
 246035074     gbbct289.seq
  21361281     gbbct29.seq
 249011249     gbbct290.seq
 249696011     gbbct291.seq
  52027525     gbbct292.seq
 249201065     gbbct293.seq
 245885401     gbbct294.seq
 247124126     gbbct295.seq
 248574546     gbbct296.seq
 244958721     gbbct297.seq
 237490863     gbbct298.seq
 195549216     gbbct299.seq
 248982274     gbbct3.seq
  38591073     gbbct30.seq
 246600840     gbbct300.seq
 248400258     gbbct301.seq
 244815797     gbbct302.seq
 239366214     gbbct303.seq
 247378258     gbbct304.seq
 239588319     gbbct305.seq
 241061131     gbbct306.seq
 248778703     gbbct307.seq
 247600004     gbbct308.seq
 240545316     gbbct309.seq
 237196078     gbbct31.seq
 243803459     gbbct310.seq
 243934978     gbbct311.seq
 249503223     gbbct312.seq
 246224869     gbbct313.seq
   6676051     gbbct314.seq
 248391326     gbbct315.seq
 244713975     gbbct316.seq
 249990670     gbbct317.seq
 246751172     gbbct318.seq
 246433414     gbbct319.seq
 242844247     gbbct32.seq
 245919203     gbbct320.seq
 249957783     gbbct321.seq
 249216496     gbbct322.seq
 241680594     gbbct323.seq
 245319568     gbbct324.seq
 243309579     gbbct325.seq
 248787121     gbbct326.seq
 248415683     gbbct327.seq
 243968588     gbbct328.seq
 242517651     gbbct329.seq
 240149614     gbbct33.seq
 248844611     gbbct330.seq
 244239485     gbbct331.seq
 242785669     gbbct332.seq
  44579837     gbbct333.seq
 244525102     gbbct334.seq
 248045621     gbbct335.seq
 249211838     gbbct336.seq
 243640666     gbbct337.seq
 238305900     gbbct338.seq
 246899967     gbbct339.seq
 246548560     gbbct34.seq
 245217544     gbbct340.seq
 219036920     gbbct341.seq
 241749234     gbbct342.seq
 247526722     gbbct343.seq
 248176564     gbbct344.seq
 248898931     gbbct345.seq
 248259801     gbbct346.seq
 245430473     gbbct347.seq
 247256318     gbbct348.seq
 240518138     gbbct349.seq
 245935466     gbbct35.seq
 244544684     gbbct350.seq
  30875148     gbbct351.seq
 247921041     gbbct352.seq
 244639856     gbbct353.seq
 248916816     gbbct354.seq
 240221222     gbbct355.seq
 240536439     gbbct356.seq
 245770814     gbbct357.seq
 248334336     gbbct358.seq
 243710457     gbbct359.seq
 249518826     gbbct36.seq
 243721145     gbbct360.seq
 228845422     gbbct361.seq
 247663514     gbbct362.seq
 242707475     gbbct363.seq
 243347957     gbbct364.seq
 245359708     gbbct365.seq
 244434382     gbbct366.seq
 247046804     gbbct367.seq
 245967300     gbbct368.seq
 246251046     gbbct369.seq
 246133996     gbbct37.seq
 240332090     gbbct370.seq
 248939646     gbbct371.seq
 239970881     gbbct372.seq
 241788213     gbbct373.seq
 247471851     gbbct374.seq
  17106324     gbbct375.seq
 244270477     gbbct376.seq
 249627909     gbbct377.seq
 247981853     gbbct378.seq
 248354042     gbbct379.seq
 242552745     gbbct38.seq
 242277892     gbbct380.seq
  36606999     gbbct381.seq
 242041116     gbbct382.seq
 236585361     gbbct383.seq
 240663087     gbbct384.seq
 247126674     gbbct385.seq
 247684622     gbbct386.seq
 249181862     gbbct387.seq
 242116016     gbbct388.seq
 245223089     gbbct389.seq
 178904831     gbbct39.seq
 249069391     gbbct390.seq
 244536550     gbbct391.seq
 140553142     gbbct392.seq
 231684322     gbbct393.seq
 243279398     gbbct394.seq
 247707034     gbbct395.seq
 242814589     gbbct396.seq
 246371446     gbbct397.seq
 242309430     gbbct398.seq
 249691325     gbbct399.seq
 248864749     gbbct4.seq
 249772673     gbbct40.seq
 242942757     gbbct400.seq
 240398627     gbbct401.seq
  37250758     gbbct402.seq
 244838343     gbbct403.seq
 240926350     gbbct404.seq
 244954461     gbbct405.seq
 241218891     gbbct406.seq
 245568924     gbbct407.seq
 246868582     gbbct408.seq
 202586421     gbbct409.seq
 245216747     gbbct41.seq
 249081168     gbbct410.seq
 245656133     gbbct411.seq
 246447822     gbbct412.seq
 248505056     gbbct413.seq
 247469613     gbbct414.seq
 244446630     gbbct415.seq
 245622066     gbbct416.seq
 244507637     gbbct417.seq
 247808345     gbbct418.seq
  23001910     gbbct419.seq
 246908970     gbbct42.seq
 248622810     gbbct420.seq
 249206333     gbbct421.seq
 249552738     gbbct422.seq
 242262968     gbbct423.seq
 245268514     gbbct424.seq
 248013865     gbbct425.seq
 244482959     gbbct426.seq
  27058021     gbbct427.seq
 240879640     gbbct428.seq
 240485138     gbbct429.seq
 248715882     gbbct43.seq
 238119987     gbbct430.seq
 244090976     gbbct431.seq
 247967479     gbbct432.seq
 245526130     gbbct433.seq
 247340318     gbbct434.seq
 219150552     gbbct435.seq
 242691803     gbbct436.seq
 247228707     gbbct437.seq
 239239445     gbbct438.seq
 249831092     gbbct439.seq
 240139156     gbbct44.seq
 247396285     gbbct440.seq
 249630061     gbbct441.seq
 143926129     gbbct442.seq
 246618717     gbbct443.seq
  59045685     gbbct444.seq
   6831378     gbbct445.seq
  14103728     gbbct446.seq
  22748850     gbbct447.seq
  44382845     gbbct448.seq
  86370718     gbbct449.seq
 247354967     gbbct45.seq
 168074650     gbbct450.seq
 249997058     gbbct451.seq
 249889592     gbbct452.seq
 245928920     gbbct453.seq
 245549416     gbbct454.seq
 248944378     gbbct455.seq
 248169254     gbbct456.seq
 245373505     gbbct457.seq
 243447964     gbbct458.seq
 249612533     gbbct459.seq
 238146778     gbbct46.seq
 249998788     gbbct460.seq
  12596299     gbbct461.seq
 248638905     gbbct462.seq
 244383966     gbbct463.seq
 249044585     gbbct464.seq
 249998881     gbbct465.seq
 248187139     gbbct466.seq
 249999977     gbbct467.seq
 249998925     gbbct468.seq
 226631944     gbbct469.seq
 248489975     gbbct47.seq
 249993132     gbbct470.seq
 249999203     gbbct471.seq
 249998907     gbbct472.seq
  38960573     gbbct473.seq
 249999386     gbbct474.seq
 249997128     gbbct475.seq
  83134509     gbbct476.seq
 249997982     gbbct477.seq
 249998480     gbbct478.seq
 119688393     gbbct479.seq
 249758392     gbbct48.seq
 249998158     gbbct480.seq
 249997583     gbbct481.seq
  26759210     gbbct482.seq
 136886708     gbbct483.seq
 249960973     gbbct484.seq
 249726503     gbbct485.seq
 239922346     gbbct486.seq
 112896598     gbbct487.seq
 247516675     gbbct488.seq
 246624735     gbbct489.seq
 247753957     gbbct49.seq
 245702106     gbbct490.seq
 248778610     gbbct491.seq
 248698148     gbbct492.seq
 243449091     gbbct493.seq
 246778251     gbbct494.seq
 246979390     gbbct495.seq
 247975781     gbbct496.seq
 229702516     gbbct497.seq
 249987220     gbbct498.seq
 105056639     gbbct499.seq
 249974749     gbbct5.seq
 246732695     gbbct50.seq
 247762102     gbbct500.seq
 239873944     gbbct501.seq
 237340764     gbbct502.seq
 249331091     gbbct503.seq
 247076145     gbbct504.seq
 246000711     gbbct505.seq
 247581678     gbbct506.seq
 249280690     gbbct507.seq
  97625090     gbbct508.seq
 246056506     gbbct509.seq
 244482837     gbbct51.seq
 247836065     gbbct510.seq
 244899861     gbbct511.seq
 243637725     gbbct512.seq
 246858499     gbbct513.seq
 247592492     gbbct514.seq
 246396193     gbbct515.seq
 173289333     gbbct516.seq
  49878839     gbbct517.seq
 100949045     gbbct518.seq
 249995944     gbbct519.seq
 116082098     gbbct52.seq
 242557637     gbbct520.seq
 245319818     gbbct53.seq
 239965684     gbbct54.seq
 243796561     gbbct55.seq
 246826813     gbbct56.seq
 249205986     gbbct57.seq
 248427261     gbbct58.seq
 245610930     gbbct59.seq
  40300630     gbbct6.seq
 243530935     gbbct60.seq
 249937923     gbbct61.seq
 247965813     gbbct62.seq
 249558828     gbbct63.seq
 243878546     gbbct64.seq
 240165726     gbbct65.seq
 249557921     gbbct66.seq
 249998368     gbbct67.seq
 242573406     gbbct68.seq
 249165937     gbbct69.seq
 236403158     gbbct7.seq
 246719271     gbbct70.seq
 244405644     gbbct71.seq
 242761770     gbbct72.seq
 249982188     gbbct73.seq
 247124168     gbbct74.seq
 244747477     gbbct75.seq
 249662168     gbbct76.seq
 247348132     gbbct77.seq
   4108412     gbbct78.seq
 244241177     gbbct79.seq
 157697346     gbbct8.seq
 247972834     gbbct80.seq
 249362099     gbbct81.seq
 240280108     gbbct82.seq
 249670070     gbbct83.seq
 247055029     gbbct84.seq
 244594662     gbbct85.seq
 249789616     gbbct86.seq
 238886157     gbbct87.seq
 248633884     gbbct88.seq
 249773974     gbbct89.seq
 246786421     gbbct9.seq
 247795922     gbbct90.seq
 246124028     gbbct91.seq
  30310080     gbbct92.seq
 245123007     gbbct93.seq
 248424203     gbbct94.seq
 244246446     gbbct95.seq
 244865592     gbbct96.seq
 248229690     gbbct97.seq
 240342508     gbbct98.seq
 241788083     gbbct99.seq
   7234366     gbchg.txt
 250000247     gbcon1.seq
 249993616     gbcon10.seq
 250000102     gbcon100.seq
  48471727     gbcon101.seq
 249995058     gbcon102.seq
 249995292     gbcon103.seq
 249999081     gbcon104.seq
 249996003     gbcon105.seq
 249997161     gbcon106.seq
   9912200     gbcon107.seq
 249999865     gbcon108.seq
 249997281     gbcon109.seq
 244549243     gbcon11.seq
 249998854     gbcon110.seq
 249998474     gbcon111.seq
 187377117     gbcon112.seq
 249993476     gbcon113.seq
 249996617     gbcon114.seq
 249996794     gbcon115.seq
 249995754     gbcon116.seq
 249995024     gbcon117.seq
 114605876     gbcon118.seq
 249997526     gbcon119.seq
 247881007     gbcon12.seq
 249996436     gbcon120.seq
 249997759     gbcon121.seq
 249997192     gbcon122.seq
 249996943     gbcon123.seq
 136128497     gbcon124.seq
 249998114     gbcon125.seq
 249995914     gbcon126.seq
 249999832     gbcon127.seq
 222788052     gbcon128.seq
 173591655     gbcon129.seq
 246532698     gbcon13.seq
 249996463     gbcon130.seq
 250000239     gbcon131.seq
  45123591     gbcon132.seq
 249999603     gbcon133.seq
 249983531     gbcon134.seq
 203591373     gbcon135.seq
 199346006     gbcon136.seq
 249841737     gbcon137.seq
 249613155     gbcon138.seq
 249998717     gbcon139.seq
 238111268     gbcon14.seq
 250000257     gbcon140.seq
 249999720     gbcon141.seq
 126272309     gbcon142.seq
 250000136     gbcon143.seq
 249414186     gbcon144.seq
 244776550     gbcon145.seq
 244013501     gbcon146.seq
 249998477     gbcon147.seq
 249862330     gbcon148.seq
 249999408     gbcon149.seq
 246803299     gbcon15.seq
  85430345     gbcon150.seq
 249999726     gbcon151.seq
 249995400     gbcon152.seq
 249938140     gbcon153.seq
 249823095     gbcon154.seq
 249998079     gbcon155.seq
 250000171     gbcon156.seq
 249991985     gbcon157.seq
   6379456     gbcon158.seq
 249571833     gbcon159.seq
 249100615     gbcon16.seq
 250000176     gbcon160.seq
 249998570     gbcon161.seq
 249999696     gbcon162.seq
 131027908     gbcon163.seq
 249998889     gbcon164.seq
 249999227     gbcon165.seq
 249984889     gbcon166.seq
 249998349     gbcon167.seq
 249999997     gbcon168.seq
 249997574     gbcon169.seq
 240806932     gbcon17.seq
 249999400     gbcon170.seq
 163441051     gbcon171.seq
 249999170     gbcon172.seq
 249998894     gbcon173.seq
 249998022     gbcon174.seq
 249997221     gbcon175.seq
 168830239     gbcon176.seq
 250000153     gbcon177.seq
 249998233     gbcon178.seq
 249116844     gbcon179.seq
 245640514     gbcon18.seq
 249972961     gbcon180.seq
 249999905     gbcon181.seq
 249974478     gbcon182.seq
 249808266     gbcon183.seq
 249842269     gbcon184.seq
 249998535     gbcon185.seq
  66673812     gbcon186.seq
 250000186     gbcon187.seq
 249995593     gbcon188.seq
 249998057     gbcon189.seq
 249892001     gbcon19.seq
 249937042     gbcon190.seq
 250000201     gbcon191.seq
 249997666     gbcon192.seq
   3379171     gbcon193.seq
 249999690     gbcon194.seq
 249999180     gbcon195.seq
 249997731     gbcon196.seq
 249999441     gbcon197.seq
 147973187     gbcon198.seq
 249996910     gbcon199.seq
 249997663     gbcon2.seq
 244936010     gbcon20.seq
 249953516     gbcon200.seq
 249992681     gbcon201.seq
 249999916     gbcon202.seq
 249998973     gbcon203.seq
 249941414     gbcon204.seq
 249999113     gbcon205.seq
   7458120     gbcon206.seq
 249995329     gbcon207.seq
 249998874     gbcon208.seq
 249998513     gbcon209.seq
 245207861     gbcon21.seq
 249999827     gbcon210.seq
 198324129     gbcon211.seq
  44793208     gbcon212.seq
 249999960     gbcon213.seq
 249997460     gbcon214.seq
 249999952     gbcon215.seq
 249992457     gbcon216.seq
 249997971     gbcon217.seq
 177764167     gbcon218.seq
 249984336     gbcon219.seq
 248591316     gbcon22.seq
 249999681     gbcon220.seq
 249983055     gbcon221.seq
 249998933     gbcon222.seq
 249990936     gbcon223.seq
 249997185     gbcon224.seq
 152497079     gbcon225.seq
 249997803     gbcon226.seq
 249992491     gbcon227.seq
 249997847     gbcon228.seq
 249997197     gbcon229.seq
 249781623     gbcon23.seq
 216484831     gbcon230.seq
 249999114     gbcon231.seq
 249998526     gbcon232.seq
 249994517     gbcon233.seq
 200780658     gbcon234.seq
 249999188     gbcon235.seq
 249999634     gbcon236.seq
 249996225     gbcon237.seq
 249998520     gbcon238.seq
 249991860     gbcon239.seq
 153649198     gbcon24.seq
   3958814     gbcon240.seq
 249251508     gbcon241.seq
 249999672     gbcon242.seq
 250000157     gbcon243.seq
 249956956     gbcon244.seq
 249998926     gbcon245.seq
 249904953     gbcon246.seq
  92876563     gbcon247.seq
 249999092     gbcon248.seq
 249999464     gbcon249.seq
 249990197     gbcon25.seq
 250000234     gbcon250.seq
 249998082     gbcon251.seq
 151305618     gbcon252.seq
 249996164     gbcon253.seq
 249995728     gbcon254.seq
 249999414     gbcon255.seq
 249999259     gbcon256.seq
   8714040     gbcon257.seq
 249998262     gbcon258.seq
 249992859     gbcon259.seq
 249995972     gbcon26.seq
 249615947     gbcon260.seq
 249999025     gbcon261.seq
 249996876     gbcon262.seq
 175637906     gbcon263.seq
 249999844     gbcon264.seq
 249990963     gbcon265.seq
 249998896     gbcon266.seq
 249998666     gbcon267.seq
 250000091     gbcon268.seq
 104911921     gbcon269.seq
 249999688     gbcon27.seq
 250000006     gbcon270.seq
 249993928     gbcon271.seq
 249999642     gbcon272.seq
 249984872     gbcon273.seq
 249994238     gbcon274.seq
 104113954     gbcon275.seq
 249327116     gbcon276.seq
 249997399     gbcon277.seq
 249999344     gbcon278.seq
 249999564     gbcon279.seq
 249999838     gbcon28.seq
 184746884     gbcon280.seq
 250000025     gbcon281.seq
 249998630     gbcon282.seq
 249802308     gbcon283.seq
 249997831     gbcon284.seq
 249993757     gbcon285.seq
 249998471     gbcon286.seq
 129494379     gbcon287.seq
 249873034     gbcon288.seq
 249979533     gbcon289.seq
 249998707     gbcon29.seq
 249670066     gbcon290.seq
 249966235     gbcon291.seq
 249999947     gbcon292.seq
 249997141     gbcon293.seq
 249929697     gbcon294.seq
 191115726     gbcon295.seq
 249998874     gbcon296.seq
 250000045     gbcon297.seq
 249878867     gbcon298.seq
 249999488     gbcon299.seq
 249998894     gbcon3.seq
 249999347     gbcon30.seq
 249998198     gbcon300.seq
 186403692     gbcon301.seq
 249996828     gbcon302.seq
 249998585     gbcon303.seq
 249999314     gbcon304.seq
 249998749     gbcon305.seq
 249899951     gbcon306.seq
 249998098     gbcon307.seq
 247436823     gbcon308.seq
 250000253     gbcon309.seq
  81247390     gbcon31.seq
 250000174     gbcon310.seq
 250000096     gbcon311.seq
 249248548     gbcon312.seq
 249728950     gbcon313.seq
 249997860     gbcon314.seq
 249981081     gbcon315.seq
 249997346     gbcon316.seq
 166378375     gbcon317.seq
 249999458     gbcon318.seq
 249998177     gbcon319.seq
 249998890     gbcon32.seq
 249474148     gbcon320.seq
 249996231     gbcon321.seq
 125793795     gbcon322.seq
 249560188     gbcon323.seq
 249996386     gbcon324.seq
 249999193     gbcon325.seq
 249998147     gbcon326.seq
 249998835     gbcon327.seq
 249998602     gbcon328.seq
 249999122     gbcon329.seq
 249999804     gbcon33.seq
 103501979     gbcon330.seq
 249999069     gbcon331.seq
 249999875     gbcon332.seq
 249996947     gbcon333.seq
 249996117     gbcon334.seq
 249998256     gbcon335.seq
 249997172     gbcon336.seq
  19572273     gbcon337.seq
 249913609     gbcon338.seq
 249998392     gbcon339.seq
 249999148     gbcon34.seq
 250000105     gbcon340.seq
 249997396     gbcon341.seq
 249998030     gbcon342.seq
 249997956     gbcon343.seq
 249998202     gbcon344.seq
 249999524     gbcon345.seq
 249863107     gbcon346.seq
 249566976     gbcon347.seq
 249975107     gbcon348.seq
 131915178     gbcon349.seq
 249999869     gbcon35.seq
 250000041     gbcon350.seq
 249998616     gbcon351.seq
 249999761     gbcon352.seq
 249999436     gbcon353.seq
  37638463     gbcon354.seq
 249999246     gbcon355.seq
 249998030     gbcon356.seq
 250000149     gbcon357.seq
 249998460     gbcon358.seq
 249996825     gbcon359.seq
 247507218     gbcon36.seq
 249994963     gbcon360.seq
 249999605     gbcon361.seq
 249999633     gbcon362.seq
   2667331     gbcon363.seq
 250000086     gbcon364.seq
 249999738     gbcon365.seq
 249999991     gbcon366.seq
 249999337     gbcon367.seq
 250000061     gbcon368.seq
  77447496     gbcon369.seq
 248843076     gbcon37.seq
 249981802     gbcon38.seq
  38588250     gbcon39.seq
 249992348     gbcon4.seq
 249997284     gbcon40.seq
 249483168     gbcon41.seq
 125744383     gbcon42.seq
 126402369     gbcon43.seq
 249991267     gbcon44.seq
 249999122     gbcon45.seq
 249999517     gbcon46.seq
 249997898     gbcon47.seq
  26019784     gbcon48.seq
 249999520     gbcon49.seq
 249999588     gbcon5.seq
 250000158     gbcon50.seq
 249997942     gbcon51.seq
 249996661     gbcon52.seq
 249999447     gbcon53.seq
 197801884     gbcon54.seq
 249995009     gbcon55.seq
 249998243     gbcon56.seq
 249997153     gbcon57.seq
 249998312     gbcon58.seq
 249999774     gbcon59.seq
 249997128     gbcon6.seq
 249998166     gbcon60.seq
  41929642     gbcon61.seq
 249997971     gbcon62.seq
 249998523     gbcon63.seq
 249994641     gbcon64.seq
 249997127     gbcon65.seq
 249999662     gbcon66.seq
  27021264     gbcon67.seq
 249996783     gbcon68.seq
 249999817     gbcon69.seq
  92503332     gbcon7.seq
 249998382     gbcon70.seq
 249995556     gbcon71.seq
 249997081     gbcon72.seq
  20620805     gbcon73.seq
 249994608     gbcon74.seq
 249995334     gbcon75.seq
 249996443     gbcon76.seq
 249996717     gbcon77.seq
 249997080     gbcon78.seq
 135388982     gbcon79.seq
 249992520     gbcon8.seq
 249999204     gbcon80.seq
 249998450     gbcon81.seq
 249998272     gbcon82.seq
 249997459     gbcon83.seq
 176584001     gbcon84.seq
 249996314     gbcon85.seq
 249999452     gbcon86.seq
 249994925     gbcon87.seq
 249997508     gbcon88.seq
 238783867     gbcon89.seq
 249909238     gbcon9.seq
 249999844     gbcon90.seq
 249998048     gbcon91.seq
 250000106     gbcon92.seq
 249995283     gbcon93.seq
 249993884     gbcon94.seq
  85705140     gbcon95.seq
 249995498     gbcon96.seq
 249995014     gbcon97.seq
 249999777     gbcon98.seq
 249995148     gbcon99.seq
  32848403     gbdel.txt
 249998987     gbenv1.seq
 249997839     gbenv10.seq
 249998099     gbenv100.seq
 249999866     gbenv101.seq
 249999816     gbenv102.seq
 120127199     gbenv103.seq
 249997865     gbenv11.seq
 249999440     gbenv12.seq
  53621119     gbenv13.seq
 249998427     gbenv14.seq
 249998667     gbenv15.seq
 249997793     gbenv16.seq
 250000120     gbenv17.seq
 249999496     gbenv18.seq
 249999595     gbenv19.seq
 249998183     gbenv2.seq
 249999685     gbenv20.seq
 245223270     gbenv21.seq
 249999248     gbenv22.seq
 249999530     gbenv23.seq
 249998988     gbenv24.seq
 249999018     gbenv25.seq
 173516163     gbenv26.seq
 249998167     gbenv27.seq
 249999401     gbenv28.seq
 249999805     gbenv29.seq
 249997055     gbenv3.seq
 249999509     gbenv30.seq
 250000119     gbenv31.seq
 249999939     gbenv32.seq
  69907681     gbenv33.seq
 249997840     gbenv34.seq
 249998857     gbenv35.seq
 249998309     gbenv36.seq
 249998869     gbenv37.seq
 177715542     gbenv38.seq
 249999292     gbenv39.seq
 249998778     gbenv4.seq
 249999018     gbenv40.seq
 249999813     gbenv41.seq
 249999318     gbenv42.seq
 249999259     gbenv43.seq
 249998929     gbenv44.seq
  46071484     gbenv45.seq
 249998756     gbenv46.seq
 250000105     gbenv47.seq
 249999374     gbenv48.seq
 249997755     gbenv49.seq
 245253907     gbenv5.seq
 192032571     gbenv50.seq
 249999454     gbenv51.seq
 249999556     gbenv52.seq
 249999135     gbenv53.seq
 250000251     gbenv54.seq
 249999639     gbenv55.seq
  83181815     gbenv56.seq
 249999388     gbenv57.seq
 249999694     gbenv58.seq
 249956195     gbenv59.seq
 249998173     gbenv6.seq
 249998369     gbenv60.seq
 249999955     gbenv61.seq
 213318698     gbenv62.seq
 249999393     gbenv63.seq
 249997569     gbenv64.seq
 249999418     gbenv65.seq
 249999454     gbenv66.seq
 249999017     gbenv67.seq
  84660422     gbenv68.seq
 249999509     gbenv69.seq
 249999852     gbenv7.seq
 249999796     gbenv70.seq
 249984670     gbenv71.seq
 249999083     gbenv72.seq
 249999372     gbenv73.seq
 143640119     gbenv74.seq
 249997569     gbenv75.seq
 249999072     gbenv76.seq
 249999137     gbenv77.seq
 249999674     gbenv78.seq
 249999521     gbenv79.seq
 228267990     gbenv8.seq
  90200054     gbenv80.seq
 249998351     gbenv81.seq
 249999769     gbenv82.seq
 249999518     gbenv83.seq
 249999925     gbenv84.seq
 236538281     gbenv85.seq
 249999228     gbenv86.seq
 249999891     gbenv87.seq
 249999194     gbenv88.seq
 249998313     gbenv89.seq
 249998310     gbenv9.seq
 249998131     gbenv90.seq
 127827127     gbenv91.seq
 249999300     gbenv92.seq
 249999627     gbenv93.seq
 249999891     gbenv94.seq
 249998338     gbenv95.seq
 249999407     gbenv96.seq
 155242092     gbenv97.seq
 249997833     gbenv98.seq
 249999835     gbenv99.seq
 524292291     gbest1.seq
 524291471     gbest10.seq
 524291478     gbest100.seq
 524289445     gbest101.seq
 524290234     gbest102.seq
 524288978     gbest103.seq
 332614734     gbest104.seq
 524290182     gbest105.seq
 524290859     gbest106.seq
 524290670     gbest107.seq
 381846367     gbest108.seq
 385036642     gbest109.seq
 524289897     gbest11.seq
 379178955     gbest110.seq
 379762555     gbest111.seq
 376681647     gbest112.seq
 380970518     gbest113.seq
 385571277     gbest114.seq
 383979816     gbest115.seq
 383046098     gbest116.seq
 379514962     gbest117.seq
 402947158     gbest118.seq
 488301143     gbest119.seq
 524288937     gbest12.seq
 524288841     gbest120.seq
 524289115     gbest121.seq
 524289537     gbest122.seq
 524291898     gbest123.seq
 450350111     gbest124.seq
 524289351     gbest125.seq
 524288880     gbest126.seq
 524291239     gbest127.seq
 524290554     gbest128.seq
 524292134     gbest129.seq
 120885096     gbest13.seq
 524291919     gbest130.seq
 524289924     gbest131.seq
 524291061     gbest132.seq
 524288980     gbest133.seq
 524291735     gbest134.seq
 524291545     gbest135.seq
 524291801     gbest136.seq
 272229328     gbest137.seq
 524289390     gbest138.seq
 524291353     gbest139.seq
 524289175     gbest14.seq
 524291848     gbest140.seq
 524290999     gbest141.seq
 524291036     gbest142.seq
 524291519     gbest143.seq
 524290067     gbest144.seq
 524290907     gbest145.seq
 524290042     gbest146.seq
 524289401     gbest147.seq
 524289715     gbest148.seq
 524288782     gbest149.seq
 524289376     gbest15.seq
 524290467     gbest150.seq
 455902611     gbest151.seq
 524290870     gbest152.seq
 524290631     gbest153.seq
 524290294     gbest154.seq
 524290710     gbest155.seq
 524290741     gbest156.seq
 524290138     gbest157.seq
 524289839     gbest158.seq
 524292631     gbest159.seq
 524289477     gbest16.seq
 524289891     gbest160.seq
 524291982     gbest161.seq
 524291355     gbest162.seq
 524290535     gbest163.seq
 213205135     gbest164.seq
 524291768     gbest165.seq
 524290244     gbest166.seq
 524289675     gbest167.seq
 524290840     gbest168.seq
 524289869     gbest169.seq
 524289948     gbest17.seq
 524291907     gbest170.seq
 524289886     gbest171.seq
 524289194     gbest172.seq
 524289763     gbest173.seq
 524290844     gbest174.seq
 524289204     gbest175.seq
 524290677     gbest176.seq
 524291258     gbest177.seq
  68556994     gbest178.seq
 524290703     gbest179.seq
 524289545     gbest18.seq
 524290849     gbest180.seq
 524289166     gbest181.seq
 524289609     gbest182.seq
 524289672     gbest183.seq
 524290932     gbest184.seq
 524292683     gbest185.seq
 524290782     gbest186.seq
 524292253     gbest187.seq
 524291261     gbest188.seq
 524290031     gbest189.seq
 524290510     gbest19.seq
 524290538     gbest190.seq
 436155679     gbest191.seq
 524289597     gbest192.seq
 524290022     gbest193.seq
 524289573     gbest194.seq
 524291164     gbest195.seq
 524293030     gbest196.seq
 524289615     gbest197.seq
 524289933     gbest198.seq
 524289936     gbest199.seq
 524291401     gbest2.seq
 524290930     gbest20.seq
 524291147     gbest200.seq
 524290802     gbest201.seq
 524290023     gbest202.seq
 524290065     gbest203.seq
 524289121     gbest204.seq
  17790516     gbest205.seq
 524289211     gbest206.seq
 524289653     gbest207.seq
 524290915     gbest208.seq
 524289693     gbest209.seq
 524289084     gbest21.seq
 524289006     gbest210.seq
 524289760     gbest211.seq
 524289601     gbest212.seq
 524291843     gbest213.seq
 524289156     gbest214.seq
 524290607     gbest215.seq
 448386389     gbest216.seq
 524290389     gbest217.seq
 524289226     gbest218.seq
 524291079     gbest219.seq
 485444352     gbest22.seq
 524291215     gbest220.seq
 524292904     gbest221.seq
 524296900     gbest222.seq
 524292485     gbest223.seq
 524289435     gbest224.seq
 524290309     gbest225.seq
 524290371     gbest226.seq
 524290050     gbest227.seq
 524292186     gbest228.seq
 433006168     gbest229.seq
 491230689     gbest23.seq
 524290022     gbest230.seq
 524289115     gbest231.seq
 524290077     gbest232.seq
 524292632     gbest233.seq
 524290174     gbest234.seq
 524291139     gbest235.seq
 524291397     gbest236.seq
 524291122     gbest237.seq
 524289751     gbest238.seq
 524291226     gbest239.seq
 501187217     gbest24.seq
 524292483     gbest240.seq
 524291100     gbest241.seq
 524289406     gbest242.seq
 524290090     gbest243.seq
 223324497     gbest244.seq
 524290138     gbest245.seq
 524291581     gbest246.seq
 524290577     gbest247.seq
 524290240     gbest248.seq
 524291826     gbest249.seq
 314824082     gbest25.seq
 524290627     gbest250.seq
 524289604     gbest251.seq
 512724451     gbest252.seq
 524290083     gbest253.seq
 524289692     gbest254.seq
 524291321     gbest255.seq
 315449801     gbest256.seq
 524288782     gbest257.seq
 524290944     gbest258.seq
 524291108     gbest259.seq
 524289024     gbest26.seq
 524290631     gbest260.seq
 524290938     gbest261.seq
 524290305     gbest262.seq
 524290526     gbest263.seq
 524291235     gbest264.seq
 524290560     gbest265.seq
 524290274     gbest266.seq
 193970722     gbest267.seq
 524290377     gbest268.seq
 524290957     gbest269.seq
 524289200     gbest27.seq
 524288822     gbest270.seq
 524290838     gbest271.seq
 524290777     gbest272.seq
 524288844     gbest273.seq
 524289333     gbest274.seq
 524289405     gbest275.seq
 524291672     gbest276.seq
 524288986     gbest277.seq
 524289797     gbest278.seq
 345576777     gbest279.seq
 524290773     gbest28.seq
 524290664     gbest280.seq
 524291373     gbest281.seq
 524291168     gbest282.seq
 524290021     gbest283.seq
 524289400     gbest284.seq
 524288851     gbest285.seq
 524289748     gbest286.seq
 524291424     gbest287.seq
 524290255     gbest288.seq
 524288931     gbest289.seq
 524290709     gbest29.seq
 524288902     gbest290.seq
 262878119     gbest291.seq
 524292815     gbest292.seq
 524290733     gbest293.seq
 524290543     gbest294.seq
 524289818     gbest295.seq
 524289573     gbest296.seq
 524289892     gbest297.seq
 524290351     gbest298.seq
 524291102     gbest299.seq
 488606309     gbest3.seq
 524292999     gbest30.seq
 524289440     gbest300.seq
 524290445     gbest301.seq
 466965067     gbest302.seq
 306804712     gbest303.seq
 472922302     gbest304.seq
 470054216     gbest305.seq
 524290482     gbest306.seq
 524291658     gbest307.seq
 524290304     gbest308.seq
 524289194     gbest309.seq
 524289454     gbest31.seq
 524290592     gbest310.seq
 524291714     gbest311.seq
 524290965     gbest312.seq
 524289835     gbest313.seq
 524291946     gbest314.seq
 524289675     gbest315.seq
 360147313     gbest316.seq
 524291189     gbest317.seq
 524288759     gbest318.seq
 524289231     gbest319.seq
 524289152     gbest32.seq
 524288881     gbest320.seq
 524291223     gbest321.seq
 524292227     gbest322.seq
 524290667     gbest323.seq
 524288868     gbest324.seq
 524290507     gbest325.seq
 524290489     gbest326.seq
 524291562     gbest327.seq
 513867041     gbest328.seq
 514552993     gbest329.seq
 524290792     gbest33.seq
 206180962     gbest330.seq
 524290387     gbest331.seq
 524290225     gbest332.seq
 524291394     gbest333.seq
 524291239     gbest334.seq
 524289116     gbest335.seq
 524289400     gbest336.seq
 493768744     gbest337.seq
 524290610     gbest338.seq
 524292815     gbest339.seq
 505617506     gbest34.seq
 524291725     gbest340.seq
 524290681     gbest341.seq
 524288878     gbest342.seq
 524290245     gbest343.seq
 322980299     gbest344.seq
 524291419     gbest345.seq
 524292177     gbest346.seq
 524291273     gbest347.seq
 524289131     gbest348.seq
 524290658     gbest349.seq
 485167864     gbest35.seq
 524292587     gbest350.seq
 509032363     gbest351.seq
 524290696     gbest352.seq
 524294966     gbest353.seq
 524295623     gbest354.seq
 524288724     gbest355.seq
 524288876     gbest356.seq
 524291176     gbest357.seq
 524290102     gbest358.seq
 156161857     gbest359.seq
 486913273     gbest36.seq
 524291511     gbest360.seq
 524291960     gbest361.seq
 524290570     gbest362.seq
 524290406     gbest363.seq
 524290824     gbest364.seq
 524289054     gbest365.seq
 524290158     gbest366.seq
 524290239     gbest367.seq
 524288760     gbest368.seq
 524288942     gbest369.seq
 485869957     gbest37.seq
 524289516     gbest370.seq
  60832001     gbest371.seq
 524290023     gbest372.seq
 524289469     gbest373.seq
 524289563     gbest374.seq
 524290842     gbest375.seq
 524288894     gbest376.seq
 524289619     gbest377.seq
 486447893     gbest378.seq
 524292214     gbest379.seq
 480403390     gbest38.seq
 524291651     gbest380.seq
 524290652     gbest381.seq
 524289463     gbest382.seq
 246872526     gbest383.seq
 524290069     gbest384.seq
 524288862     gbest385.seq
 524290630     gbest386.seq
 524290248     gbest387.seq
 524289559     gbest388.seq
 524289814     gbest389.seq
 484812157     gbest39.seq
 524291293     gbest390.seq
 524290818     gbest391.seq
 524290166     gbest392.seq
 524288834     gbest393.seq
 143529456     gbest394.seq
 524291276     gbest395.seq
 524291502     gbest396.seq
 524292172     gbest397.seq
 524290195     gbest398.seq
 524290754     gbest399.seq
 524291691     gbest4.seq
 124817331     gbest40.seq
 524290261     gbest400.seq
 524289484     gbest401.seq
 524292275     gbest402.seq
 524291003     gbest403.seq
 524290495     gbest404.seq
 524289646     gbest405.seq
 524289988     gbest406.seq
 441347832     gbest407.seq
 524292668     gbest408.seq
 524291340     gbest409.seq
 524291523     gbest41.seq
 524290225     gbest410.seq
 524290513     gbest411.seq
 524289725     gbest412.seq
 524290127     gbest413.seq
 524289667     gbest414.seq
 524289660     gbest415.seq
 524289702     gbest416.seq
 524290207     gbest417.seq
 524291276     gbest418.seq
 524292519     gbest419.seq
 522434125     gbest42.seq
 502842123     gbest420.seq
 524288909     gbest421.seq
 524290151     gbest422.seq
 524290985     gbest423.seq
 524290082     gbest424.seq
 524288762     gbest425.seq
 524289820     gbest426.seq
 524291021     gbest427.seq
 524290234     gbest428.seq
 524290124     gbest429.seq
 524288933     gbest43.seq
 524291864     gbest430.seq
 524289688     gbest431.seq
 524289406     gbest432.seq
 524292230     gbest433.seq
 524289822     gbest434.seq
 174738890     gbest435.seq
 524288798     gbest436.seq
 524290900     gbest437.seq
 524293447     gbest438.seq
 524289909     gbest439.seq
 524290581     gbest44.seq
 524289544     gbest440.seq
 524290234     gbest441.seq
 524289155     gbest442.seq
 524291368     gbest443.seq
 524290261     gbest444.seq
 524290746     gbest445.seq
 524289622     gbest446.seq
 524291390     gbest447.seq
  89110620     gbest448.seq
 524291774     gbest449.seq
 524292873     gbest45.seq
 524290318     gbest450.seq
 524289187     gbest451.seq
 524289842     gbest452.seq
 524290606     gbest453.seq
 524290238     gbest454.seq
 524289573     gbest455.seq
 524289762     gbest456.seq
 524290825     gbest457.seq
 524291455     gbest458.seq
 524289285     gbest459.seq
 524289496     gbest46.seq
  31478357     gbest460.seq
 524290922     gbest461.seq
 524289749     gbest462.seq
 524289912     gbest463.seq
 524290972     gbest464.seq
 524290280     gbest465.seq
 524291108     gbest466.seq
 524289192     gbest467.seq
 524290610     gbest468.seq
 524291381     gbest469.seq
 524291814     gbest47.seq
 524291429     gbest470.seq
 524290617     gbest471.seq
  26712053     gbest472.seq
 524288784     gbest473.seq
 524288819     gbest474.seq
 524289487     gbest475.seq
 524290446     gbest476.seq
 524290542     gbest477.seq
 524291059     gbest478.seq
 524288839     gbest479.seq
 524290340     gbest48.seq
 524290230     gbest480.seq
 524289792     gbest481.seq
 524289333     gbest482.seq
 524289684     gbest483.seq
 471557751     gbest484.seq
 341415615     gbest485.seq
 524288981     gbest49.seq
 524291085     gbest5.seq
 524290483     gbest50.seq
 524289606     gbest51.seq
 524288809     gbest52.seq
 524289817     gbest53.seq
 221949415     gbest54.seq
 524291638     gbest55.seq
 524291124     gbest56.seq
 524290461     gbest57.seq
 524289085     gbest58.seq
 524291163     gbest59.seq
 524289212     gbest6.seq
 524291807     gbest60.seq
 524289382     gbest61.seq
 524290740     gbest62.seq
 524289808     gbest63.seq
 524290478     gbest64.seq
 524292075     gbest65.seq
 524289096     gbest66.seq
 427526430     gbest67.seq
 524292016     gbest68.seq
 524289325     gbest69.seq
 524289170     gbest7.seq
 524290971     gbest70.seq
 524290063     gbest71.seq
 524291132     gbest72.seq
 524290061     gbest73.seq
 524289983     gbest74.seq
 524289179     gbest75.seq
 524293696     gbest76.seq
 524288889     gbest77.seq
 524290248     gbest78.seq
 524291133     gbest79.seq
 524291146     gbest8.seq
 154072533     gbest80.seq
 524290785     gbest81.seq
 524290977     gbest82.seq
 524289274     gbest83.seq
 524288896     gbest84.seq
 524290588     gbest85.seq
 524290003     gbest86.seq
 524290102     gbest87.seq
 524290462     gbest88.seq
 524291341     gbest89.seq
 524289701     gbest9.seq
 524291066     gbest90.seq
 524290488     gbest91.seq
 429601031     gbest92.seq
 524291811     gbest93.seq
 524291491     gbest94.seq
 524288768     gbest95.seq
 524289800     gbest96.seq
 524291420     gbest97.seq
 524291930     gbest98.seq
 524290446     gbest99.seq
 524290275     gbgss1.seq
 524291955     gbgss10.seq
 524289867     gbgss100.seq
 524289266     gbgss101.seq
 524290051     gbgss102.seq
 524289370     gbgss103.seq
 385822709     gbgss104.seq
 524289760     gbgss105.seq
 524289666     gbgss106.seq
 524288896     gbgss107.seq
 524289249     gbgss108.seq
 524291060     gbgss109.seq
 524290034     gbgss11.seq
 524289126     gbgss110.seq
 524289522     gbgss111.seq
 524290540     gbgss112.seq
 524289172     gbgss113.seq
 524290447     gbgss114.seq
 524291424     gbgss115.seq
  20840761     gbgss116.seq
 524290969     gbgss117.seq
 524290528     gbgss118.seq
 524291238     gbgss119.seq
 524292471     gbgss12.seq
 524289771     gbgss120.seq
 524288914     gbgss121.seq
 524290289     gbgss122.seq
 524288765     gbgss123.seq
 524290710     gbgss124.seq
 524290152     gbgss125.seq
 524289230     gbgss126.seq
 524292768     gbgss127.seq
 524291188     gbgss128.seq
 195671683     gbgss129.seq
 524289623     gbgss13.seq
 524290524     gbgss130.seq
 524289008     gbgss131.seq
 524291005     gbgss132.seq
 524290542     gbgss133.seq
 524290073     gbgss134.seq
 524291634     gbgss135.seq
 524289265     gbgss136.seq
 524289367     gbgss137.seq
 524290285     gbgss138.seq
 518521767     gbgss139.seq
 524291518     gbgss14.seq
 494778922     gbgss140.seq
 216702281     gbgss141.seq
 524290020     gbgss142.seq
 524288955     gbgss143.seq
 524289401     gbgss144.seq
 524290986     gbgss145.seq
 524288755     gbgss146.seq
 524291631     gbgss147.seq
 524290026     gbgss148.seq
 524290877     gbgss149.seq
 524289933     gbgss15.seq
 524290267     gbgss150.seq
 524290109     gbgss151.seq
 319629208     gbgss152.seq
 524291721     gbgss153.seq
 524289918     gbgss154.seq
 524289613     gbgss155.seq
 524290653     gbgss156.seq
 524289736     gbgss157.seq
 524290027     gbgss158.seq
 524290399     gbgss159.seq
 524290092     gbgss16.seq
 524290208     gbgss160.seq
 524290044     gbgss161.seq
 524290580     gbgss162.seq
 524289237     gbgss163.seq
 524291249     gbgss164.seq
 138542518     gbgss165.seq
 524289377     gbgss166.seq
 524292023     gbgss167.seq
 524290138     gbgss168.seq
 524290472     gbgss169.seq
 524290859     gbgss17.seq
 524289131     gbgss170.seq
 524291211     gbgss171.seq
 524290285     gbgss172.seq
 524290055     gbgss173.seq
 524289903     gbgss174.seq
 524290443     gbgss175.seq
 371905609     gbgss176.seq
 524289061     gbgss177.seq
  71132891     gbgss178.seq
 249999307     gbgss179.seq
 524291325     gbgss18.seq
 249999803     gbgss180.seq
 249999034     gbgss181.seq
 250000188     gbgss182.seq
  27270082     gbgss183.seq
 250000220     gbgss184.seq
 249999312     gbgss185.seq
 249997128     gbgss186.seq
 249998262     gbgss187.seq
 219536183     gbgss188.seq
 250000046     gbgss189.seq
 279090585     gbgss19.seq
 249997736     gbgss190.seq
 249999841     gbgss191.seq
 249999021     gbgss192.seq
 189705997     gbgss193.seq
 249999911     gbgss194.seq
 249997779     gbgss195.seq
 249998992     gbgss196.seq
 249997543     gbgss197.seq
 249998328     gbgss198.seq
  66166938     gbgss199.seq
 524291621     gbgss2.seq
 524291499     gbgss20.seq
 249998062     gbgss200.seq
    542128     gbgss201.seq
  80022020     gbgss202.seq
 250000228     gbgss203.seq
 249999996     gbgss204.seq
  84490531     gbgss205.seq
 249998087     gbgss206.seq
 249999221     gbgss207.seq
 249998781     gbgss208.seq
 197045515     gbgss209.seq
 524290645     gbgss21.seq
 249999644     gbgss210.seq
 250000078     gbgss211.seq
 249998943     gbgss212.seq
 241194397     gbgss213.seq
 249998895     gbgss214.seq
 249998646     gbgss215.seq
 249999899     gbgss216.seq
 239478749     gbgss217.seq
 249999622     gbgss218.seq
 249996865     gbgss219.seq
 524289701     gbgss22.seq
 249999649     gbgss220.seq
 250000226     gbgss221.seq
 121271948     gbgss222.seq
 249999870     gbgss223.seq
 250000164     gbgss224.seq
 249998650     gbgss225.seq
 249998378     gbgss226.seq
  86638471     gbgss227.seq
 249999180     gbgss228.seq
 250000196     gbgss229.seq
 524290729     gbgss23.seq
 249998742     gbgss230.seq
 249998926     gbgss231.seq
 249999544     gbgss232.seq
 137865838     gbgss233.seq
 249999577     gbgss234.seq
 249999925     gbgss235.seq
 249999323     gbgss236.seq
 249997632     gbgss237.seq
  79228653     gbgss238.seq
 249997675     gbgss239.seq
 524289994     gbgss24.seq
 249998339     gbgss240.seq
 249999331     gbgss241.seq
 249999245     gbgss242.seq
 249997693     gbgss243.seq
 249999721     gbgss244.seq
  99660048     gbgss245.seq
 249998155     gbgss246.seq
 249999580     gbgss247.seq
 249999271     gbgss248.seq
  52447926     gbgss249.seq
 524289323     gbgss25.seq
  53076689     gbgss250.seq
 249998109     gbgss251.seq
 249998073     gbgss252.seq
 249999880     gbgss253.seq
 249999725     gbgss254.seq
 249998744     gbgss255.seq
 249997664     gbgss256.seq
 211852026     gbgss257.seq
 249997890     gbgss258.seq
 249999836     gbgss259.seq
 524289046     gbgss26.seq
 249998514     gbgss260.seq
 249998986     gbgss261.seq
  21316342     gbgss262.seq
 249997567     gbgss263.seq
 249999132     gbgss264.seq
 249996572     gbgss265.seq
 249998435     gbgss266.seq
 249997631     gbgss267.seq
 249998992     gbgss268.seq
 181964370     gbgss269.seq
 524289049     gbgss27.seq
 249998672     gbgss270.seq
 250000165     gbgss271.seq
 250000243     gbgss272.seq
 221699337     gbgss273.seq
 249999134     gbgss274.seq
 249998851     gbgss275.seq
 249998700     gbgss276.seq
 249999839     gbgss277.seq
 249999513     gbgss278.seq
 249999543     gbgss279.seq
 524290385     gbgss28.seq
 145308699     gbgss280.seq
 249997149     gbgss281.seq
 249998191     gbgss282.seq
 249999087     gbgss283.seq
 249998744     gbgss284.seq
 227218278     gbgss285.seq
 249997931     gbgss286.seq
 249997185     gbgss287.seq
 249999114     gbgss288.seq
 249999909     gbgss289.seq
 524289541     gbgss29.seq
 249998098     gbgss290.seq
 116181294     gbgss291.seq
 249999837     gbgss292.seq
 249998408     gbgss293.seq
 249998054     gbgss294.seq
 249997635     gbgss295.seq
 215534679     gbgss296.seq
 249998609     gbgss297.seq
 249998604     gbgss298.seq
 249999576     gbgss299.seq
 524289224     gbgss3.seq
 524289539     gbgss30.seq
 249998662     gbgss300.seq
  85129549     gbgss301.seq
 249999096     gbgss302.seq
 249998187     gbgss303.seq
 249997655     gbgss304.seq
 249997711     gbgss305.seq
 249998095     gbgss306.seq
 249998419     gbgss307.seq
 133619126     gbgss308.seq
  38127171     gbgss31.seq
 524290692     gbgss32.seq
 524289403     gbgss33.seq
 524290861     gbgss34.seq
 524289081     gbgss35.seq
 524290990     gbgss36.seq
 524289827     gbgss37.seq
 524290883     gbgss38.seq
 489544680     gbgss39.seq
 524289671     gbgss4.seq
 524289577     gbgss40.seq
 524291345     gbgss41.seq
 524290785     gbgss42.seq
  25535202     gbgss43.seq
 524289747     gbgss44.seq
 524290378     gbgss45.seq
 524291521     gbgss46.seq
 524289643     gbgss47.seq
 233018261     gbgss48.seq
 524288807     gbgss49.seq
 151399857     gbgss5.seq
 524289400     gbgss50.seq
 524290207     gbgss51.seq
 524290841     gbgss52.seq
 524290825     gbgss53.seq
 524290689     gbgss54.seq
 524291111     gbgss55.seq
 524289811     gbgss56.seq
 524290595     gbgss57.seq
 524289448     gbgss58.seq
 524291684     gbgss59.seq
 524291679     gbgss6.seq
  25910731     gbgss60.seq
 524289593     gbgss61.seq
 524290025     gbgss62.seq
 524291204     gbgss63.seq
 452380934     gbgss64.seq
 524289916     gbgss65.seq
 524291744     gbgss66.seq
 524289344     gbgss67.seq
 524290058     gbgss68.seq
 524289670     gbgss69.seq
 524289760     gbgss7.seq
 524289792     gbgss70.seq
 524291092     gbgss71.seq
 524289554     gbgss72.seq
 524291553     gbgss73.seq
 524289045     gbgss74.seq
 524290003     gbgss75.seq
 524288912     gbgss76.seq
  51041476     gbgss77.seq
 524289273     gbgss78.seq
 524289689     gbgss79.seq
 524291187     gbgss8.seq
 524290773     gbgss80.seq
 524288959     gbgss81.seq
 524289606     gbgss82.seq
 524291532     gbgss83.seq
 524292100     gbgss84.seq
 524289958     gbgss85.seq
 524290817     gbgss86.seq
 524291513     gbgss87.seq
 524289279     gbgss88.seq
 381339318     gbgss89.seq
 524290755     gbgss9.seq
 524290979     gbgss90.seq
 524290405     gbgss91.seq
 524291434     gbgss92.seq
 524289231     gbgss93.seq
 524289414     gbgss94.seq
 524292071     gbgss95.seq
 524288954     gbgss96.seq
 524291454     gbgss97.seq
 524291567     gbgss98.seq
 524289220     gbgss99.seq
 249995862     gbhtc1.seq
 249996894     gbhtc10.seq
 249997988     gbhtc11.seq
 187660220     gbhtc12.seq
 249999169     gbhtc13.seq
 249998046     gbhtc14.seq
 155979693     gbhtc15.seq
 249995478     gbhtc2.seq
 249991894     gbhtc3.seq
 249985970     gbhtc4.seq
 249999048     gbhtc5.seq
 249987440     gbhtc6.seq
 249996035     gbhtc7.seq
  80798178     gbhtc8.seq
 249998827     gbhtc9.seq
 249919103     gbhtg1.seq
 249935336     gbhtg10.seq
 249898506     gbhtg100.seq
 249852504     gbhtg101.seq
 249535042     gbhtg102.seq
 249887166     gbhtg103.seq
   3688130     gbhtg104.seq
 249798859     gbhtg105.seq
 249998294     gbhtg106.seq
 249949751     gbhtg107.seq
 249916394     gbhtg108.seq
 249978605     gbhtg109.seq
    799292     gbhtg11.seq
 249896195     gbhtg110.seq
 167433043     gbhtg111.seq
 249850870     gbhtg112.seq
 249939795     gbhtg113.seq
 249869598     gbhtg114.seq
 249906673     gbhtg115.seq
 249768916     gbhtg116.seq
 249967908     gbhtg117.seq
 249944117     gbhtg118.seq
 219057303     gbhtg119.seq
 249867576     gbhtg12.seq
 249986066     gbhtg120.seq
 249896587     gbhtg121.seq
 249935778     gbhtg122.seq
 249900357     gbhtg123.seq
 249891139     gbhtg124.seq
 249797886     gbhtg125.seq
 249847034     gbhtg126.seq
 249920794     gbhtg127.seq
 249887387     gbhtg128.seq
 249878396     gbhtg129.seq
 249953697     gbhtg13.seq
 249892198     gbhtg130.seq
 144800589     gbhtg131.seq
 249890602     gbhtg132.seq
 249895390     gbhtg133.seq
 249844710     gbhtg134.seq
 249988579     gbhtg135.seq
 249862660     gbhtg136.seq
 135815749     gbhtg137.seq
 249905628     gbhtg138.seq
 249808330     gbhtg139.seq
 249995099     gbhtg14.seq
 249958007     gbhtg140.seq
 249697484     gbhtg141.seq
 249816953     gbhtg142.seq
 134304697     gbhtg143.seq
 249939319     gbhtg144.seq
 249796848     gbhtg145.seq
 249816843     gbhtg146.seq
 249884829     gbhtg147.seq
 249747665     gbhtg148.seq
 249922755     gbhtg149.seq
 249938964     gbhtg15.seq
 249831405     gbhtg150.seq
 249900380     gbhtg151.seq
 249955029     gbhtg152.seq
 249829301     gbhtg153.seq
 249944800     gbhtg154.seq
   9240611     gbhtg155.seq
 249750336     gbhtg16.seq
 249774726     gbhtg17.seq
 249714731     gbhtg18.seq
 249957759     gbhtg19.seq
 249965174     gbhtg2.seq
 249931734     gbhtg20.seq
 235850971     gbhtg21.seq
 249743613     gbhtg22.seq
 249849760     gbhtg23.seq
 249968489     gbhtg24.seq
 249904378     gbhtg25.seq
 249743777     gbhtg26.seq
 249872278     gbhtg27.seq
 249943100     gbhtg28.seq
 249821972     gbhtg29.seq
 249990925     gbhtg3.seq
 249974297     gbhtg30.seq
 225307913     gbhtg31.seq
 249988250     gbhtg32.seq
 249721384     gbhtg33.seq
 249910646     gbhtg34.seq
 249900069     gbhtg35.seq
 249839995     gbhtg36.seq
 249796553     gbhtg37.seq
 249749194     gbhtg38.seq
 249608093     gbhtg39.seq
 249912663     gbhtg4.seq
 249819463     gbhtg40.seq
 224341330     gbhtg41.seq
 249988697     gbhtg42.seq
 249929499     gbhtg43.seq
 249878159     gbhtg44.seq
 249894493     gbhtg45.seq
 249780350     gbhtg46.seq
 249512030     gbhtg47.seq
 249848792     gbhtg48.seq
 249876917     gbhtg49.seq
 249892800     gbhtg5.seq
 249885018     gbhtg50.seq
 234804693     gbhtg51.seq
 249991982     gbhtg52.seq
 249969628     gbhtg53.seq
 249777162     gbhtg54.seq
 249928077     gbhtg55.seq
 249738038     gbhtg56.seq
  18488541     gbhtg57.seq
 249846209     gbhtg58.seq
 249813649     gbhtg59.seq
 249976698     gbhtg6.seq
 249982652     gbhtg60.seq
 249907805     gbhtg61.seq
 225115632     gbhtg62.seq
 249868960     gbhtg63.seq
 249892184     gbhtg64.seq
 249989957     gbhtg65.seq
 249828872     gbhtg66.seq
 249951490     gbhtg67.seq
  15793409     gbhtg68.seq
 249969504     gbhtg69.seq
 249792412     gbhtg7.seq
 249868114     gbhtg70.seq
 249949360     gbhtg71.seq
 249752681     gbhtg72.seq
 223399956     gbhtg73.seq
 249931880     gbhtg74.seq
 249870863     gbhtg75.seq
 249834885     gbhtg76.seq
 249935383     gbhtg77.seq
 235157815     gbhtg78.seq
 249863725     gbhtg79.seq
 249808933     gbhtg8.seq
 249962382     gbhtg80.seq
 249850580     gbhtg81.seq
 249876768     gbhtg82.seq
 202286158     gbhtg83.seq
 249854884     gbhtg84.seq
 249932273     gbhtg85.seq
 249851304     gbhtg86.seq
 249870067     gbhtg87.seq
 206005794     gbhtg88.seq
 249874212     gbhtg89.seq
 249937013     gbhtg9.seq
 249860356     gbhtg90.seq
 249764128     gbhtg91.seq
 249875964     gbhtg92.seq
 194399433     gbhtg93.seq
 249959164     gbhtg94.seq
 249968525     gbhtg95.seq
 249861046     gbhtg96.seq
 249784880     gbhtg97.seq
 161649769     gbhtg98.seq
 249859601     gbhtg99.seq
 249996835     gbinv1.seq
 249997098     gbinv10.seq
 246458874     gbinv100.seq
 247926198     gbinv101.seq
 111121411     gbinv102.seq
 249999908     gbinv103.seq
 249997123     gbinv104.seq
 249997815     gbinv105.seq
 250000110     gbinv106.seq
 249998999     gbinv107.seq
 135087474     gbinv108.seq
 246473213     gbinv11.seq
 249934189     gbinv12.seq
 226516876     gbinv13.seq
 248469141     gbinv14.seq
 250000062     gbinv15.seq
 249999266     gbinv16.seq
  88291647     gbinv17.seq
 249997396     gbinv18.seq
 249997506     gbinv19.seq
 249785245     gbinv2.seq
 249996570     gbinv20.seq
 153750887     gbinv21.seq
 249394828     gbinv22.seq
 247814048     gbinv23.seq
 249999979     gbinv24.seq
 249854910     gbinv25.seq
 248131620     gbinv26.seq
 231050115     gbinv27.seq
 175319053     gbinv28.seq
 249998123     gbinv29.seq
 249891316     gbinv3.seq
 250000220     gbinv30.seq
 249999666     gbinv31.seq
  11854732     gbinv32.seq
 249998863     gbinv33.seq
 249996760     gbinv34.seq
 249999128     gbinv35.seq
 249997327     gbinv36.seq
 249999065     gbinv37.seq
   7767036     gbinv38.seq
 249998525     gbinv39.seq
 202823890     gbinv4.seq
 249999759     gbinv40.seq
 250000263     gbinv41.seq
 249999163     gbinv42.seq
 173511776     gbinv43.seq
 249999473     gbinv44.seq
 249997124     gbinv45.seq
 249999648     gbinv46.seq
 249998352     gbinv47.seq
 115730874     gbinv48.seq
 249998253     gbinv49.seq
 249997277     gbinv5.seq
 249997734     gbinv50.seq
 249998425     gbinv51.seq
 249999730     gbinv52.seq
 101088304     gbinv53.seq
 249999210     gbinv54.seq
 249998956     gbinv55.seq
 249998928     gbinv56.seq
 249999534     gbinv57.seq
 106242289     gbinv58.seq
 249996998     gbinv59.seq
 250000186     gbinv6.seq
 249997401     gbinv60.seq
 249997094     gbinv61.seq
 249997945     gbinv62.seq
 187776138     gbinv63.seq
 249998155     gbinv64.seq
 249998101     gbinv65.seq
 249997877     gbinv66.seq
 249999580     gbinv67.seq
 223388810     gbinv68.seq
 249999763     gbinv69.seq
 249999301     gbinv7.seq
 249979520     gbinv70.seq
 249997782     gbinv71.seq
 250000088     gbinv72.seq
 249999838     gbinv73.seq
 249536136     gbinv74.seq
 249999161     gbinv75.seq
  24278458     gbinv76.seq
 249999804     gbinv77.seq
 249999334     gbinv78.seq
 249998579     gbinv79.seq
 249997867     gbinv8.seq
 195993243     gbinv80.seq
 242954427     gbinv81.seq
  61014068     gbinv82.seq
  54947886     gbinv83.seq
  52917686     gbinv84.seq
 156788939     gbinv85.seq
 249983717     gbinv86.seq
 249987661     gbinv87.seq
 250000011     gbinv88.seq
  13298097     gbinv89.seq
 138259393     gbinv9.seq
 249999292     gbinv90.seq
 249999528     gbinv91.seq
 249999497     gbinv92.seq
 249998460     gbinv93.seq
 172341791     gbinv94.seq
 249999187     gbinv95.seq
 249363278     gbinv96.seq
 239262607     gbinv97.seq
 248216883     gbinv98.seq
 248546313     gbinv99.seq
 249715052     gbmam1.seq
 338653931     gbmam10.seq
 315434407     gbmam11.seq
 162425847     gbmam12.seq
 150157334     gbmam13.seq
 159032538     gbmam14.seq
 136269230     gbmam15.seq
 122412955     gbmam16.seq
 248159396     gbmam17.seq
 202955071     gbmam18.seq
 208310866     gbmam19.seq
 249999644     gbmam2.seq
 209752346     gbmam20.seq
 197940543     gbmam21.seq
 230561841     gbmam22.seq
 220222444     gbmam23.seq
 123191120     gbmam24.seq
 190279404     gbmam25.seq
 195995383     gbmam26.seq
 174515534     gbmam27.seq
 149170534     gbmam28.seq
 145602287     gbmam29.seq
  84490804     gbmam3.seq
 151524132     gbmam30.seq
 131892622     gbmam31.seq
 166263689     gbmam32.seq
 132948664     gbmam33.seq
 178685080     gbmam34.seq
 197788353     gbmam35.seq
 206568488     gbmam36.seq
 242409571     gbmam37.seq
 220443672     gbmam38.seq
 213549561     gbmam39.seq
  82811153     gbmam4.seq
 247368706     gbmam40.seq
 179287074     gbmam41.seq
   9943428     gbmam42.seq
  43989127     gbmam43.seq
  91322474     gbmam44.seq
  88810705     gbmam45.seq
   6365611     gbmam46.seq
  20918340     gbmam47.seq
 249999423     gbmam48.seq
 199541519     gbmam49.seq
  71295407     gbmam5.seq
 249998929     gbmam50.seq
 249968609     gbmam51.seq
 249997973     gbmam52.seq
 249991899     gbmam53.seq
 233732222     gbmam54.seq
 177359267     gbmam55.seq
  22570875     gbmam6.seq
   1268605     gbmam7.seq
   2477678     gbmam8.seq
 375834657     gbmam9.seq
  24177924     gbnew.txt
 249999742     gbpat1.seq
 249999845     gbpat10.seq
 249998963     gbpat100.seq
 249999641     gbpat101.seq
 249999965     gbpat102.seq
 249999455     gbpat103.seq
 137267099     gbpat104.seq
 250000015     gbpat105.seq
 249999153     gbpat106.seq
 249888679     gbpat107.seq
 249749771     gbpat108.seq
 250000144     gbpat109.seq
 168190468     gbpat11.seq
 179846740     gbpat110.seq
 250000043     gbpat111.seq
 249999494     gbpat112.seq
 249997096     gbpat113.seq
  70391857     gbpat114.seq
 249999852     gbpat115.seq
 249998905     gbpat116.seq
 249695789     gbpat117.seq
 249999993     gbpat118.seq
 249999110     gbpat119.seq
 249998227     gbpat12.seq
  55704446     gbpat120.seq
 249999350     gbpat121.seq
 249999805     gbpat122.seq
 249999831     gbpat123.seq
 249998300     gbpat124.seq
 144919044     gbpat125.seq
 249999927     gbpat126.seq
 249999834     gbpat127.seq
 226235203     gbpat128.seq
 249966117     gbpat129.seq
 249999567     gbpat13.seq
 249976912     gbpat130.seq
 249999729     gbpat131.seq
 249998903     gbpat132.seq
 249998034     gbpat133.seq
  59559800     gbpat134.seq
 249995969     gbpat135.seq
 249995285     gbpat136.seq
 249998740     gbpat137.seq
 249998430     gbpat138.seq
 249999159     gbpat139.seq
 249998560     gbpat14.seq
   9607227     gbpat140.seq
 249999998     gbpat141.seq
 249998686     gbpat142.seq
 249999576     gbpat143.seq
 249998604     gbpat144.seq
  36785302     gbpat145.seq
 249995259     gbpat146.seq
 249999971     gbpat147.seq
 249999853     gbpat148.seq
 224419737     gbpat149.seq
 249996595     gbpat15.seq
 249999338     gbpat150.seq
 249999887     gbpat151.seq
 249999564     gbpat152.seq
  75491672     gbpat153.seq
 249999318     gbpat154.seq
 250000002     gbpat155.seq
 249999740     gbpat156.seq
  55090875     gbpat157.seq
 249998017     gbpat158.seq
 250000200     gbpat159.seq
 250000152     gbpat16.seq
 250000248     gbpat160.seq
 249999329     gbpat161.seq
 249998924     gbpat162.seq
 249997016     gbpat163.seq
 202385090     gbpat164.seq
 250000181     gbpat165.seq
 249999529     gbpat166.seq
 249999529     gbpat167.seq
 205870569     gbpat168.seq
 249999373     gbpat169.seq
  66935351     gbpat17.seq
 249999431     gbpat170.seq
 249999678     gbpat171.seq
   2029303     gbpat172.seq
 249998971     gbpat173.seq
 249996376     gbpat174.seq
 249999489     gbpat175.seq
 249997869     gbpat176.seq
  81953257     gbpat177.seq
 249999232     gbpat178.seq
 249999933     gbpat179.seq
 249998753     gbpat18.seq
 249999839     gbpat180.seq
 248237643     gbpat181.seq
 249998773     gbpat182.seq
 249999109     gbpat183.seq
 249998937     gbpat184.seq
 250000075     gbpat185.seq
 248566246     gbpat186.seq
 249998056     gbpat187.seq
 230155279     gbpat188.seq
 250000241     gbpat189.seq
 249999427     gbpat19.seq
 249998973     gbpat190.seq
 249997114     gbpat191.seq
 250000182     gbpat192.seq
 249999162     gbpat193.seq
 249999322     gbpat194.seq
 249998718     gbpat195.seq
  85324625     gbpat196.seq
 249998863     gbpat197.seq
 249998474     gbpat198.seq
 249999138     gbpat199.seq
 249998973     gbpat2.seq
 249999265     gbpat20.seq
 249999449     gbpat200.seq
 207988412     gbpat201.seq
 249999722     gbpat202.seq
 249857963     gbpat203.seq
 249994216     gbpat204.seq
 249998130     gbpat205.seq
 174001805     gbpat206.seq
 249988465     gbpat207.seq
 250000151     gbpat208.seq
 249999438     gbpat209.seq
 249999211     gbpat21.seq
 249998572     gbpat210.seq
 249998928     gbpat211.seq
 249999475     gbpat212.seq
   8448545     gbpat213.seq
 249998572     gbpat214.seq
 249659866     gbpat215.seq
 249999934     gbpat216.seq
 132772292     gbpat217.seq
 249999588     gbpat218.seq
 249997972     gbpat219.seq
 179041317     gbpat22.seq
 249997783     gbpat220.seq
 249999208     gbpat221.seq
 249995993     gbpat222.seq
 249997662     gbpat223.seq
 250000202     gbpat224.seq
 250000248     gbpat225.seq
  56242960     gbpat226.seq
 249999673     gbpat227.seq
 249989218     gbpat228.seq
 249998307     gbpat229.seq
 249999721     gbpat23.seq
 249997672     gbpat230.seq
 208385420     gbpat231.seq
 249999385     gbpat232.seq
 250000247     gbpat233.seq
 249998575     gbpat234.seq
 250000112     gbpat235.seq
  57204991     gbpat236.seq
 249999909     gbpat237.seq
 249997403     gbpat238.seq
 249997388     gbpat239.seq
 249993019     gbpat24.seq
 249997616     gbpat240.seq
 249997564     gbpat241.seq
 237291371     gbpat242.seq
 249999914     gbpat243.seq
 249998584     gbpat244.seq
 249998866     gbpat245.seq
 249999571     gbpat246.seq
  25824641     gbpat247.seq
 249999458     gbpat248.seq
 249991306     gbpat249.seq
 249999228     gbpat25.seq
 249999863     gbpat250.seq
 135111998     gbpat251.seq
 249980963     gbpat252.seq
 249999989     gbpat253.seq
 250000225     gbpat254.seq
 250000225     gbpat255.seq
 148497227     gbpat256.seq
 249999032     gbpat257.seq
 250000018     gbpat258.seq
 249999574     gbpat259.seq
 249999441     gbpat26.seq
  64423759     gbpat260.seq
 249999027     gbpat261.seq
 249989619     gbpat262.seq
 249998962     gbpat263.seq
 249981586     gbpat264.seq
 249999491     gbpat265.seq
 159538878     gbpat266.seq
 249999492     gbpat267.seq
 249998152     gbpat268.seq
 249999483     gbpat269.seq
  62270827     gbpat27.seq
 249988141     gbpat270.seq
 125941966     gbpat271.seq
 249998964     gbpat272.seq
 249990860     gbpat273.seq
 249996353     gbpat274.seq
 249996754     gbpat275.seq
 249995718     gbpat276.seq
 249998309     gbpat277.seq
 249996432     gbpat278.seq
 249995570     gbpat279.seq
 249997265     gbpat28.seq
 169824995     gbpat280.seq
 249998984     gbpat281.seq
 249999538     gbpat282.seq
 249996738     gbpat283.seq
 175272980     gbpat284.seq
 249999299     gbpat285.seq
 249998705     gbpat286.seq
 249999850     gbpat287.seq
 249999883     gbpat288.seq
 249999311     gbpat289.seq
 249999931     gbpat29.seq
 249838671     gbpat290.seq
 248658359     gbpat291.seq
 104796870     gbpat292.seq
 249997973     gbpat293.seq
 249992798     gbpat294.seq
 250000146     gbpat295.seq
 249999567     gbpat296.seq
 176159629     gbpat297.seq
 249997533     gbpat298.seq
 249999844     gbpat299.seq
 250000047     gbpat3.seq
 250000021     gbpat30.seq
 249998892     gbpat300.seq
 249998625     gbpat301.seq
 250000073     gbpat302.seq
 249998597     gbpat303.seq
 100300068     gbpat304.seq
 249998886     gbpat305.seq
 249999596     gbpat306.seq
 249994400     gbpat307.seq
 249996528     gbpat308.seq
 249997485     gbpat309.seq
 250000141     gbpat31.seq
 249999753     gbpat310.seq
 249999952     gbpat311.seq
 250000242     gbpat312.seq
 250000225     gbpat313.seq
  51653377     gbpat314.seq
 249998897     gbpat315.seq
 249981992     gbpat316.seq
 249996676     gbpat317.seq
 249997685     gbpat318.seq
 249998618     gbpat319.seq
 249999487     gbpat32.seq
 249999619     gbpat320.seq
 249999671     gbpat321.seq
 249999145     gbpat322.seq
 228317481     gbpat323.seq
 249999683     gbpat324.seq
 247266865     gbpat325.seq
 244213826     gbpat326.seq
 249997145     gbpat327.seq
 250000185     gbpat328.seq
 249998573     gbpat329.seq
 171720969     gbpat33.seq
 249999999     gbpat330.seq
 247683950     gbpat331.seq
 249998149     gbpat332.seq
 249999943     gbpat333.seq
 249999425     gbpat334.seq
 249999644     gbpat335.seq
 249999774     gbpat336.seq
 153301072     gbpat337.seq
 249999048     gbpat34.seq
 249751296     gbpat35.seq
 250000170     gbpat36.seq
 249999819     gbpat37.seq
 249999602     gbpat38.seq
 249999430     gbpat39.seq
 249999549     gbpat4.seq
 249876988     gbpat40.seq
  91529369     gbpat41.seq
 249999939     gbpat42.seq
 249906739     gbpat43.seq
 250000067     gbpat44.seq
 249999726     gbpat45.seq
 249999047     gbpat46.seq
 249766282     gbpat47.seq
 249999760     gbpat48.seq
 246849861     gbpat49.seq
  61168666     gbpat5.seq
 161790474     gbpat50.seq
 249999577     gbpat51.seq
 249999804     gbpat52.seq
 249999700     gbpat53.seq
 249999646     gbpat54.seq
 213206429     gbpat55.seq
 250000030     gbpat56.seq
 250000009     gbpat57.seq
 249999551     gbpat58.seq
 155999827     gbpat59.seq
 249999674     gbpat6.seq
 250000240     gbpat60.seq
 249998241     gbpat61.seq
 249998859     gbpat62.seq
 249999668     gbpat63.seq
 125160270     gbpat64.seq
 249996507     gbpat65.seq
 249999556     gbpat66.seq
 249998622     gbpat67.seq
 249997829     gbpat68.seq
 249998957     gbpat69.seq
 249999362     gbpat7.seq
 249999723     gbpat70.seq
 135705288     gbpat71.seq
 249999622     gbpat72.seq
 249999332     gbpat73.seq
 250000167     gbpat74.seq
 248918247     gbpat75.seq
 248123146     gbpat76.seq
 249394834     gbpat77.seq
 248798213     gbpat78.seq
 249999258     gbpat79.seq
 249996047     gbpat8.seq
 141050219     gbpat80.seq
 250000182     gbpat81.seq
 249999208     gbpat82.seq
 250000165     gbpat83.seq
 249999811     gbpat84.seq
 249999309     gbpat85.seq
 249999750     gbpat86.seq
  87741306     gbpat87.seq
 249925675     gbpat88.seq
 250000208     gbpat89.seq
 249999776     gbpat9.seq
 249999832     gbpat90.seq
 250000210     gbpat91.seq
 250000095     gbpat92.seq
 250000146     gbpat93.seq
 130989890     gbpat94.seq
 249999003     gbpat95.seq
 249999366     gbpat96.seq
 249999447     gbpat97.seq
 249999901     gbpat98.seq
 184979714     gbpat99.seq
 249998584     gbphg1.seq
 249827358     gbphg2.seq
 249874911     gbphg3.seq
 249951654     gbphg4.seq
  63360050     gbphg5.seq
 249999727     gbpln1.seq
 196851433     gbpln10.seq
  74904970     gbpln100.seq
 249995840     gbpln101.seq
 249998813     gbpln102.seq
 249997972     gbpln103.seq
 106156360     gbpln104.seq
 249999515     gbpln105.seq
 249998742     gbpln106.seq
 250000047     gbpln107.seq
 249998735     gbpln108.seq
 138358806     gbpln109.seq
 249998432     gbpln11.seq
 249996394     gbpln110.seq
 249805606     gbpln111.seq
 249998316     gbpln112.seq
 248345848     gbpln113.seq
 243494514     gbpln114.seq
 249973782     gbpln115.seq
 250000209     gbpln116.seq
  39745108     gbpln117.seq
 249999516     gbpln118.seq
  47487807     gbpln119.seq
 249992160     gbpln12.seq
 210409986     gbpln120.seq
 247532028     gbpln121.seq
 185607450     gbpln122.seq
 997331398     gbpln123.seq
  56486277     gbpln124.seq
 217280468     gbpln125.seq
 171793647     gbpln126.seq
 197391133     gbpln127.seq
 177950617     gbpln128.seq
 196456252     gbpln129.seq
 249998987     gbpln13.seq
 189037039     gbpln130.seq
 220764606     gbpln131.seq
 227204479     gbpln132.seq
 224027156     gbpln133.seq
 248372205     gbpln134.seq
 188708370     gbpln135.seq
 249998726     gbpln136.seq
 249999970     gbpln137.seq
  57045369     gbpln138.seq
 249746969     gbpln139.seq
 249960170     gbpln14.seq
 249999827     gbpln140.seq
 249998422     gbpln141.seq
 249997762     gbpln142.seq
 249998429     gbpln143.seq
  13612288     gbpln144.seq
 249999065     gbpln145.seq
 248041899     gbpln146.seq
 249998573     gbpln147.seq
 249997503     gbpln148.seq
  84466819     gbpln149.seq
 222903265     gbpln15.seq
 249998955     gbpln150.seq
 249997832     gbpln151.seq
 249998585     gbpln152.seq
 213168750     gbpln153.seq
 249998850     gbpln154.seq
 249997768     gbpln155.seq
 249997823     gbpln156.seq
 160883623     gbpln157.seq
 249998372     gbpln158.seq
 249994248     gbpln159.seq
 249999890     gbpln16.seq
 249999604     gbpln160.seq
 129897184     gbpln161.seq
 249999326     gbpln162.seq
 249998481     gbpln163.seq
 250000226     gbpln164.seq
 249999172     gbpln165.seq
 249999095     gbpln166.seq
 249999703     gbpln167.seq
  47427515     gbpln168.seq
 249998419     gbpln169.seq
 249990442     gbpln17.seq
 249998308     gbpln170.seq
 249999390     gbpln171.seq
 249999519     gbpln172.seq
 249999604     gbpln173.seq
  46429031     gbpln174.seq
 249999632     gbpln175.seq
 249999028     gbpln176.seq
 247664803     gbpln177.seq
 248345228     gbpln178.seq
 249220395     gbpln179.seq
 249965339     gbpln18.seq
 250000168     gbpln180.seq
   7310868     gbpln181.seq
 220745640     gbpln182.seq
 224206313     gbpln183.seq
 180769610     gbpln184.seq
 766528189     gbpln185.seq
 241050342     gbpln186.seq
 225440072     gbpln187.seq
 223345495     gbpln188.seq
 247867839     gbpln189.seq
  18729995     gbpln19.seq
 249450872     gbpln190.seq
 228421819     gbpln191.seq
 249999072     gbpln192.seq
 102066226     gbpln193.seq
 249997876     gbpln194.seq
 249998835     gbpln195.seq
 249997646     gbpln196.seq
 249995484     gbpln197.seq
  87432452     gbpln198.seq
 249998194     gbpln2.seq
 241005321     gbpln20.seq
 249891736     gbpln21.seq
 248162352     gbpln22.seq
 249625878     gbpln23.seq
 240030578     gbpln24.seq
 231415812     gbpln25.seq
 232512418     gbpln26.seq
 235239775     gbpln27.seq
 199014935     gbpln28.seq
 204227457     gbpln29.seq
 249995621     gbpln3.seq
 249999732     gbpln30.seq
  95344035     gbpln31.seq
 249999768     gbpln32.seq
 133192128     gbpln33.seq
 203981219     gbpln34.seq
  84488595     gbpln35.seq
 191574833     gbpln36.seq
 228663904     gbpln37.seq
 243276497     gbpln38.seq
 249608485     gbpln39.seq
 249960179     gbpln4.seq
 249676853     gbpln40.seq
 249998559     gbpln41.seq
 249590406     gbpln42.seq
 137796452     gbpln43.seq
 249130516     gbpln44.seq
 249951075     gbpln45.seq
 248595782     gbpln46.seq
 248796588     gbpln47.seq
 249414934     gbpln48.seq
 249604556     gbpln49.seq
 249894938     gbpln5.seq
 103698915     gbpln50.seq
 249349086     gbpln51.seq
 247427951     gbpln52.seq
 243771043     gbpln53.seq
 219791144     gbpln54.seq
 249020201     gbpln55.seq
 134817676     gbpln56.seq
 243505174     gbpln57.seq
 202810877     gbpln58.seq
 214739175     gbpln59.seq
 249912307     gbpln6.seq
 243089376     gbpln60.seq
 249507061     gbpln61.seq
 114980120     gbpln62.seq
 248739165     gbpln63.seq
 208314306     gbpln64.seq
 220962844     gbpln65.seq
 248394563     gbpln66.seq
 172290936     gbpln67.seq
 203039115     gbpln68.seq
 195647644     gbpln69.seq
 249919303     gbpln7.seq
 174630462     gbpln70.seq
 233654211     gbpln71.seq
 175879654     gbpln72.seq
 249658962     gbpln73.seq
 238690973     gbpln74.seq
 232947931     gbpln75.seq
  65593188     gbpln76.seq
 172901755     gbpln77.seq
 146175027     gbpln78.seq
 126466706     gbpln79.seq
 249869754     gbpln8.seq
 181463533     gbpln80.seq
 154678179     gbpln81.seq
 147213277     gbpln82.seq
 243795145     gbpln83.seq
 219220175     gbpln84.seq
 145131488     gbpln85.seq
 189274789     gbpln86.seq
 154858374     gbpln87.seq
 191029235     gbpln88.seq
 171171102     gbpln89.seq
 249994506     gbpln9.seq
 194023361     gbpln90.seq
 194872072     gbpln91.seq
 168527889     gbpln92.seq
 173322438     gbpln93.seq
 201667549     gbpln94.seq
 178248165     gbpln95.seq
     84604     gbpln96.seq
    354449     gbpln97.seq
 164935257     gbpln98.seq
  40081560     gbpln99.seq
 147957234     gbpri1.seq
 249829449     gbpri10.seq
 143951048     gbpri11.seq
 249938389     gbpri12.seq
 249864786     gbpri13.seq
 249870085     gbpri14.seq
 249923234     gbpri15.seq
 249847949     gbpri16.seq
 249851601     gbpri17.seq
 249741155     gbpri18.seq
 249904267     gbpri19.seq
 249968109     gbpri2.seq
 249931437     gbpri20.seq
 249975812     gbpri21.seq
 249641383     gbpri22.seq
 249889870     gbpri23.seq
 207245727     gbpri24.seq
 162649291     gbpri25.seq
 249994763     gbpri26.seq
 244711168     gbpri27.seq
 249973486     gbpri28.seq
 249983047     gbpri29.seq
 249829536     gbpri3.seq
 249946931     gbpri30.seq
 249783882     gbpri31.seq
 249750397     gbpri32.seq
 249840243     gbpri33.seq
 249990396     gbpri34.seq
 249993484     gbpri35.seq
  18804857     gbpri36.seq
 249999056     gbpri37.seq
 249974877     gbpri38.seq
 249410869     gbpri39.seq
 249974303     gbpri4.seq
 249984125     gbpri40.seq
 249732007     gbpri41.seq
 179362562     gbpri42.seq
 249998683     gbpri43.seq
 249975928     gbpri44.seq
 249966172     gbpri45.seq
 249999667     gbpri46.seq
 249987067     gbpri47.seq
  66348444     gbpri48.seq
 249988509     gbpri49.seq
 249917217     gbpri5.seq
 249988949     gbpri50.seq
 249998314     gbpri51.seq
 146060412     gbpri52.seq
 314294173     gbpri53.seq
 258775295     gbpri54.seq
 268666434     gbpri55.seq
 249976201     gbpri56.seq
 249985034     gbpri57.seq
 249847129     gbpri58.seq
  10303287     gbpri59.seq
 249853936     gbpri6.seq
 249750943     gbpri7.seq
 249904713     gbpri8.seq
 249823999     gbpri9.seq
    486711     gbrel.txt
 249960730     gbrod1.seq
 249869153     gbrod10.seq
  80603868     gbrod11.seq
 249853719     gbrod12.seq
 249993397     gbrod13.seq
 249952018     gbrod14.seq
 249790966     gbrod15.seq
 249791212     gbrod16.seq
 249877726     gbrod17.seq
 249887975     gbrod18.seq
 249033188     gbrod19.seq
 249878749     gbrod2.seq
 249737953     gbrod20.seq
 249777714     gbrod21.seq
 204220110     gbrod22.seq
 249997989     gbrod23.seq
 249992132     gbrod24.seq
 249959966     gbrod25.seq
 249989896     gbrod26.seq
 249997808     gbrod27.seq
 250000254     gbrod28.seq
 249995141     gbrod29.seq
 249846336     gbrod3.seq
 249998445     gbrod30.seq
  20816692     gbrod31.seq
 249956268     gbrod4.seq
 249723115     gbrod5.seq
 249894551     gbrod6.seq
 249813115     gbrod7.seq
 249947122     gbrod8.seq
 249984733     gbrod9.seq
 249997746     gbsts1.seq
 249997088     gbsts10.seq
 206741382     gbsts11.seq
 249998430     gbsts12.seq
 249999169     gbsts13.seq
 250000011     gbsts14.seq
 249998492     gbsts15.seq
  21531082     gbsts16.seq
 249999089     gbsts17.seq
 249999767     gbsts18.seq
 249999322     gbsts19.seq
 249999681     gbsts2.seq
 183195388     gbsts20.seq
 249998943     gbsts3.seq
 249996454     gbsts4.seq
  37833138     gbsts5.seq
 249998732     gbsts6.seq
 249995639     gbsts7.seq
 249996228     gbsts8.seq
 249996787     gbsts9.seq
 249999144     gbsyn1.seq
 163674801     gbsyn10.seq
 249992888     gbsyn2.seq
 249971816     gbsyn3.seq
 249948734     gbsyn4.seq
 249948494     gbsyn5.seq
 249961019     gbsyn6.seq
 249997114     gbsyn7.seq
 249996411     gbsyn8.seq
 249992322     gbsyn9.seq
 249999675     gbtsa1.seq
  50318331     gbtsa10.seq
 249998031     gbtsa100.seq
 249999022     gbtsa101.seq
 249994258     gbtsa102.seq
 250000145     gbtsa103.seq
 249999147     gbtsa104.seq
  99482523     gbtsa105.seq
 249998116     gbtsa106.seq
 249999006     gbtsa107.seq
 249999406     gbtsa108.seq
 249998157     gbtsa109.seq
 249995943     gbtsa11.seq
 249998792     gbtsa110.seq
 249999353     gbtsa111.seq
 221423351     gbtsa112.seq
 250000072     gbtsa113.seq
 250000158     gbtsa114.seq
 250000198     gbtsa115.seq
 249999986     gbtsa116.seq
 250000096     gbtsa117.seq
   9941672     gbtsa118.seq
 249997842     gbtsa119.seq
 249997183     gbtsa12.seq
 249998997     gbtsa120.seq
 249999686     gbtsa121.seq
 215403410     gbtsa122.seq
 249998009     gbtsa123.seq
 249999478     gbtsa124.seq
 250000220     gbtsa125.seq
 249999818     gbtsa126.seq
 249999718     gbtsa127.seq
 249997636     gbtsa128.seq
 164931384     gbtsa129.seq
 249994887     gbtsa13.seq
 249997163     gbtsa130.seq
 249996135     gbtsa131.seq
 249997577     gbtsa132.seq
 250000175     gbtsa133.seq
 249999451     gbtsa134.seq
 250000157     gbtsa135.seq
   2518352     gbtsa136.seq
 249997865     gbtsa137.seq
 249996502     gbtsa138.seq
 249997490     gbtsa139.seq
 249998618     gbtsa14.seq
 249999799     gbtsa140.seq
 131360517     gbtsa141.seq
 249994731     gbtsa142.seq
 249998059     gbtsa143.seq
 249999383     gbtsa144.seq
 249999200     gbtsa145.seq
  30978866     gbtsa146.seq
 249998453     gbtsa147.seq
 249998596     gbtsa148.seq
 249999972     gbtsa149.seq
 249998003     gbtsa15.seq
 249996762     gbtsa150.seq
 249998685     gbtsa151.seq
 249999392     gbtsa152.seq
 249998560     gbtsa153.seq
 249998976     gbtsa154.seq
  45724243     gbtsa155.seq
 249998921     gbtsa156.seq
 249999118     gbtsa157.seq
 249998545     gbtsa158.seq
 250000026     gbtsa159.seq
  16855572     gbtsa16.seq
 249997741     gbtsa160.seq
 249999330     gbtsa161.seq
  84607457     gbtsa162.seq
 249999313     gbtsa163.seq
 249998187     gbtsa164.seq
 249998633     gbtsa165.seq
 139220115     gbtsa166.seq
 249996774     gbtsa167.seq
 249996438     gbtsa168.seq
 249999007     gbtsa169.seq
 249998023     gbtsa17.seq
 249994445     gbtsa170.seq
 249992518     gbtsa171.seq
 249999858     gbtsa172.seq
 208363603     gbtsa173.seq
 249998828     gbtsa174.seq
 249996630     gbtsa175.seq
 249993564     gbtsa176.seq
 249994891     gbtsa177.seq
 250000106     gbtsa178.seq
 249997818     gbtsa179.seq
 249996915     gbtsa18.seq
 230583152     gbtsa180.seq
 249998515     gbtsa181.seq
 249999189     gbtsa182.seq
 249997207     gbtsa183.seq
 249996939     gbtsa184.seq
 249994703     gbtsa185.seq
 249995475     gbtsa186.seq
 249996599     gbtsa187.seq
 154687296     gbtsa188.seq
 249999558     gbtsa189.seq
 249997721     gbtsa19.seq
 249997141     gbtsa190.seq
 249999121     gbtsa191.seq
 249999588     gbtsa192.seq
 249997398     gbtsa193.seq
 249995404     gbtsa194.seq
 249999599     gbtsa195.seq
 222049284     gbtsa196.seq
 249999907     gbtsa197.seq
 249998022     gbtsa198.seq
 249999831     gbtsa199.seq
 249999875     gbtsa2.seq
 249996846     gbtsa20.seq
 249998525     gbtsa200.seq
 231476173     gbtsa201.seq
 249997536     gbtsa202.seq
 249996694     gbtsa203.seq
 249998981     gbtsa204.seq
 249997945     gbtsa205.seq
 249996879     gbtsa206.seq
 249997044     gbtsa207.seq
 249998226     gbtsa208.seq
 249998918     gbtsa209.seq
 179291287     gbtsa21.seq
  32621095     gbtsa210.seq
 249998497     gbtsa211.seq
 249998243     gbtsa212.seq
 249999255     gbtsa213.seq
 249995777     gbtsa214.seq
 249998092     gbtsa215.seq
 249998480     gbtsa216.seq
 249998398     gbtsa217.seq
 219125607     gbtsa218.seq
 249998478     gbtsa219.seq
 250000051     gbtsa22.seq
 249998905     gbtsa220.seq
 249995180     gbtsa221.seq
 249996675     gbtsa222.seq
 249994729     gbtsa223.seq
 249999027     gbtsa224.seq
 249999088     gbtsa225.seq
  28750338     gbtsa226.seq
 249999639     gbtsa227.seq
 249999892     gbtsa228.seq
 249996250     gbtsa229.seq
 249996448     gbtsa23.seq
 249995951     gbtsa230.seq
 249997802     gbtsa231.seq
 249999056     gbtsa232.seq
 249998509     gbtsa233.seq
 171540916     gbtsa234.seq
 249997209     gbtsa24.seq
 249998115     gbtsa25.seq
 149436272     gbtsa26.seq
 249999039     gbtsa27.seq
 249999075     gbtsa28.seq
 249999518     gbtsa29.seq
 249999971     gbtsa3.seq
 249998261     gbtsa30.seq
 249998844     gbtsa31.seq
   8360330     gbtsa32.seq
 249999396     gbtsa33.seq
 249998120     gbtsa34.seq
 249999803     gbtsa35.seq
 249998636     gbtsa36.seq
 249998533     gbtsa37.seq
 249998139     gbtsa38.seq
  67400599     gbtsa39.seq
 250000153     gbtsa4.seq
 249997527     gbtsa40.seq
 249999512     gbtsa41.seq
 249997467     gbtsa42.seq
 249999834     gbtsa43.seq
 249999596     gbtsa44.seq
 249998999     gbtsa45.seq
 249999361     gbtsa46.seq
  25962503     gbtsa47.seq
 249998180     gbtsa48.seq
 249999478     gbtsa49.seq
 146773925     gbtsa5.seq
 249999517     gbtsa50.seq
 249998366     gbtsa51.seq
  71315757     gbtsa52.seq
 250000188     gbtsa53.seq
 249998272     gbtsa54.seq
 249998401     gbtsa55.seq
 249995458     gbtsa56.seq
 153223993     gbtsa57.seq
 249999559     gbtsa58.seq
 249999540     gbtsa59.seq
 249998177     gbtsa6.seq
 249998090     gbtsa60.seq
 249998687     gbtsa61.seq
 249999177     gbtsa62.seq
 249998672     gbtsa63.seq
 250000057     gbtsa64.seq
 237094882     gbtsa65.seq
 249999479     gbtsa66.seq
 249996321     gbtsa67.seq
 249999966     gbtsa68.seq
 249998922     gbtsa69.seq
 249998374     gbtsa7.seq
 249998518     gbtsa70.seq
 249995333     gbtsa71.seq
 225927264     gbtsa72.seq
 249999425     gbtsa73.seq
 249997754     gbtsa74.seq
 249999723     gbtsa75.seq
 249997236     gbtsa76.seq
 249999596     gbtsa77.seq
 249997131     gbtsa78.seq
 174846214     gbtsa79.seq
 249998957     gbtsa8.seq
 249998462     gbtsa80.seq
 249997782     gbtsa81.seq
 250000080     gbtsa82.seq
 250000037     gbtsa83.seq
 249995888     gbtsa84.seq
 104827980     gbtsa85.seq
 249998728     gbtsa86.seq
 249998717     gbtsa87.seq
 249998008     gbtsa88.seq
 249999076     gbtsa89.seq
 249999330     gbtsa9.seq
 249997765     gbtsa90.seq
  39653951     gbtsa91.seq
 249999197     gbtsa92.seq
 249998374     gbtsa93.seq
 249997757     gbtsa94.seq
 249998081     gbtsa95.seq
 249999059     gbtsa96.seq
 144311861     gbtsa97.seq
 249992015     gbtsa98.seq
 249997674     gbtsa99.seq
   1077232     gbuna1.seq
 249998741     gbvrl1.seq
 249993948     gbvrl10.seq
 249997029     gbvrl11.seq
 249979293     gbvrl12.seq
 249998195     gbvrl13.seq
 249999221     gbvrl14.seq
 249998055     gbvrl15.seq
  29059847     gbvrl16.seq
 249998909     gbvrl17.seq
 249996423     gbvrl18.seq
 249995698     gbvrl19.seq
 249999563     gbvrl2.seq
 249999260     gbvrl20.seq
 209279060     gbvrl21.seq
 249998183     gbvrl22.seq
 249998766     gbvrl23.seq
 249999013     gbvrl24.seq
 249996382     gbvrl25.seq
 126625230     gbvrl26.seq
 249998129     gbvrl27.seq
 249996770     gbvrl28.seq
 250000195     gbvrl29.seq
 249997819     gbvrl3.seq
 249998680     gbvrl30.seq
 249999377     gbvrl31.seq
  55768028     gbvrl32.seq
 249984266     gbvrl33.seq
 250000020     gbvrl34.seq
 249974488     gbvrl35.seq
 249997692     gbvrl36.seq
 249997337     gbvrl37.seq
  81571235     gbvrl38.seq
 249999936     gbvrl39.seq
 249998272     gbvrl4.seq
 249819106     gbvrl40.seq
 249998775     gbvrl41.seq
 250000032     gbvrl42.seq
 249996038     gbvrl43.seq
 103178650     gbvrl44.seq
 249999448     gbvrl45.seq
 249861333     gbvrl46.seq
 249999492     gbvrl47.seq
 249993444     gbvrl48.seq
 249986141     gbvrl49.seq
 249988254     gbvrl5.seq
  14786288     gbvrl50.seq
 249995746     gbvrl51.seq
 249998966     gbvrl52.seq
 249992455     gbvrl53.seq
 249999386     gbvrl54.seq
 249774464     gbvrl55.seq
 249997152     gbvrl56.seq
 200323048     gbvrl57.seq
  69441096     gbvrl6.seq
 249997230     gbvrl7.seq
 250000218     gbvrl8.seq
 249997584     gbvrl9.seq
 249953261     gbvrt1.seq
  87347346     gbvrt10.seq
 249749293     gbvrt11.seq
 249836066     gbvrt12.seq
 249995333     gbvrt13.seq
  34843259     gbvrt14.seq
  15637437     gbvrt15.seq
  36032850     gbvrt16.seq
  18507952     gbvrt17.seq
 218993367     gbvrt18.seq
 238544136     gbvrt19.seq
 249731436     gbvrt2.seq
 245204042     gbvrt20.seq
 244333176     gbvrt21.seq
 212088982     gbvrt22.seq
 235491821     gbvrt23.seq
 240950113     gbvrt24.seq
 241392153     gbvrt25.seq
 233746357     gbvrt26.seq
 216505315     gbvrt27.seq
 249176153     gbvrt28.seq
 235299157     gbvrt29.seq
 249998309     gbvrt3.seq
 223829498     gbvrt30.seq
 231081542     gbvrt31.seq
 189626996     gbvrt32.seq
  14151693     gbvrt33.seq
  21383246     gbvrt34.seq
  90967413     gbvrt35.seq
 249980624     gbvrt36.seq
 249935599     gbvrt37.seq
 249988735     gbvrt38.seq
 250000099     gbvrt39.seq
 249999778     gbvrt4.seq
 249998069     gbvrt40.seq
 249989893     gbvrt41.seq
  54829704     gbvrt42.seq
 249977366     gbvrt43.seq
 249997678     gbvrt44.seq
 249997058     gbvrt45.seq
 249998421     gbvrt46.seq
 249996928     gbvrt47.seq
  94355793     gbvrt48.seq
 249998878     gbvrt49.seq
 229820199     gbvrt5.seq
 249998783     gbvrt50.seq
 249999524     gbvrt51.seq
 189018890     gbvrt52.seq
 249999172     gbvrt53.seq
 249997548     gbvrt54.seq
  22445102     gbvrt55.seq
 249999598     gbvrt56.seq
 189232888     gbvrt57.seq
 249999757     gbvrt58.seq
 249999770     gbvrt59.seq
 249991727     gbvrt6.seq
 249999866     gbvrt60.seq
 120357045     gbvrt61.seq
 249998375     gbvrt62.seq
 249997764     gbvrt63.seq
 249999570     gbvrt64.seq
  22181557     gbvrt65.seq
 249999842     gbvrt66.seq
 250000144     gbvrt67.seq
 249997895     gbvrt68.seq
 231270521     gbvrt69.seq
  13625816     gbvrt7.seq
 236339468     gbvrt70.seq
 234100397     gbvrt71.seq
 248773605     gbvrt72.seq
 247438412     gbvrt73.seq
 249933914     gbvrt74.seq
 249991250     gbvrt75.seq
 249996634     gbvrt76.seq
  91910607     gbvrt77.seq
 199952251     gbvrt78.seq
 122600608     gbvrt79.seq
 249990720     gbvrt8.seq
 243437483     gbvrt80.seq
 239733905     gbvrt81.seq
 233022258     gbvrt82.seq
 248903510     gbvrt83.seq
 240622316     gbvrt84.seq
 249662766     gbvrt85.seq
 249486033     gbvrt86.seq
 249567265     gbvrt87.seq
 249549093     gbvrt88.seq
 240301986     gbvrt89.seq
  39939512     gbvrt9.seq
 228044136     gbvrt90.seq
 207991154     gbvrt91.seq
 225083850     gbvrt92.seq
 249999217     gbvrt93.seq
  89470107     gbvrt94.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         64573      87284986
BCT10        12635      75804323
BCT100       45         112926461
BCT101       62         111891716
BCT102       62         108342624
BCT103       57         116195274
BCT104       63         111278300
BCT105       39         113384349
BCT106       59         111542017
BCT107       44         107663961
BCT108       44         110441702
BCT109       61         109855524
BCT11        2600       37759883
BCT110       38         110289963
BCT111       47         111322081
BCT112       11         27206151
BCT113       29         106059433
BCT114       24         104995446
BCT115       22         102815134
BCT116       22         103083356
BCT117       22         103088809
BCT118       22         103089218
BCT119       22         103633799
BCT12        1296       115524731
BCT120       22         104408660
BCT121       24         108509216
BCT122       47         110106529
BCT123       39         105943067
BCT124       9          27440665
BCT125       50         111764862
BCT126       60         109369965
BCT127       60         114865324
BCT128       68         113315118
BCT129       44         114294823
BCT13        14         17783631
BCT130       51         120259158
BCT131       59         121894787
BCT132       32         105533620
BCT133       26         110619128
BCT134       35         85165722
BCT135       44         114207420
BCT136       48         116972150
BCT137       62         113378131
BCT138       40         111579752
BCT139       37         115642270
BCT14        79         119443556
BCT140       25         110288300
BCT141       56         114513545
BCT142       7          21581982
BCT143       28         113584725
BCT144       60         113712694
BCT145       50         110304872
BCT146       37         114067329
BCT147       31         120103946
BCT148       48         118088836
BCT149       53         114617819
BCT15        108        113659812
BCT150       11         9464264
BCT151       78         113214393
BCT152       35         111461557
BCT153       46         112794907
BCT154       71         111279951
BCT155       59         115205726
BCT156       65         114250676
BCT157       63         116191647
BCT158       32         73509747
BCT159       53         103990173
BCT16        64         117502615
BCT160       60         104041780
BCT161       29         106052559
BCT162       45         111334518
BCT163       62         114775163
BCT164       48         109166193
BCT165       60         105891713
BCT166       51         113077166
BCT167       21         19661294
BCT168       162        111153271
BCT169       83         112822179
BCT17        67         116257954
BCT170       48         107014680
BCT171       56         108418810
BCT172       39         110201627
BCT173       60         111547533
BCT174       36         110576514
BCT175       47         113632224
BCT176       24         98541315
BCT177       35         105782148
BCT178       32         106750541
BCT179       41         109306445
BCT18        66         123972567
BCT180       36         109129522
BCT181       47         111389428
BCT182       46         110556602
BCT183       48         112877957
BCT184       34         107160153
BCT185       21         55380015
BCT186       94         107567012
BCT187       30         110366632
BCT188       26         106790034
BCT189       26         106809724
BCT19        37         114503115
BCT190       33         110883410
BCT191       55         112913783
BCT192       41         108625162
BCT193       17         45134599
BCT194       54         109329126
BCT195       30         109979579
BCT196       41         110944335
BCT197       35         110170230
BCT198       50         107737018
BCT199       59         110981011
BCT2         31270      98947186
BCT20        91         122581415
BCT200       46         115154482
BCT201       17         23124218
BCT202       99         108381810
BCT203       51         106146784
BCT204       44         110445382
BCT205       48         113454617
BCT206       44         108778957
BCT207       45         111012807
BCT208       86         110394596
BCT209       56         111476577
BCT21        56         119162563
BCT210       52         111721087
BCT211       39         110141463
BCT212       35         112358952
BCT213       72         116235599
BCT214       49         113144528
BCT215       18         26713993
BCT216       70         111990039
BCT217       43         109558177
BCT218       43         112248629
BCT219       51         112580939
BCT22        85         133357143
BCT220       68         106646226
BCT221       87         102298976
BCT222       43         109238455
BCT223       48         103066847
BCT224       92         109381196
BCT225       47         107492558
BCT226       26         106747657
BCT227       36         110290270
BCT228       56         108321932
BCT229       36         107187948
BCT23        75         121928156
BCT230       38         105844899
BCT231       83         107817386
BCT232       43         104872925
BCT233       46         113019807
BCT234       22         67931236
BCT235       64         111130189
BCT236       108        104825154
BCT237       61         111304599
BCT238       62         106656274
BCT239       60         106515237
BCT24        81         115699793
BCT240       58         107099604
BCT241       79         110778774
BCT242       91         106725042
BCT243       29         104969405
BCT244       22         64568502
BCT245       50         113958402
BCT246       53         108011335
BCT247       60         108420997
BCT248       52         109213977
BCT249       72         112251232
BCT25        90         119492129
BCT250       69         110577886
BCT251       48         109632300
BCT252       60         107069404
BCT253       52         115804554
BCT254       72         106359313
BCT255       45         114547939
BCT256       45         32040831
BCT257       45         111169376
BCT258       48         112304661
BCT259       47         108169953
BCT26        80         121954198
BCT260       56         110517810
BCT261       55         115012461
BCT262       47         107300839
BCT263       60         112493559
BCT264       51         107331826
BCT265       46         108914180
BCT266       47         110422202
BCT267       81         110285202
BCT268       59         109925109
BCT269       13         24343653
BCT27        104        128949186
BCT270       51         108956514
BCT271       118        111755910
BCT272       42         116419382
BCT273       57         109481167
BCT274       47         108993958
BCT275       44         111331834
BCT276       51         113622523
BCT277       44         110120614
BCT278       47         111211419
BCT279       64         108233583
BCT28        453        77812895
BCT280       53         117409525
BCT281       108        120787516
BCT282       42         107628761
BCT283       12         34648240
BCT284       54         109444298
BCT285       46         119158964
BCT286       45         112703886
BCT287       61         109566435
BCT288       71         107366358
BCT289       61         115866512
BCT29        5200       7533877
BCT290       31         109597586
BCT291       38         111193620
BCT292       10         24472548
BCT293       70         111512140
BCT294       48         113415583
BCT295       83         108110828
BCT296       67         118157291
BCT297       31         105927862
BCT298       47         102484237
BCT299       56         87753276
BCT3         47         113004732
BCT30        10402      13141930
BCT300       64         105999418
BCT301       47         110185307
BCT302       80         105114161
BCT303       75         117495758
BCT304       60         114156881
BCT305       50         104169648
BCT306       68         110382862
BCT307       73         113375895
BCT308       70         113921559
BCT309       37         103321369
BCT31        53817      84837054
BCT310       59         106861554
BCT311       59         108142786
BCT312       30         107525933
BCT313       53         114594372
BCT314       7          2857663
BCT315       48         109115940
BCT316       47         108870666
BCT317       51         115552170
BCT318       79         112678381
BCT319       67         113956010
BCT32        86         109498452
BCT320       64         113795052
BCT321       64         119455421
BCT322       67         122102989
BCT323       57         114837481
BCT324       41         113267465
BCT325       62         105697558
BCT326       59         116947400
BCT327       53         110283206
BCT328       34         107343156
BCT329       63         111689939
BCT33        137        95492678
BCT330       54         111402883
BCT331       58         109462098
BCT332       64         107635805
BCT333       12         19862167
BCT334       66         109892637
BCT335       54         113942058
BCT336       80         138357086
BCT337       57         116903566
BCT338       52         111604847
BCT339       74         108456864
BCT34        58         113456579
BCT340       78         110216005
BCT341       62         99605865
BCT342       48         106758116
BCT343       71         110810362
BCT344       62         109086423
BCT345       55         108821676
BCT346       42         110254988
BCT347       48         107568738
BCT348       49         112442984
BCT349       52         115130662
BCT35        52         112579647
BCT350       68         112585063
BCT351       8          15707030
BCT352       54         117309002
BCT353       45         113770639
BCT354       54         111405029
BCT355       46         107120084
BCT356       57         110607111
BCT357       51         109421288
BCT358       51         114071495
BCT359       45         116462565
BCT36        48         116997605
BCT360       53         115471364
BCT361       51         108798237
BCT362       58         108419516
BCT363       42         110822968
BCT364       60         106649285
BCT365       45         117089511
BCT366       44         108247543
BCT367       53         147863731
BCT368       44         194098436
BCT369       64         126877826
BCT37        59         116528153
BCT370       66         109424957
BCT371       102        106533817
BCT372       50         108802558
BCT373       56         107228585
BCT374       72         109455119
BCT375       12         9237674
BCT376       207        155444487
BCT377       119        119863310
BCT378       68         108632952
BCT379       66         113616476
BCT38        67         111716459
BCT380       67         108641064
BCT381       9          15465514
BCT382       42         105310251
BCT383       49         108491932
BCT384       43         115611729
BCT385       35         112728477
BCT386       59         121104733
BCT387       52         113334671
BCT388       72         112922084
BCT389       67         115435011
BCT39        30         80349661
BCT390       41         114120808
BCT391       44         111032765
BCT392       28         64092918
BCT393       57         112686044
BCT394       37         113777682
BCT395       45         106650927
BCT396       60         111531813
BCT397       83         106443287
BCT398       44         154739738
BCT399       80         110621007
BCT4         58         114249094
BCT40        44         112327765
BCT400       53         106210812
BCT401       44         105572503
BCT402       9          17133451
BCT403       59         115770332
BCT404       84         188841568
BCT405       67         127963710
BCT406       58         108019533
BCT407       82         118905695
BCT408       66         133140976
BCT409       71         143571354
BCT41        59         108549640
BCT410       73         143680753
BCT411       78         133478789
BCT412       60         139113567
BCT413       49         119372539
BCT414       52         109068749
BCT415       57         106062314
BCT416       29         129458917
BCT417       45         119524627
BCT418       41         111951289
BCT419       9          9940016
BCT42        72         113152419
BCT420       96         113482348
BCT421       68         112480576
BCT422       47         118496106
BCT423       74         115895826
BCT424       56         113845650
BCT425       62         116142187
BCT426       55         111494062
BCT427       5          11689408
BCT428       70         108480138
BCT429       36         108045740
BCT43        59         112109297
BCT430       45         102639658
BCT431       60         122722850
BCT432       48         107103144
BCT433       85         114708705
BCT434       50         113176278
BCT435       45         97377128
BCT436       63         104259512
BCT437       59         120871014
BCT438       61         121741976
BCT439       60         110891835
BCT44        60         105492134
BCT440       63         127349605
BCT441       67         136502281
BCT442       67         60702795
BCT443       204        94545960
BCT444       324        21043424
BCT445       1589       2511957
BCT446       3172       5268484
BCT447       6338       7796395
BCT448       12613      14997690
BCT449       25523      27672494
BCT45        58         112573463
BCT450       50567      54073367
BCT451       76726      78742520
BCT452       72580      78145376
BCT453       8213       93055368
BCT454       5442       100112786
BCT455       3164       103164360
BCT456       131        99758696
BCT457       37         107592501
BCT458       1191       101609791
BCT459       7055       99540641
BCT46        51         106493710
BCT460       37299      89631404
BCT461       4039       3625140
BCT462       71367      76385903
BCT463       3728       103841551
BCT464       4392       102170073
BCT465       6609       100692159
BCT466       3488       101201946
BCT467       20947      101459124
BCT468       76012      80447128
BCT469       66696      72945773
BCT47        50         111687232
BCT470       76457      79300084
BCT471       73055      77688601
BCT472       73594      75215735
BCT473       10548      12779900
BCT474       71878      76356195
BCT475       72964      74960994
BCT476       25369      24789890
BCT477       67485      82545123
BCT478       65316      85386293
BCT479       30073      41819412
BCT48        94         111458496
BCT480       56204      87636032
BCT481       60633      90392390
BCT482       4124       10472300
BCT483       30080      50927947
BCT484       6901       116873910
BCT485       2228       184711560
BCT486       2326       135561742
BCT487       3034       43961507
BCT488       2460       108251599
BCT489       2575       116897639
BCT49        58         111561411
BCT490       2505       109511888
BCT491       1351       117718682
BCT492       1645       110640600
BCT493       48         108705635
BCT494       45         110575625
BCT495       40         114900924
BCT496       29         110388155
BCT497       2232       109433935
BCT498       408        119797053
BCT499       1095       58790525
BCT5         27521      104242627
BCT50        84         112644694
BCT500       457        124891584
BCT501       709        134426410
BCT502       21         115156206
BCT503       25         121554497
BCT504       22         120524174
BCT505       23         120079355
BCT506       1637       121429670
BCT507       472        143263499
BCT508       911        47992516
BCT509       1195       122635489
BCT51        108        108953601
BCT510       748        149990140
BCT511       48         160127866
BCT512       34         109993540
BCT513       214        125164370
BCT514       87         158924541
BCT515       529        114172126
BCT516       2219       114237460
BCT517       11681      19551874
BCT518       23615      39504348
BCT519       57354      96062243
BCT52        30         51546888
BCT520       50906      91628080
BCT53        201        112694419
BCT54        53         109969331
BCT55        35         108859141
BCT56        60         109966555
BCT57        58         109966357
BCT58        46         113084021
BCT59        77         110161336
BCT6         10015      14329906
BCT60        62         109092488
BCT61        46         111286269
BCT62        60         112027245
BCT63        78         112427817
BCT64        84         111007733
BCT65        67         109336234
BCT66        61         108350042
BCT67        59         109790210
BCT68        55         108616273
BCT69        55         110914781
BCT7         39658      80452186
BCT70        65         113580356
BCT71        62         106974023
BCT72        69         106881048
BCT73        62         115998031
BCT74        44         116898024
BCT75        73         109295595
BCT76        55         114736454
BCT77        66         113765735
BCT78        9          1978793
BCT79        43         109853786
BCT8         1635       58802251
BCT80        51         118673819
BCT81        68         113547030
BCT82        48         110288002
BCT83        55         116500783
BCT84        104        116324895
BCT85        70         111645516
BCT86        85         109846187
BCT87        64         113994836
BCT88        62         118631327
BCT89        51         119558294
BCT9         8013       93844117
BCT90        57         114381603
BCT91        59         118186495
BCT92        5          14376193
BCT93        48         118002347
BCT94        135        118620434
BCT95        182        117074069
BCT96        66         111219258
BCT97        300        116964215
BCT98        60         109500882
BCT99        68         108099610
ENV1         93344      72326888
ENV10        86893      70991742
ENV100       116351     49597857
ENV101       110717     48799563
ENV102       102275     52049333
ENV103       48374      26380669
ENV11        93904      73201898
ENV12        82521      86710319
ENV13        19492      17024735
ENV14        85259      81187629
ENV15        119464     43019005
ENV16        89274      78076208
ENV17        97022      67996481
ENV18        96512      63832433
ENV19        113309     67168318
ENV2         97272      69121907
ENV20        118330     65710750
ENV21        58578      79094163
ENV22        64374      80737775
ENV23        91110      75794068
ENV24        126222     39552104
ENV25        124075     29252102
ENV26        87102      20058260
ENV27        123684     50576070
ENV28        97287      68251566
ENV29        117748     55872716
ENV3         94995      67749295
ENV30        138268     52907469
ENV31        106617     62339668
ENV32        96252      64915025
ENV33        22011      21789173
ENV34        62756      85293276
ENV35        89547      73458531
ENV36        104414     44560034
ENV37        96733      58830834
ENV38        68244      51328886
ENV39        111877     47527594
ENV4         72012      84219722
ENV40        101584     61426951
ENV41        107119     62818858
ENV42        63768      91044923
ENV43        72759      79116937
ENV44        62246      84555310
ENV45        11461      15615818
ENV46        71118      78555168
ENV47        108842     49751909
ENV48        113078     56885637
ENV49        105031     61480978
ENV5         44905      96475424
ENV50        78194      41641580
ENV51        101425     44613775
ENV52        42570      53405786
ENV53        42078      54694904
ENV54        58588      57603209
ENV55        97239      61444456
ENV56        32772      18482397
ENV57        92511      67352399
ENV58        81441      71524577
ENV59        78900      68375064
ENV6         55179      97658691
ENV60        86523      70199665
ENV61        97034      59976312
ENV62        80031      52212096
ENV63        110424     46323274
ENV64        90526      60930691
ENV65        101844     52166958
ENV66        94525      57427231
ENV67        80349      75362365
ENV68        29779      21748084
ENV69        74406      83178393
ENV7         88661      87240186
ENV70        83687      51661163
ENV71        86653      60200475
ENV72        58507      76596999
ENV73        106201     31858372
ENV74        62595      15813468
ENV75        79259      74967610
ENV76        92901      58247251
ENV77        102082     60424070
ENV78        109308     39479150
ENV79        108793     38318504
ENV8         95144      57672107
ENV80        31280      23240317
ENV81        99401      54592294
ENV82        117115     29632068
ENV83        108292     41973372
ENV84        104452     50577978
ENV85        107562     43083957
ENV86        103077     51202843
ENV87        121711     47583748
ENV88        118304     40370729
ENV89        106049     51676671
ENV9         132107     31605417
ENV90        100008     54757876
ENV91        39383      35610995
ENV92        97829      56558828
ENV93        100686     54886686
ENV94        95597      51295290
ENV95        82491      38700197
ENV96        110525     48657737
ENV97        55302      44280711
ENV98        93960      70042546
ENV99        123139     44836255
EST1         160129     62048092
EST10        169871     73444984
EST100       231885     141230131
EST101       238152     124790673
EST102       192956     104583190
EST103       183661     102481809
EST104       95966      67587916
EST105       161408     120611065
EST106       175080     106821755
EST107       134235     84331809
EST108       63884      23749865
EST109       63412      22288910
EST11        168623     72963393
EST110       63854      23122662
EST111       63916      26929608
EST112       64401      22911933
EST113       64607      24630352
EST114       63537      27083983
EST115       63849      26181805
EST116       64075      27278891
EST117       63912      25159791
EST118       61292      34058859
EST119       129465     64374313
EST12        171892     73648748
EST120       161205     86116516
EST121       183960     92675835
EST122       149311     95927409
EST123       158328     93280139
EST124       126243     82219367
EST125       189329     90796862
EST126       156772     83321519
EST127       157438     84498941
EST128       157969     85335760
EST129       151895     85208739
EST13        58008      27771950
EST130       174577     93669727
EST131       183435     117240292
EST132       203137     102617353
EST133       160950     87822611
EST134       162442     82274487
EST135       143309     84529212
EST136       144735     90899218
EST137       93886      48766905
EST138       173566     98171665
EST139       244800     113006337
EST14        218643     109735786
EST140       155951     84220498
EST141       168033     92674500
EST142       150707     87960278
EST143       135731     83734523
EST144       155620     96114730
EST145       155157     85679703
EST146       124039     63532147
EST147       121157     65078933
EST148       127844     57423772
EST149       127024     51040844
EST15        169347     106042695
EST150       128333     51155087
EST151       112032     41733802
EST152       164724     83019119
EST153       177835     74484307
EST154       162635     111158778
EST155       201806     123526600
EST156       214137     121574275
EST157       175566     96838696
EST158       155825     108334665
EST159       140273     95361215
EST16        183313     113933752
EST160       157743     96727699
EST161       156587     82439091
EST162       139210     78449383
EST163       172428     95510865
EST164       61164      38978291
EST165       151288     92661539
EST166       193517     111110809
EST167       146535     84262310
EST168       142342     72116469
EST169       152739     88438543
EST17        195950     117516581
EST170       189985     105196832
EST171       157000     96371709
EST172       168558     83507877
EST173       130094     87241010
EST174       173284     101642000
EST175       173658     100271685
EST176       119264     67543261
EST177       159450     91175353
EST178       22229      13499206
EST179       171661     103705274
EST18        195737     119934967
EST180       182535     120344935
EST181       144523     116575465
EST182       195086     100059024
EST183       153518     105316008
EST184       153503     99016634
EST185       142264     82736540
EST186       179027     73112287
EST187       150175     83124556
EST188       157395     100801472
EST189       159709     97762181
EST19        159743     113640656
EST190       142026     85842175
EST191       150476     90089860
EST192       147352     94376905
EST193       131826     91670001
EST194       142404     87460919
EST195       137889     89993045
EST196       133989     94262480
EST197       163915     87524297
EST198       175497     96460193
EST199       174850     97297683
EST2         162850     61814226
EST20        190628     100813735
EST200       172590     96887873
EST201       170002     95292428
EST202       173387     96344213
EST203       174880     95815064
EST204       175383     96513280
EST205       6029       3144815
EST206       190346     105932551
EST207       207615     105884500
EST208       172756     103038308
EST209       180723     102297573
EST21        219598     107269449
EST210       202247     122969687
EST211       198082     113900342
EST212       194343     124812637
EST213       137907     92478298
EST214       220165     140535311
EST215       237792     119714328
EST216       150861     102053549
EST217       183390     101249253
EST218       203514     99789075
EST219       132275     95254621
EST22        186500     60116041
EST220       147670     87072835
EST221       211179     116999585
EST222       160652     104303805
EST223       104983     110231812
EST224       155042     103415792
EST225       162696     97777018
EST226       141963     101599161
EST227       223833     106717666
EST228       137136     99351308
EST229       115667     82394536
EST23        137455     39303578
EST230       138442     98298561
EST231       123238     88290824
EST232       144401     90158116
EST233       130114     88874714
EST234       140887     105532857
EST235       132404     93288685
EST236       125250     84784277
EST237       142666     88360805
EST238       160083     121947988
EST239       124315     118276372
EST24        102678     27795659
EST240       139879     103642764
EST241       178323     107905407
EST242       164496     102257112
EST243       159221     100653860
EST244       76271      44548403
EST245       167473     126106711
EST246       143928     106295925
EST247       156892     100599347
EST248       214550     97774779
EST249       185371     113119873
EST25        120117     50376646
EST250       156261     84600090
EST251       219254     29953147
EST252       218355     88110833
EST253       163751     122039027
EST254       174624     102454072
EST255       163466     108501462
EST256       108689     67463796
EST257       155932     113930193
EST258       185518     112449894
EST259       189765     98435836
EST26        215597     98196770
EST260       177137     111068190
EST261       163722     111701149
EST262       233395     109676225
EST263       278362     121444925
EST264       189803     114126089
EST265       188609     37110359
EST266       260448     125249546
EST267       57280      37094718
EST268       153650     97980431
EST269       166484     102516847
EST27        219991     110549633
EST270       167301     114787647
EST271       198053     103313897
EST272       158703     107751468
EST273       195831     114681680
EST274       198918     47203784
EST275       205214     44900162
EST276       183494     103105310
EST277       176682     118974843
EST278       182618     115130351
EST279       117663     67035941
EST28        190574     88319167
EST280       175956     114554411
EST281       171525     74811434
EST282       133090     83122643
EST283       132252     85963302
EST284       156791     101768203
EST285       262657     27696987
EST286       266660     24513316
EST287       145870     107532703
EST288       170035     110955068
EST289       160883     101456865
EST29        158162     69018859
EST290       162420     89962332
EST291       140304     12831430
EST292       210382     74724852
EST293       165986     107720991
EST294       177614     107027977
EST295       153517     99033806
EST296       201456     108724596
EST297       154371     111165665
EST298       166918     101076306
EST299       188404     115702522
EST3         152153     53984386
EST30        171843     69709846
EST300       180331     103934232
EST301       187604     98707986
EST302       184125     64381342
EST303       120605     42476142
EST304       183963     71375308
EST305       184618     69638708
EST306       186653     96999877
EST307       183236     131696164
EST308       145856     84785616
EST309       153074     92912583
EST31        151584     64139215
EST310       132071     100733895
EST311       161816     97118640
EST312       173038     98976740
EST313       149664     96828875
EST314       167989     95140766
EST315       161075     107617391
EST316       96518      68427408
EST317       165098     108342327
EST318       158175     109498575
EST319       179671     152262118
EST32        167260     75847921
EST320       171256     111807076
EST321       142569     76618482
EST322       144089     98244816
EST323       147381     101008877
EST324       135486     91296158
EST325       149845     100169208
EST326       150814     101406896
EST327       178580     109674218
EST328       148869     84293837
EST329       149350     85242710
EST33        178072     69560990
EST330       58817      36557112
EST331       151156     108771133
EST332       162144     97428733
EST333       143814     91458772
EST334       142490     89690757
EST335       206273     112047308
EST336       136793     74769775
EST337       91287      54599719
EST338       131442     86646786
EST339       137132     87049428
EST34        116151     39110680
EST340       124914     79790328
EST341       160856     85977649
EST342       216962     84698335
EST343       170477     87960994
EST344       103513     61391216
EST345       165614     103679383
EST346       147361     90106965
EST347       133481     88896721
EST348       136465     88924634
EST349       186857     122209163
EST35        96436      29612140
EST350       160942     97411036
EST351       154702     78534927
EST352       188621     128424232
EST353       116308     80501136
EST354       72720      43729302
EST355       136336     75011003
EST356       131038     78525509
EST357       146697     58050544
EST358       155650     31598566
EST359       46315      9517888
EST36        96822      30281588
EST360       153386     41324625
EST361       190806     120475280
EST362       238619     114471619
EST363       249097     113920674
EST364       188409     103114178
EST365       140843     91308200
EST366       135818     86334319
EST367       152480     89860125
EST368       191830     118596577
EST369       229223     63813920
EST37        95745      29054938
EST370       178993     111850230
EST371       29588      13810914
EST372       214922     118035997
EST373       205327     121912401
EST374       203644     116237571
EST375       144588     69723190
EST376       198114     122159499
EST377       162603     102762708
EST378       164270     126255556
EST379       183136     147316659
EST38        97626      29491456
EST380       158031     91734408
EST381       164866     106281142
EST382       186493     106396366
EST383       90207      52923865
EST384       206127     112253203
EST385       195282     108630683
EST386       192030     118530513
EST387       191586     124608349
EST388       202249     133361993
EST389       219705     133412024
EST39        97987      30992354
EST390       208519     133118090
EST391       198602     149757415
EST392       213257     165551607
EST393       202239     121832558
EST394       48976      30906500
EST395       181050     94544773
EST396       172002     70404625
EST397       164886     12791613
EST398       151988     14405221
EST399       155406     32172858
EST4         172151     67668502
EST40        26150      6694753
EST400       155773     31276947
EST401       155469     32015759
EST402       147714     95244114
EST403       188792     113775989
EST404       161794     109911114
EST405       166649     100975516
EST406       149127     102889284
EST407       121121     84049784
EST408       145488     95030974
EST409       172888     118485177
EST41        101644     53117804
EST410       142863     99417864
EST411       177458     104989766
EST412       173324     36492092
EST413       165662     58473118
EST414       156475     110522972
EST415       161467     102768169
EST416       163129     102100164
EST417       157543     91640819
EST418       190460     124196593
EST419       145841     96346321
EST42        119850     50999334
EST420       127314     87387055
EST421       154467     95589983
EST422       156112     93577926
EST423       174454     93669612
EST424       161034     96877459
EST425       166340     96619567
EST426       172523     105905700
EST427       141408     88325716
EST428       102253     72998855
EST429       80902      62222185
EST43        166496     92139249
EST430       104789     69116898
EST431       157168     86617266
EST432       126764     76820154
EST433       139618     91489973
EST434       141510     83229543
EST435       46446      31404179
EST436       167514     97545296
EST437       179546     93705703
EST438       164772     105839563
EST439       154178     96527858
EST44        170929     72243240
EST440       171734     76983702
EST441       192834     106038279
EST442       155409     83977949
EST443       166830     96627663
EST444       220502     129863066
EST445       155392     105414716
EST446       171976     103575459
EST447       140814     93593972
EST448       23304      15561447
EST449       136219     91246615
EST45        167784     85299474
EST450       198937     74883424
EST451       181777     86171154
EST452       207404     88810983
EST453       201300     81702163
EST454       182785     107372533
EST455       184082     112219399
EST456       191001     109975919
EST457       196098     116662559
EST458       199183     130943770
EST459       189835     88523387
EST46        169137     87119038
EST460       11083      5344267
EST461       186788     112379981
EST462       216845     130461325
EST463       213759     133027730
EST464       204119     118214924
EST465       199525     119724163
EST466       172838     104479186
EST467       200640     125770065
EST468       154032     90943547
EST469       148494     111698488
EST47        163858     88120560
EST470       159316     86862108
EST471       188375     96698401
EST472       6954       3798181
EST473       150425     80525111
EST474       155408     85105938
EST475       186310     99130418
EST476       168465     109084388
EST477       184606     106786377
EST478       177177     116399460
EST479       184229     122540356
EST48        162971     83191697
EST480       181808     119150089
EST481       178636     104235378
EST482       191325     115590030
EST483       165330     73219026
EST484       154337     54285746
EST485       106083     42202958
EST49        160582     91514495
EST5         170238     66687493
EST50        162551     89308670
EST51        158538     98697206
EST52        160249     70797489
EST53        148384     83043654
EST54        67027      45027763
EST55        168223     70336694
EST56        165613     75232135
EST57        165959     91680956
EST58        159112     96843968
EST59        157138     102945263
EST6         172412     67099145
EST60        165323     99464200
EST61        160937     108862712
EST62        172956     79570493
EST63        174776     94587682
EST64        155212     84383383
EST65        148710     82314424
EST66        160544     98019474
EST67        125496     72251727
EST68        150384     92168772
EST69        196043     108845769
EST7         171545     73594969
EST70        182191     95424944
EST71        221249     121355918
EST72        188045     112548620
EST73        203546     120636433
EST74        165053     90824833
EST75        132546     60593304
EST76        137351     67630793
EST77        159251     99934239
EST78        157918     96535455
EST79        143410     79076694
EST8         181550     73745103
EST80        42998      19984642
EST81        163936     100433367
EST82        212890     115229514
EST83        226257     124988763
EST84        201908     95163603
EST85        213162     93784434
EST86        160449     92480876
EST87        144757     88311019
EST88        164515     80787076
EST89        160974     81236722
EST9         168561     69271060
EST90        152824     101692829
EST91        152044     90853863
EST92        126229     80404712
EST93        156502     113223945
EST94        141750     103760181
EST95        142588     101965309
EST96        141484     97772884
EST97        148187     81773240
EST98        179695     111938823
EST99        227174     137462507
GSS1         201765     88393689
GSS10        133582     61455950
GSS100       145752     114883362
GSS101       142374     116383703
GSS102       144252     117844834
GSS103       170442     129092802
GSS104       137462     74724457
GSS105       192257     121379713
GSS106       169506     113263521
GSS107       200389     117627441
GSS108       206379     135361049
GSS109       210703     139052186
GSS11        137304     73447717
GSS110       209765     139938273
GSS111       205683     145120270
GSS112       206483     144071149
GSS113       205586     145386653
GSS114       203079     147396434
GSS115       181515     137785648
GSS116       7139       3559157
GSS117       131083     82770221
GSS118       170215     80853656
GSS119       184692     79306460
GSS12        148968     76157686
GSS120       170312     148244032
GSS121       178555     121345428
GSS122       180275     146294947
GSS123       188586     121509611
GSS124       188004     139433034
GSS125       193042     128029289
GSS126       191702     93768289
GSS127       164324     153515011
GSS128       164301     114499357
GSS129       60340      36411413
GSS13        146056     69687995
GSS130       167325     152118091
GSS131       168496     151146692
GSS132       168717     151637500
GSS133       169791     150917430
GSS134       167417     154297804
GSS135       180424     134609774
GSS136       172835     148551554
GSS137       173652     123278626
GSS138       187499     93392642
GSS139       259509     53999619
GSS14        173017     86457031
GSS140       258652     39878237
GSS141       113316     17422634
GSS142       256749     59225608
GSS143       266395     55169196
GSS144       191792     88089892
GSS145       197993     66660532
GSS146       185674     147585795
GSS147       181702     150051544
GSS148       166107     153459170
GSS149       167386     154457000
GSS15        162956     97602489
GSS150       233813     76976314
GSS151       231594     78041164
GSS152       129028     58607650
GSS153       214491     54787615
GSS154       158713     98264590
GSS155       182692     113506288
GSS156       136354     87245970
GSS157       163814     129587370
GSS158       179506     157803321
GSS159       188569     155875412
GSS16        173414     88597299
GSS160       191227     126697466
GSS161       218219     139251712
GSS162       222711     133764494
GSS163       162061     99601290
GSS164       151542     86602056
GSS165       40066      30748930
GSS166       212908     158795737
GSS167       193254     101973605
GSS168       173478     69925565
GSS169       204527     158582482
GSS17        185268     116038108
GSS170       206812     161287901
GSS171       208117     164562142
GSS172       206568     134856732
GSS173       203800     145866640
GSS174       224105     136470177
GSS175       201549     65840700
GSS176       174878     94226414
GSS177       258734     142371518
GSS178       32027      18393764
GSS179       87375      64103840
GSS18        191402     111995015
GSS180       83926      63074443
GSS181       103736     48659056
GSS182       68877      58698888
GSS183       7313       6756990
GSS184       68904      58160721
GSS185       69534      56898519
GSS186       69772      56433485
GSS187       71622      56290743
GSS188       67206      50842980
GSS189       76238      58461130
GSS19        101068     45157319
GSS190       86639      74399035
GSS191       81831      44658448
GSS192       92736      45153832
GSS193       63725      47847900
GSS194       78081      61893846
GSS195       70457      59382827
GSS196       68395      63565679
GSS197       63332      52838738
GSS198       94982      42020100
GSS199       18216      4260634
GSS2         183364     92903686
GSS20        181557     101597495
GSS200       113554     71279902
GSS201       206        156931
GSS202       23226      28867035
GSS203       109723     71097090
GSS204       84797      34832316
GSS205       34871      21614135
GSS206       103993     62903048
GSS207       102976     64217927
GSS208       105147     68151070
GSS209       79884      39912713
GSS21        167019     114736525
GSS210       83527      54888563
GSS211       96136      61753164
GSS212       108044     78945540
GSS213       104766     75631871
GSS214       106686     80430314
GSS215       104248     80117974
GSS216       76721      51115479
GSS217       103345     62631542
GSS218       110548     66826634
GSS219       106057     59212883
GSS22        170215     97985052
GSS220       68304      37406646
GSS221       69501      38677774
GSS222       36760      17562257
GSS223       86142      46401696
GSS224       98449      56764845
GSS225       94892      49440300
GSS226       97262      56462367
GSS227       39255      21997076
GSS228       114855     43716251
GSS229       117293     39460437
GSS23        187040     127110766
GSS230       109075     53490846
GSS231       108949     67746338
GSS232       101533     78141049
GSS233       54696      32336729
GSS234       97424      37123873
GSS235       96927      37873906
GSS236       98284      35637304
GSS237       95520      40185769
GSS238       31845      14945615
GSS239       104191     66442509
GSS24        193921     129705997
GSS240       95150      61604354
GSS241       95766      60724103
GSS242       95367      61293700
GSS243       75595      70600991
GSS244       81916      69016607
GSS245       33634      32491215
GSS246       82831      27918196
GSS247       83303      27045179
GSS248       83897      25794921
GSS249       17701      5153013
GSS25        177748     105053124
GSS250       16547      7508221
GSS251       94605      60908245
GSS252       96103      64610709
GSS253       95270      65040443
GSS254       106528     70066025
GSS255       92475      46091116
GSS256       91780      49886764
GSS257       76121      41539409
GSS258       91399      57345117
GSS259       90265      62185096
GSS26        186167     108292693
GSS260       88936      64255670
GSS261       89858      62824607
GSS262       7578       5429987
GSS263       88518      64189595
GSS264       91219      63097213
GSS265       94711      59499098
GSS266       75614      65245817
GSS267       84994      78968925
GSS268       83445      81047461
GSS269       66441      49326047
GSS27        169930     151306582
GSS270       115710     63345042
GSS271       109508     55806767
GSS272       107863     52276734
GSS273       97634      43692152
GSS274       110146     49201977
GSS275       98861      46183314
GSS276       81078      63156364
GSS277       73131      73078884
GSS278       64591      55602017
GSS279       60949      47151330
GSS28        189750     145369165
GSS280       35630      26902277
GSS281       61051      46897110
GSS282       62318      49766268
GSS283       84463      87124836
GSS284       82870      89025174
GSS285       76621      72751886
GSS286       84728      65179968
GSS287       60336      48552561
GSS288       60281      48723318
GSS289       80187      51874172
GSS29        152162     107208934
GSS290       82184      61367380
GSS291       44416      26577232
GSS292       95284      57518679
GSS293       94047      59336854
GSS294       94416      58789547
GSS295       95209      57626971
GSS296       81805      50093018
GSS297       104332     69608616
GSS298       104890     74782057
GSS299       110042     68759043
GSS3         176506     88394950
GSS30        191566     131447531
GSS300       107586     71626914
GSS301       36263      24826247
GSS302       112024     66445708
GSS303       98068      61328228
GSS304       107603     56999080
GSS305       93293      73291771
GSS306       82737      88820842
GSS307       78908      94250347
GSS308       50679      28237992
GSS31        13450      8656646
GSS32        196267     127436164
GSS33        218975     117370716
GSS34        220856     114826209
GSS35        221954     113335961
GSS36        214691     124261741
GSS37        197227     155401496
GSS38        193925     145868584
GSS39        191423     69068243
GSS4         167737     85508955
GSS40        184852     97315817
GSS41        187900     124602991
GSS42        173907     161263297
GSS43        8004       5221848
GSS44        183892     100270488
GSS45        173259     121792670
GSS46        181398     122236115
GSS47        186649     119270268
GSS48        78506      68047416
GSS49        170765     101350443
GSS5         48530      29152779
GSS50        166917     102544102
GSS51        167103     101960158
GSS52        182672     120781278
GSS53        184806     116551793
GSS54        181865     122987307
GSS55        186977     112894752
GSS56        189224     135286782
GSS57        177627     103846288
GSS58        194455     119640341
GSS59        180452     131782736
GSS6         162385     84826755
GSS60        8443       7671350
GSS61        172432     138669830
GSS62        162915     112376376
GSS63        162938     112417881
GSS64        156424     106001336
GSS65        156518     128937002
GSS66        170945     143074183
GSS67        176874     115264070
GSS68        203454     127460178
GSS69        193943     110621262
GSS7         166489     79908475
GSS70        245846     127140005
GSS71        160889     106872521
GSS72        158938     119276986
GSS73        162058     124082099
GSS74        162025     124138233
GSS75        174405     108732169
GSS76        187572     137657091
GSS77        18875      12156685
GSS78        197579     125560090
GSS79        169803     110924099
GSS8         166547     89341078
GSS80        197945     129564914
GSS81        208356     89266280
GSS82        192216     95963421
GSS83        132093     92361323
GSS84        145946     117192653
GSS85        140365     117398498
GSS86        143403     114434440
GSS87        144772     120436985
GSS88        142349     116174710
GSS89        108573     90527351
GSS9         138318     67426405
GSS90        150146     122847619
GSS91        148368     118147832
GSS92        144647     113643750
GSS93        143499     116030455
GSS94        144993     120382205
GSS95        149051     121556637
GSS96        148092     118941752
GSS97        146794     121586406
GSS98        146798     121584299
GSS99        147330     120524395
HTC1         25101      27115273
HTC10        68990      83670707
HTC11        68103      69601473
HTC12        56785      53129056
HTC13        67768      60782734
HTC14        69852      69982210
HTC15        53505      42174094
HTC2         16105      36288852
HTC3         16046      36677221
HTC4         16271      35595400
HTC5         15996      40356923
HTC6         16084      37533163
HTC7         54286      32155873
HTC8         30551      18495385
HTC9         60910      77896619
HTG1         1319       188798847
HTG10        1299       186399691
HTG100       990        189448072
HTG101       997        189338886
HTG102       983        189157681
HTG103       1164       191380395
HTG104       22         2840231
HTG105       1090       190373723
HTG106       1053       190176019
HTG107       1392       191740916
HTG108       1294       191609595
HTG109       1641       191150380
HTG11        4          606452
HTG110       1331       192003621
HTG111       886        128541061
HTG112       1439       190844464
HTG113       1519       189555079
HTG114       1507       185985994
HTG115       1505       180139091
HTG116       1439       189988054
HTG117       1549       182739821
HTG118       1576       179517828
HTG119       1380       157639225
HTG12        1452       184004673
HTG120       1591       179505523
HTG121       1587       179611588
HTG122       1580       179575648
HTG123       1598       179580959
HTG124       1603       179513131
HTG125       1581       180746555
HTG126       1555       183982954
HTG127       1574       183957055
HTG128       1485       187625796
HTG129       1414       189852056
HTG13        875        191786413
HTG130       1063       185876469
HTG131       674        108990706
HTG132       1558       186647331
HTG133       1862       178854359
HTG134       987        187982440
HTG135       1085       193367281
HTG136       1091       193164785
HTG137       578        105203883
HTG138       1032       189666580
HTG139       1055       192668594
HTG14        754        192249622
HTG140       1164       191966294
HTG141       1079       192247965
HTG142       1083       192977959
HTG143       588        103686357
HTG144       1122       192664765
HTG145       1078       192391538
HTG146       1078       192343720
HTG147       1167       191963087
HTG148       2125       191459994
HTG149       1096       192456765
HTG15        746        192098155
HTG150       1077       192049291
HTG151       1088       192458469
HTG152       1037       190364444
HTG153       1998       182603873
HTG154       1766       189499012
HTG155       103        6955512
HTG16        785        191953105
HTG17        796        191820344
HTG18        776        191918138
HTG19        2070       170867394
HTG2         2464       186026155
HTG20        1105       187256821
HTG21        874        179202862
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2516       185249883
HTG30        911        190941779
HTG31        841        171449145
HTG32        876        191233060
HTG33        967        189366255
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2553       188400147
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1257       188207454
HTG43        1169       188143648
HTG44        1150       188026157
HTG45        1118       191332771
HTG46        1268       190550291
HTG47        1175       190762525
HTG48        1128       191238543
HTG49        1046       191316194
HTG5         1283       185468219
HTG50        1030       189606221
HTG51        1041       178579157
HTG52        969        190260546
HTG53        1105       190197636
HTG54        1046       190176357
HTG55        1014       189806472
HTG56        968        189013700
HTG57        80         14074619
HTG58        1010       189338312
HTG59        1029       189906352
HTG6         1273       185194143
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1086       189577588
HTG64        1065       189501278
HTG65        1169       188886612
HTG66        1179       187436132
HTG67        1283       184477002
HTG68        90         11586390
HTG69        1224       185639149
HTG7         1276       185273299
HTG70        1238       184594896
HTG71        1245       184608221
HTG72        1182       187730359
HTG73        1016       169381726
HTG74        1124       189291870
HTG75        1111       192198396
HTG76        1147       192455345
HTG77        1188       192530503
HTG78        1070       181090314
HTG79        1182       192179432
HTG8         1458       184539635
HTG80        1130       192597104
HTG81        1231       192164530
HTG82        1131       192205387
HTG83        907        155718784
HTG84        1244       190290657
HTG85        1256       189445002
HTG86        1159       192543685
HTG87        1159       192540759
HTG88        928        158882781
HTG89        1197       192656061
HTG9         1200       186946737
HTG90        1117       192722248
HTG91        1161       192777037
HTG92        1131       193019385
HTG93        902        149867285
HTG94        1065       192616675
HTG95        1172       192538158
HTG96        1029       189700171
HTG97        1076       190088822
HTG98        658        122808035
HTG99        1019       189897801
INV1         94383      48935179
INV10        81162      72343355
INV100       5504       151289809
INV101       3538       155804774
INV102       20175      44157400
INV103       73248      58014373
INV104       76305      45983604
INV105       76054      47426166
INV106       76603      51639158
INV107       71282      65389068
INV108       24407      64647045
INV11        47984      93509744
INV12        36         176944197
INV13        171        169829817
INV14        9          195252378
INV15        46379      122816688
INV16        78629      61955487
INV17        28082      25204739
INV18        85667      66961577
INV19        81730      67552428
INV2         59376      92750113
INV20        79188      68589192
INV21        47288      43476391
INV22        36854      122809002
INV23        283        150449073
INV24        51753      102163675
INV25        78070      57226131
INV26        72188      61147001
INV27        23860      127823841
INV28        6          133712559
INV29        57391      102357677
INV3         1370       188389428
INV30        75297      50857393
INV31        77154      54616351
INV32        3652       3313475
INV33        77333      54848004
INV34        75675      55564151
INV35        76458      55955387
INV36        77173      59897900
INV37        73864      49021860
INV38        2665       1707468
INV39        79666      57486523
INV4         908        125771686
INV40        75502      56176713
INV41        75096      61731666
INV42        78719      58697179
INV43        52575      35237300
INV44        78699      56875199
INV45        74438      52705468
INV46        75511      57359860
INV47        78046      58282240
INV48        36605      31611105
INV49        76325      48760134
INV5         26741      110390585
INV50        73558      44851049
INV51        75828      45871311
INV52        77398      54482208
INV53        29657      21430501
INV54        77336      54787277
INV55        74700      44642855
INV56        74024      43738968
INV57        74254      42863542
INV58        29775      18006403
INV59        69784      41440732
INV6         78693      72078695
INV60        69415      41583485
INV61        69053      41728046
INV62        69134      41115948
INV63        52564      34799468
INV64        69562      40595880
INV65        71148      43811465
INV66        68648      51180218
INV67        67291      48351144
INV68        67550      52717104
INV69        71413      53744091
INV7         53874      96439389
INV70        71347      54154257
INV71        74745      62245262
INV72        76976      57077153
INV73        75867      56295350
INV74        68036      78621289
INV75        41659      148447073
INV76        6656       13427770
INV77        81899      126749699
INV78        101136     110191760
INV79        116939     96644568
INV8         6264       174635524
INV80        99289      69232818
INV81        39632      151261647
INV82        472        47268496
INV83        800        42674647
INV84        566        40635863
INV85        8037       115580217
INV86        8071       166406101
INV87        15490      165838134
INV88        21683      161462030
INV89        1340       8441268
INV9         35645      41700294
INV90        29318      156008826
INV91        38723      149357093
INV92        51920      140051234
INV93        71367      126811786
INV94        64375      76908791
INV95        118449     93189348
INV96        62122      144117104
INV97        1743       177545896
INV98        20056      130655856
INV99        2583       149810510
MAM1         21087      155185392
MAM10        1          249270926
MAM11        1          224538689
MAM12        1          119391557
MAM13        1          108026203
MAM14        1          117168053
MAM15        1          100190483
MAM16        1          90795278
MAM17        2          181387745
MAM18        2          141515582
MAM19        2          145976525
MAM2         14369      164686387
MAM20        2          152818830
MAM21        2          141060329
MAM22        3          161893012
MAM23        3          155380844
MAM24        2          89552564
MAM25        1          135657913
MAM26        1          152899641
MAM27        1          136179924
MAM28        1          116383733
MAM29        1          113757587
MAM3         20044      31721943
MAM30        1          118388990
MAM31        1          102953489
MAM32        2          129845822
MAM33        1          103782134
MAM34        2          139482799
MAM35        2          154419370
MAM36        2          161344367
MAM37        3          189161858
MAM38        3          172078298
MAM39        3          166779946
MAM4         26813      24993565
MAM40        5          193070562
MAM41        9          140471672
MAM42        54         7614329
MAM43        215        34073042
MAM44        431        71272130
MAM45        861        68509101
MAM46        1706       2411269
MAM47        6836       6159435
MAM48        80286      75310347
MAM49        30240      118091297
MAM5         13731      20581276
MAM50        76918      63014687
MAM51        69718      72880981
MAM52        65462      78719838
MAM53        52872      89886432
MAM54        20065      149885511
MAM55        29562      88387962
MAM6         3445       7368868
MAM7         107        699953
MAM8         19         1775631
MAM9         1          275920749
PAT1         225426     70993955
PAT10        126654     101608778
PAT100       180490     3429310
PAT101       180135     3422565
PAT102       179993     3419867
PAT103       179981     3419639
PAT104       125419     2711863
PAT105       349650     8741250
PAT106       186050     91875274
PAT107       107513     135541957
PAT108       3843       194691476
PAT109       137991     108090545
PAT11        90452      62784230
PAT110       151783     50730134
PAT111       227882     34313993
PAT112       253630     16070281
PAT113       177600     67409226
PAT114       48026      21887625
PAT115       115736     110547238
PAT116       139350     84264510
PAT117       161028     103164685
PAT118       167185     100849156
PAT119       134737     117530952
PAT12        142880     63395362
PAT120       36618      23041490
PAT121       194814     83178152
PAT122       155047     107550529
PAT123       364428     11160383
PAT124       248176     64617758
PAT125       132887     40797313
PAT126       328269     22915988
PAT127       155764     104210281
PAT128       126354     109119371
PAT129       128479     122630735
PAT13        104574     59133164
PAT130       21689      184619586
PAT131       149967     111615722
PAT132       168658     100093679
PAT133       43844      172281111
PAT134       8038       42566337
PAT135       33730      178662375
PAT136       155435     110345001
PAT137       180818     91511668
PAT138       137025     116369121
PAT139       119019     125218305
PAT14        103238     50079881
PAT140       4849       4475753
PAT141       158424     101541724
PAT142       184327     90868267
PAT143       185136     85636854
PAT144       177480     94577577
PAT145       20467      17346132
PAT146       149543     109199294
PAT147       161593     103400312
PAT148       186330     92436086
PAT149       228368     45729382
PAT15        121140     53105997
PAT150       205276     48281754
PAT151       283466     9264744
PAT152       224633     46570735
PAT153       95243      2594242
PAT154       274370     21772171
PAT155       186799     63026714
PAT156       111649     105352203
PAT157       41636      8368539
PAT158       88148      89406799
PAT159       79145      97083182
PAT16        113080     61315470
PAT160       152804     75261060
PAT161       163971     75813834
PAT162       125692     90269097
PAT163       98234      89700149
PAT164       160478     39723877
PAT165       274167     5209173
PAT166       274122     5208318
PAT167       274122     5208318
PAT168       225455     4283645
PAT169       273522     5196918
PAT17        40106      16656738
PAT170       235901     27355379
PAT171       209223     45648746
PAT172       1997       69573
PAT173       165888     75954920
PAT174       91807      127288620
PAT175       177921     70072695
PAT176       210426     71386681
PAT177       39406      44066854
PAT178       236689     61271332
PAT179       125083     125590832
PAT18        147938     53119339
PAT180       217679     68931191
PAT181       197384     85491224
PAT182       192799     86183567
PAT183       160052     103142924
PAT184       158485     104252941
PAT185       152376     102303293
PAT186       153284     104821004
PAT187       108066     120931232
PAT188       131010     97456392
PAT189       129357     120521145
PAT19        156198     77748072
PAT190       175044     97302491
PAT191       144298     115604482
PAT192       132490     120416967
PAT193       99092      135657342
PAT194       156484     107532837
PAT195       187757     62538940
PAT196       31550      29445733
PAT197       93826      87469183
PAT198       91784      80783259
PAT199       85388      91256491
PAT2         194676     86398557
PAT20        104148     118963756
PAT200       109494     54259324
PAT201       97906      55962298
PAT202       151406     25025002
PAT203       92604      85288661
PAT204       27031      161947013
PAT205       116076     64442611
PAT206       78456      27182019
PAT207       3632       191904545
PAT208       84659      79944678
PAT209       147804     24785625
PAT21        131837     98082051
PAT210       77114      100107366
PAT211       95461      72396213
PAT212       130092     32533691
PAT213       1386       4384298
PAT214       107201     62296741
PAT215       140564     13376548
PAT216       152488     23320938
PAT217       78288      10420708
PAT218       53299      70147281
PAT219       41588      53257148
PAT22        83498      75717880
PAT220       60912      55078171
PAT221       37663      64678945
PAT222       41773      60415230
PAT223       40163      55397856
PAT224       87860      55688969
PAT225       115384     52029988
PAT226       26006      9048648
PAT227       105881     53605089
PAT228       97873      46948548
PAT229       86062      71840182
PAT23        124775     103848067
PAT230       97452      8890305
PAT231       117381     19495921
PAT232       87918      130066340
PAT233       161762     78738382
PAT234       211965     49799560
PAT235       174308     64860705
PAT236       52276      7524806
PAT237       162448     79722768
PAT238       121563     100427675
PAT239       85468      130882785
PAT24        118220     108124229
PAT240       38100      167516171
PAT241       35868      169133023
PAT242       74292      134041199
PAT243       256650     29271966
PAT244       136543     93162338
PAT245       150103     82886286
PAT246       140933     76146180
PAT247       12272      8259858
PAT248       142939     87445786
PAT249       144204     95215889
PAT25        150174     84692460
PAT250       264981     9683594
PAT251       144377     4340536
PAT252       240761     24361869
PAT253       256037     8953305
PAT254       262605     3939075
PAT255       262605     3939075
PAT256       153472     3896783
PAT257       225731     30138510
PAT258       151701     93683972
PAT259       172305     96419302
PAT26        178514     63567521
PAT260       73385      9861487
PAT261       132237     118204122
PAT262       127658     120598622
PAT263       3357       195490777
PAT264       1277       196638191
PAT265       113842     128323979
PAT266       77057      79485375
PAT267       207306     76888680
PAT268       101163     43549091
PAT269       93045      17617696
PAT27        63317      1582925
PAT270       47484      136138512
PAT271       6430       91690961
PAT272       76636      105127353
PAT273       101249     76175895
PAT274       37392      112048481
PAT275       34156      73068608
PAT276       37959      57713256
PAT277       37837      58072485
PAT278       37921      57724944
PAT279       37832      58049740
PAT28        102489     77951993
PAT280       46231      38675647
PAT281       129929     18053062
PAT282       115666     50591436
PAT283       124999     25113741
PAT284       76619      37966262
PAT285       133959     31130348
PAT286       130625     26677385
PAT287       143447     9914585
PAT288       166159     74060037
PAT289       261571     3923565
PAT29        95015      87383270
PAT290       197120     50753581
PAT291       128249     104725701
PAT292       99526      13340137
PAT293       202590     51163528
PAT294       157990     81606772
PAT295       145002     9334643
PAT296       132977     3990173
PAT297       93701      2811392
PAT298       133140     6548394
PAT299       96159      70667857
PAT3         173714     96696797
PAT30        120010     62059595
PAT300       103123     49989409
PAT301       125140     22774974
PAT302       144928     3764734
PAT303       136103     15294700
PAT304       63878      6660079
PAT305       101572     43643209
PAT306       51814      126601062
PAT307       39634      58321734
PAT308       33784      76649820
PAT309       36090      65665515
PAT31        97924      79759401
PAT310       38048      57768129
PAT311       37900      58196919
PAT312       99342      26067885
PAT313       145180     2177700
PAT314       29996      449940
PAT315       87991      80740060
PAT316       146168     18768506
PAT317       52188      56393663
PAT318       37443      60836017
PAT319       53951      58521871
PAT32        129222     55157158
PAT320       122168     32826409
PAT321       142686     8655091
PAT322       147405     2211075
PAT323       134621     2019315
PAT324       143736     3286924
PAT325       134802     7478438
PAT326       45229      66228994
PAT327       53339      67823092
PAT328       110808     53972653
PAT329       108085     52941093
PAT33        88475      49384193
PAT330       115098     64584107
PAT331       165724     98785249
PAT332       125021     117957949
PAT333       143634     112415153
PAT334       224958     64914941
PAT335       57667      157394106
PAT336       172761     81063170
PAT337       104301     44294074
PAT34        118746     69220727
PAT35        120171     36360252
PAT36        122826     44471256
PAT37        94731      87320649
PAT38        150579     21220175
PAT39        147081     34849658
PAT4         156010     106306269
PAT40        110909     55382520
PAT41        33841      36793621
PAT42        96351      83600457
PAT43        99709      72323829
PAT44        138998     37627662
PAT45        143760     37193283
PAT46        125072     64720384
PAT47        100400     86321935
PAT48        99428      68548842
PAT49        111862     67345341
PAT5         50111      20254509
PAT50        60374      52824381
PAT51        136399     108802801
PAT52        168265     98178509
PAT53        119298     126920074
PAT54        201754     75944942
PAT55        69600      127456544
PAT56        27795      181082835
PAT57        189418     92960765
PAT58        277142     6928550
PAT59        122390     31451008
PAT6         171986     92903236
PAT60        162936     78473994
PAT61        92866      90600302
PAT62        109253     73717056
PAT63        123341     64227958
PAT64        62039      29215114
PAT65        70923      110313258
PAT66        88692      82810627
PAT67        93124      79739812
PAT68        94118      72274536
PAT69        94231      74769308
PAT7         157680     87491517
PAT70        118843     59763989
PAT71        96798      9793333
PAT72        177635     10656487
PAT73        173172     10978133
PAT74        173161     10971226
PAT75        94832      96316584
PAT76        101        195797548
PAT77        66         196768687
PAT78        104        196327400
PAT79        12309      182633014
PAT8         127566     101540029
PAT80        86423      5090841
PAT81        152298     9718010
PAT82        152308     9704500
PAT83        152313     9703390
PAT84        152308     9704292
PAT85        95141      89656500
PAT86        93068      93878198
PAT87        31086      33386746
PAT88        83471      94698793
PAT89        16516      179586411
PAT9         134747     98544086
PAT90        167160     18621902
PAT91        180755     3434345
PAT92        179225     3405275
PAT93        177411     3370809
PAT94        92463      1756797
PAT95        170988     12446769
PAT96        180501     3429519
PAT97        180495     3429405
PAT98        180484     3429196
PAT99        133550     2537450
PHG1         5860       106560289
PHG2         3087       109202789
PHG3         2190       109934659
PHG4         2303       110966211
PHG5         928        26365137
PLN1         60438      94035916
PLN10        60714      60774705
PLN100       14346      29953091
PLN101       19350      134329049
PLN102       78614      75189036
PLN103       98945      57605962
PLN104       30226      32279321
PLN105       81005      72165279
PLN106       78271      76458778
PLN107       80725      70939334
PLN108       82132      75993700
PLN109       57130      30580150
PLN11        72065      77519408
PLN110       99621      56067789
PLN111       82026      69872943
PLN112       46492      98386753
PLN113       3093       156776173
PLN114       11877      162780335
PLN115       29625      121156167
PLN116       56642      101052484
PLN117       14359      9834023
PLN118       81748      72856723
PLN119       16745      12451853
PLN12        39650      50606206
PLN120       49499      72634265
PLN121       25061      110565816
PLN122       13564      89766260
PLN123       1          774434471
PLN124       8305       28494037
PLN125       1858       148969943
PLN126       2          135217911
PLN127       2          155188403
PLN128       2          140023111
PLN129       2          154604167
PLN13        39364      63980764
PLN130       2          148753627
PLN131       3          173772618
PLN132       3          178836778
PLN133       3          176344173
PLN134       3          195539469
PLN135       12431      129466187
PLN136       82777      66160204
PLN137       94006      58020357
PLN138       20367      14687818
PLN139       78042      71612051
PLN14        24732      121021270
PLN140       70796      84949828
PLN141       77806      68070114
PLN142       71867      77259557
PLN143       80675      67005716
PLN144       4084       3772516
PLN145       78821      64034279
PLN146       75375      68567469
PLN147       82655      59021261
PLN148       81728      59644749
PLN149       22191      25370946
PLN15        21159      106162909
PLN150       74544      63577877
PLN151       72520      71630954
PLN152       63526      85253409
PLN153       57461      66216002
PLN154       92622      52862397
PLN155       75020      68691165
PLN156       72038      68808265
PLN157       41566      49841008
PLN158       71267      71613444
PLN159       62421      79204065
PLN16        17587      144956899
PLN160       62688      82649979
PLN161       37938      35945901
PLN162       70686      73052286
PLN163       65434      77025180
PLN164       66206      78870461
PLN165       59628      85576435
PLN166       61200      84166307
PLN167       60098      81339434
PLN168       14948      12840204
PLN169       59519      86142596
PLN17        17646      146317509
PLN170       63312      78390683
PLN171       53560      90823634
PLN172       61066      80597234
PLN173       49111      94503523
PLN174       12823      14485763
PLN175       52786      95717543
PLN176       66206      77522375
PLN177       49580      93079221
PLN178       12233      128769802
PLN179       75         195698703
PLN18        17565      146440300
PLN180       15711      172828585
PLN181       3169       977593
PLN182       12512      154597097
PLN183       6          176139136
PLN184       41452      84574216
PLN185       1          563502314
PLN186       6694       164020655
PLN187       6          177442435
PLN188       3242       157347003
PLN189       5          195524497
PLN19        1356       10854690
PLN190       8099       163968915
PLN191       14285      131457198
PLN192       50190      96408865
PLN193       36843      22399969
PLN194       50818      94951512
PLN195       49749      88464541
PLN196       37369      111989704
PLN197       66829      81309344
PLN198       15773      33457993
PLN2         75111      78281869
PLN20        23259      121287391
PLN21        6083       151149287
PLN22        1184       166859751
PLN23        1484       166774036
PLN24        33         165555096
PLN25        6          165567871
PLN26        47         169734561
PLN27        4          173777832
PLN28        4          146720977
PLN29        22001      113591663
PLN3         37396      104768599
PLN30        67654      70403678
PLN31        28873      30903954
PLN32        77500      76702020
PLN33        35622      40580338
PLN34        57311      72144744
PLN35        28689      28923384
PLN36        2644       102424035
PLN37        3          73585790
PLN38        30         105815221
PLN39        282        133858659
PLN4         1378       179337397
PLN40        99         129632256
PLN41        285        131701927
PLN42        157        130226554
PLN43        90         71965224
PLN44        157        128672551
PLN45        141        130200994
PLN46        173        129439941
PLN47        166        136053947
PLN48        211        155822577
PLN49        273        194773389
PLN5         1846       186136088
PLN50        113        80920130
PLN51        273        194661068
PLN52        182        184910473
PLN53        121        183815870
PLN54        5          168777512
PLN55        24         192004664
PLN56        68         76006381
PLN57        71         185395548
PLN58        28         139366021
PLN59        5          169521320
PLN6         1848       194308162
PLN60        12         191290805
PLN61        105        184590114
PLN62        128        90595192
PLN63        121        187155874
PLN64        28         162873013
PLN65        6          172580596
PLN66        8          194011608
PLN67        18         125365975
PLN68        4          158605168
PLN69        2          153895754
PLN7         1688       194295727
PLN70        2          137270873
PLN71        3          183683931
PLN72        2          138356491
PLN73        6          196214810
PLN74        82         186878101
PLN75        9          181884660
PLN76        6          51253148
PLN77        74         124609184
PLN78        6          115354966
PLN79        1          99791824
PLN8         1831       193287715
PLN80        1          143206517
PLN81        1          122064722
PLN82        1          116166884
PLN83        2          192382203
PLN84        2          173014123
PLN85        1          114519869
PLN86        1          149379573
PLN87        1          122213787
PLN88        1          150766190
PLN89        1          135085854
PLN9         36864      126502327
PLN90        1          153119099
PLN91        1          153789061
PLN92        1          132998879
PLN93        1          136776503
PLN94        1          159154999
PLN95        13         140662502
PLN96        37         16871
PLN97        149        79314
PLN98        2469       93786416
PLN99        7181       18795412
PRI1         23034      59762327
PRI10        1253       178780857
PRI11        860        104346432
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191661798
PRI17        1137       193659098
PRI18        1098       194127649
PRI19        1166       193677094
PRI2         22395      144969193
PRI20        1737       191814810
PRI21        2631       189865971
PRI22        2079       192522927
PRI23        1206       195380396
PRI24        16434      131620845
PRI25        27929      79132165
PRI26        59941      84370864
PRI27        36109      81894692
PRI28        8761       172362823
PRI29        2264       191585097
PRI3         1438       174353221
PRI30        1666       190931151
PRI31        2074       192118866
PRI32        2196       191069594
PRI33        13104      162575570
PRI34        2098       170891945
PRI35        57042      89265033
PRI36        3822       7514956
PRI37        33758      66540345
PRI38        19384      127316062
PRI39        20385      148361481
PRI4         1278       185868863
PRI40        67597      84508119
PRI41        51511      91784353
PRI42        38584      73711396
PRI43        47895      96565841
PRI44        26429      103374244
PRI45        29288      110627209
PRI46        25134      104927029
PRI47        29535      101884999
PRI48        5091       42452873
PRI49        39437      104761922
PRI5         1335       184501516
PRI50        29647      110104156
PRI51        28663      104535431
PRI52        56867      34367204
PRI53        1          229594237
PRI54        1          190673448
PRI55        1          197221778
PRI56        11627      168820738
PRI57        16303      111579731
PRI58        57620      97481387
PRI59        326        7551081
PRI6         1179       179994692
PRI7         1229       180208989
PRI8         1221       179042773
PRI9         1372       174851936
ROD1         37508      133642525
ROD10        989        182010602
ROD11        307        58052732
ROD12        1034       185475616
ROD13        941        182878681
ROD14        1040       189304693
ROD15        950        180388993
ROD16        967        181966557
ROD17        991        185834465
ROD18        1190       190611728
ROD19        15160      158960947
ROD2         908        176070435
ROD20        20997      153967043
ROD21        1216       193771265
ROD22        1003       157974000
ROD23        15427      168555495
ROD24        38040      70157653
ROD25        19436      118416561
ROD26        2223       191929834
ROD27        152502     18066421
ROD28        75871      79363789
ROD29        84588      53055811
ROD3         910        173108361
ROD30        67221      76629010
ROD31        5475       6349457
ROD4         900        173849398
ROD5         919        174488736
ROD6         965        177341176
ROD7         974        179555511
ROD8         969        181372318
ROD9         1001       181665338
STS1         85559      36896329
STS10        58083      44552041
STS11        48085      36873197
STS12        58099      43769473
STS13        64422      42856172
STS14        93857      34186170
STS15        104888     26688384
STS16        8950       2430284
STS17        104293     27679407
STS18        97854      33659726
STS19        97350      34711104
STS2         85035      49980125
STS20        69670      24724491
STS3         66345      26281661
STS4         77125      37068775
STS5         8191       4810172
STS6         54412      31740785
STS7         54312      31932091
STS8         54469      32048894
STS9         55909      37990705
SYN1         53376      71688259
SYN10        21938      62565883
SYN2         43618      81495740
SYN3         23532      126642759
SYN4         4594       176471685
SYN5         4588       176370389
SYN6         4594       176441445
SYN7         11379      161065834
SYN8         57221      74558695
SYN9         52411      84978701
TSA1         119867     38078881
TSA10        15758      19457445
TSA100       84628      38647321
TSA101       76860      53168945
TSA102       66230      68312035
TSA103       64656      75546157
TSA104       88788      55755865
TSA105       48310      25539654
TSA106       74550      86726411
TSA107       80730      75604381
TSA108       85476      72848266
TSA109       77395      84130963
TSA11        134601     34776357
TSA110       95638      51743388
TSA111       98570      70636110
TSA112       57559      94588287
TSA113       109914     49593061
TSA114       63991      68743855
TSA115       81365      89245306
TSA116       70500      72924301
TSA117       57286      120848369
TSA118       3694       3387893
TSA119       107244     68283732
TSA12        59950      20118999
TSA120       93864      83831193
TSA121       99424      76800693
TSA122       86215      66900549
TSA123       85137      59406979
TSA124       78341      62345274
TSA125       82329      77771081
TSA126       99805      59600144
TSA127       94858      42440076
TSA128       75839      55282740
TSA129       40596      38103163
TSA13        64437      60230317
TSA130       59842      61355677
TSA131       59222      61956330
TSA132       59447      62201688
TSA133       72514      79237539
TSA134       88241      50637266
TSA135       63416      65296736
TSA136       832        252551
TSA137       78109      34727398
TSA138       74879      67607515
TSA139       81463      78932809
TSA14        93892      60774882
TSA140       75039      64606512
TSA141       40597      33646913
TSA142       87917      70744689
TSA143       89637      68264227
TSA144       84723      77981171
TSA145       77299      81247994
TSA146       10512      8596527
TSA147       104870     53942459
TSA148       80798      61849074
TSA149       70740      78279664
TSA15        91383      65106730
TSA150       72679      69631207
TSA151       88473      74137515
TSA152       89286      71316634
TSA153       63435      101784529
TSA154       95798      75256889
TSA155       17016      11871471
TSA156       83362      63896652
TSA157       83862      64153636
TSA158       79385      73616320
TSA159       77070      76639823
TSA16        6713       3516114
TSA160       93994      58998624
TSA161       101042     66808521
TSA162       33299      23300565
TSA163       102259     63715273
TSA164       94026      74723592
TSA165       80955      64132522
TSA166       32032      49058197
TSA167       51993      98573117
TSA168       46992      108059536
TSA169       45060      111729686
TSA17        76328      86345063
TSA170       42052      117437639
TSA171       39600      122092043
TSA172       37741      125627862
TSA173       30097      107288374
TSA174       79278      65831927
TSA175       61766      78801121
TSA176       65943      56757743
TSA177       40135      19854948
TSA178       38520      26931630
TSA179       35906      38483420
TSA18        79571      72873999
TSA180       33719      32835987
TSA181       31723      56974521
TSA182       31529      57827756
TSA183       39360      23153642
TSA184       40480      18197417
TSA185       41160      15188692
TSA186       41560      13420160
TSA187       41798      12369266
TSA188       25925      7379156
TSA189       41988      11531997
TSA19        87122      45676818
TSA190       42033      11331256
TSA191       42081      11121330
TSA192       42155      10791502
TSA193       42199      10594518
TSA194       42246      10386471
TSA195       44469      10970414
TSA196       89574      35651580
TSA197       85248      64327814
TSA198       71514      85727361
TSA199       104370     34591482
TSA2         113513     41575102
TSA20        74112      88789066
TSA200       79480      68069082
TSA201       46133      105547678
TSA202       89741      47774789
TSA203       47189      118699045
TSA204       87176      55356978
TSA205       79486      69671475
TSA206       52801      112476082
TSA207       44638      125583658
TSA208       38073      136130006
TSA209       61544      98133552
TSA21        65190      48723008
TSA210       12102      5800279
TSA211       58652      100603319
TSA212       75646      71894803
TSA213       50457      112947945
TSA214       77365      67441564
TSA215       53726      106980439
TSA216       75926      70339630
TSA217       59610      97707887
TSA218       61369      69985665
TSA219       74428      72821943
TSA22        81439      82281132
TSA220       87323      50951603
TSA221       50899      111127179
TSA222       71562      76448065
TSA223       62951      91534461
TSA224       85139      53774514
TSA225       83387      56083879
TSA226       10763      4953843
TSA227       64419      91116089
TSA228       71926      77423316
TSA229       70933      78656816
TSA23        63006      84596593
TSA230       88398      46498714
TSA231       63160      89037236
TSA232       93507      36784395
TSA233       65147      85307235
TSA234       57907      35845393
TSA24        83853      73694341
TSA25        100169     54162179
TSA26        62763      19138064
TSA27        86234      70407370
TSA28        121324     38862791
TSA29        135063     35310894
TSA3         110421     41064860
TSA30        51855      68718843
TSA31        47829      62910692
TSA32        1549       2253596
TSA33        61314      82147786
TSA34        93472      67491932
TSA35        110655     50015529
TSA36        106345     50201806
TSA37        102307     54388700
TSA38        103560     49787675
TSA39        22637      12494687
TSA4         112137     47720377
TSA40        66642      59388549
TSA41        92820      68251805
TSA42        93446      62442749
TSA43        79794      86536802
TSA44        100835     49268702
TSA45        114271     34482783
TSA46        94903      69055916
TSA47        10363      5895735
TSA48        94696      35577587
TSA49        78213      36138263
TSA5         74536      22525878
TSA50        106962     43690670
TSA51        114967     46107338
TSA52        26890      19148939
TSA53        104334     51655152
TSA54        101776     54365987
TSA55        97582      60662772
TSA56        82228      86008299
TSA57        67802      29059764
TSA58        90828      71678131
TSA59        97915      54906712
TSA6         112164     59299839
TSA60        60403      105707789
TSA61        86731      65967022
TSA62        79360      70616777
TSA63        83856      71990209
TSA64        82738      73073597
TSA65        66555      88126792
TSA66        91172      67099618
TSA67        76182      84986777
TSA68        72161      72968018
TSA69        69246      61199847
TSA7         87942      58097196
TSA70        85711      78567288
TSA71        85092      79423958
TSA72        68092      94854440
TSA73        86359      70218089
TSA74        85532      52029253
TSA75        103092     68803181
TSA76        87069      60219812
TSA77        103531     57122474
TSA78        75996      72532642
TSA79        74667      42478724
TSA8         105281     73053535
TSA80        88020      79406904
TSA81        91816      69554168
TSA82        78643      53628715
TSA83        78975      56799054
TSA84        97227      61708495
TSA85        37388      33674257
TSA86        89459      77100280
TSA87        95713      55692877
TSA88        111184     45067626
TSA89        97283      59077752
TSA9         110108     61261039
TSA90        65710      96700007
TSA91        13351      13164463
TSA92        101868     55796774
TSA93        91582      53917306
TSA94        94202      43888098
TSA95        85593      75399941
TSA96        73247      71810899
TSA97        38585      45011146
TSA98        77356      80756171
TSA99        77829      55237291
UNA1         440        296706
VRL1         65947      72142874
VRL10        43873      73774818
VRL11        42987      73673368
VRL12        53130      72137701
VRL13        64006      72719425
VRL14        68180      69372657
VRL15        56153      74408186
VRL16        7329       8881269
VRL17        63262      72358022
VRL18        58769      73110617
VRL19        64057      65683137
VRL2         67720      67384576
VRL20        57713      74257129
VRL21        49005      61656725
VRL22        55440      73616666
VRL23        59331      72332131
VRL24        56529      74700212
VRL25        57041      73709504
VRL26        24632      42797379
VRL27        52775      76296198
VRL28        38628      83181276
VRL29        48757      75793327
VRL3         71695      63953999
VRL30        49308      74958134
VRL31        48015      79724027
VRL32        10949      18009423
VRL33        50165      78997294
VRL34        43019      87959091
VRL35        42186      84136495
VRL36        49205      80552721
VRL37        37760      88661095
VRL38        14213      28997812
VRL39        36741      91320241
VRL4         67955      68229854
VRL40        46933      82343221
VRL41        46785      78218672
VRL42        40624      89408921
VRL43        47676      81438658
VRL44        17901      34179395
VRL45        43419      82457822
VRL46        39966      86642332
VRL47        43431      81264265
VRL48        39367      87902627
VRL49        37580      91179392
VRL5         70086      69168440
VRL50        3750       3973458
VRL51        52488      82349654
VRL52        40581      95019902
VRL53        33489      100572463
VRL54        37406      95795976
VRL55        35978      95478687
VRL56        39880      84882021
VRL57        47248      58128132
VRL6         14829      20842863
VRL7         48737      77996724
VRL8         47057      72917106
VRL9         44222      72168562
VRT1         68592      78924938
VRT10        18698      27611122
VRT11        4665       186998242
VRT12        1320       193372782
VRT13        1392       193166295
VRT14        1972       24043127
VRT15        4685       4674270
VRT16        1171       26255719
VRT17        293        13983146
VRT18        30         172800274
VRT19        6          188303802
VRT2         1261       194022973
VRT20        6          193561301
VRT21        7          192869947
VRT22        5          167414846
VRT23        6          185887951
VRT24        6          190195176
VRT25        7          190542399
VRT26        6          184497247
VRT27        6          170891080
VRT28        7          196676012
VRT29        7          181307350
VRT3         48995      120860522
VRT30        6          164644620
VRT31        7          169411889
VRT32        34         138817921
VRT33        147        10842596
VRT34        586        15797052
VRT35        2343       67436863
VRT36        13371      172470823
VRT37        5827       185181355
VRT38        3801       188841871
VRT39        50362      115903266
VRT4         23844      150993601
VRT40        80331      70127200
VRT41        78385      67152806
VRT42        17783      13200461
VRT43        71650      78398544
VRT44        46103      122321814
VRT45        78052      64132995
VRT46        80335      62692049
VRT47        82674      58582478
VRT48        31365      21908535
VRT49        103616     66610837
VRT5         39378      102230371
VRT50        82164      57051052
VRT51        86545      59135710
VRT52        60344      45189919
VRT53        91424      54874518
VRT54        76796      58475158
VRT55        6587       5641652
VRT56        75777      59210940
VRT57        55988      45191779
VRT58        81766      57668731
VRT59        76188      60072545
VRT6         73313      67136256
VRT60        79070      60763273
VRT61        56371      22300893
VRT62        110430     53368138
VRT63        77788      67014249
VRT64        94461      54313860
VRT65        6764       4714410
VRT66        82565      56073475
VRT67        76393      63056750
VRT68        81603      58051873
VRT69        35066      123455736
VRT7         1631       3490698
VRT70        42         184527474
VRT71        102        182751359
VRT72        130        193761317
VRT73        296        192673693
VRT74        591        194013929
VRT75        1884       192119838
VRT76        34145      162025537
VRT77        58561      17275932
VRT78        145106     21008965
VRT79        75789      25336814
VRT8         32091      64261337
VRT80        13364      176952840
VRT81        11         188688279
VRT82        8          183427060
VRT83        12         195920558
VRT84        10         189393119
VRT85        243        196418294
VRT86        327        196217075
VRT87        2638       194315601
VRT88        2441       194492035
VRT89        10352      174412037
VRT9         5305       9780273
VRT90        9          179667620
VRT91        9          163877519
VRT92        14236      151367836
VRT93        66098      71505791
VRT94        27314      22685331

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 227.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

26616192 19752523722   Homo sapiens
9898582  10246475076   Mus musculus
2199477   6530046440   Rattus norvegicus
2232137   5431692037   Bos taurus
4209842   5245788885   Zea mays
3301354   5075446882   Sus scrofa
1346898   3237283130   Hordeum vulgare subsp. vulgare
125467    3220757391   Escherichia coli
1729561   3191415637   Danio rerio
1239294   2836938628   Oryzias latipes
311570    2682391941   Arachis hypogaea
1936030   2636490116   Triticum aestivum
72        2590574434   Ovis canadensis canadensis
746555    2572291998   Solanum lycopersicum
99        2290216303   Bos mutus
205534    1836731087   Cyprinus carpio
1378922   1727115789   Oryza sativa Japonica Group
327068    1595510956   Apteryx australis mantelli
1646      1456386736   Bordetella pertussis
258150    1436247256   Strongylocentrotus purpuratus

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377
   219   Apr 2017   231824951552   200877884
   220   Jun 2017   234997362623   201663568
   221   Aug 2017   240343378258   203180606
   222   Oct 2017   244914705468   203953682
   223   Dec 2017   249722163594   206293625
   224   Feb 2018   253630708098   207040555
   225   Apr 2018   260189141631   208452303
   226   Jun 2018   263957884539   209775348
   227   Aug 2018   260806936411   208831050 (net decrease; see Section 1.3.1)
   
  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397
  219    Apr 2017  2035032639807   451840147
  220    Jun 2017  2164683993369   487891767
  221    Aug 2017  2242294609510   499965722
  222    Oct 2017  2318156361999   508825331
  223    Dec 2017  2466098053327   551063065
  224    Feb 2018  2608532210351   564286852
  225    Apr 2018  2784740996536   621379029
  226    Jun 2018  2944617324086   639804105
  227    Aug 2018  3204855013281   665309765

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485
  219    Apr 2017   149038907599   165068542
  220    Jun 2017   158112969073   176812130
  221    Aug 2017   167045663417   186777106
  222    Oct 2017   172909268535   192754804
  223    Dec 2017   181394660188   201559502
  224    Feb 2018   193940551226   214324264
  225    Apr 2018   205232396043   227364990
  226    Jun 2018   216556686631   238788334
  227    Aug 2018   225520004678   249295386

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for release prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349
  219    Apr 2017      636923295     1438349  (unchanged)
  220    Jun 2017      824191338     1628475
  221    Aug 2017      824191338     1628475  (unchanged)
  222    Oct 2017     2993818315     9479460
  223    Dec 2017     4458042616    12695198
  224    Feb 2018     4531966831    12819978
  225    Apr 2018     5612769448    14782654
  226    Jun 2018     5896511468    15393041
  227    Aug 2018     6077824493    15822538

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          August 15 2018

                NCBI-GenBank Flat File Release 227.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

  NOTE : Presentation of GI sequence identifiers in the GenBank
  flatfile format was discontinued as of March 2017.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67, and these same three-letter codes are used
in the names of the files that make up a GenBank release.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

Legal values for the division code include:

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1
            ^^^^^^^^^^
            Compound  
            Accession.Version
            Number

  A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.

  GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://www.ncbi.nlm.nih.gov/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://www.ncbi.nlm.nih.gov/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://www.ncbi.nlm.nih.gov/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://www.ncbi.nlm.nih.gov/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:

	http://www.insdc.org/documents/feature-table

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.2

3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

  The list of valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.3

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       KZ271580              141308 bp    DNA     linear   CON 17-AUG-2017
DEFINITION  Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
            O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION   KZ271580 LQNL01000000
VERSION     KZ271580.1
DBLINK      BioProject: PRJNA230512
            BioSample: SAMN04226856
KEYWORDS    WGS; HIGH_QUALITY_DRAFT.
...
     mRNA            complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /product="hypothetical protein"
     CDS             complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="OZC04795.1"
                     /db_xref="GI:1233056989"
                     /translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
                     SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
                     ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
                     TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
                     LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
                     HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
                     LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
                     IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
                     YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
                     AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
                     IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG      join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
            gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Scaffold/CON-division join() sequence


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.

  The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov .

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Benson DA, Cavanaugh M, Clark K, Karsch-Mizrachi I, Lipman DJ,
   Ostell J, Sayers EW
   GenBank. Nucleic Acids Res. 45(D1):D37-D42 (2017)

   DOI:   10.1093/nar/gkw1070
   PMID:  27899564
   PMCID: PMC5210553

  The following statement is an example of how one might cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'

  (1) Benson, D. et al, Nucleic Acids Res. 45(D1):D37-D42 (2017)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: Simply direct your web browser of choice to:

	 http://www.ncbi.nlm.nih.gov/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 218.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Larry Chlumsky, Karen Clark, Jianli Dai, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
	Sergiy Gotvyanskyy, Eugene Gribov, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh, Alex Kotliarov,
	Alexey Kuznetsov, Frank Ludwig, Anatoly Mnev, Jim Ostell, Vasuki Palanigobu,
	Anton Perkov, Andriy Petrow, Sergey Petrunin, Wenyao Shi, Denis Sinyakov,
	Thomas Smith, Vladimir Soussov, Elena Starchenko, Hanzhen Sun,
	Andrei Vereshchagin, Jewen Xiao, Eugene Yaschenko, Liwei Zhou

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

Customer Support
	Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
	Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	Jim Ostell : Director, NCBI
	Kim Pruitt : Acting Branch Chief, NCBI/IEB

Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
Support Center