U.S. flag

An official website of the United States government

NCBI Bookshelf. A service of the National Library of Medicine, National Institutes of Health.

BLAST® Command Line Applications User Manual [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2008-.

Cover of BLAST® Command Line Applications User Manual

BLAST® Command Line Applications User Manual [Internet].

Show details

Input formats to BLAST

.

Author Information

Created: ; Last Update: September 25, 2020.

Estimated reading time: 1 minute

Multiple sequence alignment

The -in_msa psiblast option provides a way to jump start psiblast from a master-slave multiple sequence alignment computed outside psiblast. The multiple sequence alignment must contain the query sequence as one of its sequences, but it need not be the first sequence. The multiple sequence alignment must be specified in a format that is derived from Clustal, but without some headers and trailers (see example below).

The rules are also described by the following words. Suppose the multiple sequence alignment has N sequences. It may be presented in one or more blocks, where each block presents a range of columns from the multiple sequence alignment. E.g., the first block might have columns 1-60, the second block might have columns 61-95, the third block might have columns 96-128. Each block should have N rows, one row per sequence. The sequences should be in the same order in every block. Blocks are separated by one or more black lines. Within a block there are no blank lines, and each line consists of one sequence identifier followed by some whitespace followed by characters (and gaps) for that sequence in the multiple sequence alignment. In each column, all letters must be in upper case, or all letters must be in lower case.

# Example multiple sequence alignment file
align1
------
26SPS9_Hs IHAAEEKDWKTAYSYFYEAFEGYdsidspkaitslkymllckimlntpedvqalvsgkla
F57B9_Ce LHAADEKDFKTAFSYFYEAFEGYdsvdekvsaltalkymllckvmldlpdevnsllsakl
YDL097c_Sc ILHCEDKDYKTAFSYFFESFESYhnltthnsyekacqvlkymllskimlnliddvkniln
YMJ5_Ce LYSAEERDYKTSFSYFYEAFEGFasigdkinatsalkymilckimlneteqlagllaake
FUS6_ARATH KNYIRTRDYCTTTKHIIHMCMNAilvsiemgqfthvtsyvnkaeqnpetlepmvnaklrc
COS41.8_Ci SLDYKLKTYLTIARLYLEDEDPVqaemyinrasllqnetadeqlqihykvcyarvldyrr
644879 KCYSRARDYCTSAKHVINMCLNVikvsvylqnwshvlsyvskaestpeiaeqrgerdsqt
YPR108w_Sc IHCLAVRNFKEAAKLLVDSLATFtsieltsyesiatyasvtglftlertdlkskvidspe
eif-3p110_Hs SKAMKMGDWKTCHSFIINEKMNGkvw----------------------------------
T23D8.4_Ce SKAMLNGDWKKCQDYIVNDKMNQkvw----------------------------------
YD95_Sp IYLMSIRNFSGAADLLLDCMSTFsstellpyydvvryavisgaisldrvdvktkivdspe
KIAA0107_Hs LYCVAIRDFKQAAELFLDTVSTFtsyelmdyktfvtytvyvsmialerpdlrekvikgae
F49C12.8_Hs LYRMSVRDFAGAADLFLEAVPTFgsyelmtyenlilytvitttfaldrpdlrtkvircne
Int-6_Mm KFQYECGNYSGAAEYLYFFRVLVpatdrnalsslwgklaseilmqnwdaamedltrlket

26SPS9_Hs lryagrqtealkcvaqasknrsladfekaltdy---------------------------
F57B9_Ce alkyngsdldamkaiaaaaqkrslkdfqvafgsf--------------------------
YDL097c_Sc akytketyqsrgidamkavaeaynnrslldfntalkqy----------------------
YMJ5_Ce ivayqkspriiairsmadafrkrslkdfvkalaeh-------------------------
FUS6_ARATH asglahlelkkyklaarkfldvnpelgnsyneviapqdiatygglcalasfdrselkqkv
COS41.8_Ci kfleaaqrynelsyksaiheteqtkalekalncailapagqqrsrmlatlfkdercqllp
644879 qailtklkcaaglaelaarkykqaakclllasfdhcdfpellspsnvaiygglcalatfd
YPR108w_Sc llslisttaalqsissltislyasdyasyfpyllety-----------------------
eif-3p110_Hs ------------------------------------------------------------
T23D8.4_Ce ------------------------------------------------------------
YD95_Sp vlavlpqnesmssleacinslylcdysgffrtladve-----------------------
KIAA0107_Hs ilevlhslpavrqylfslyecrysvffqslavv---------------------------
F49C12.8_Hs vqeqltggglngtlipvreylesyydchydrffiqlaale--------------------
Int-6_Mm idnnsvssplqslqqrtwlihwslfvffnhpkgrdniidlflyqpqylnaiqtmcphilr

26SPS9_Hs ------------------------------------------------------------
F57B9_Ce ------------------------------------------------------------
YDL097c_Sc ------------------------------------------------------------
YMJ5_Ce ------------------------------------------------------------
FUS6_ARATH idninfrnflelvpdvrelindfyssryascleylasl----------------------
COS41.8_Ci sfgilekmfldriiksdemeefar------------------------------------
644879 rqelqrnvissssfklflelepqvrdiifkfyeskyasclkmldem--------------
YPR108w_Sc ------------------------------------------------------------
eif-3p110_Hs ------------------------------------------------------------
T23D8.4_Ce ------------------------------------------------------------
YD95_Sp ------------------------------------------------------------
KIAA0107_Hs ------------------------------------------------------------
F49C12.8_Hs ------------------------------------------------------------
Int-6_Mm ylttavitnkdvrkrrqvlkdlvkviqqesytykdpitefveclyvnfdfdgaqkklrec

26SPS9_Hs RAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMI
F57B9_Ce PQELQMDPVVRKHFHSLSERMLEKDLCRIIEPYSFVQIEHVAQQIGIDRSKVEKKLSQMI
YDL097c_Sc EKELMGDELTRSHFNALYDTLLESNLCKIIEPFECVEISHISKIIGLDTQQVEGKLSQMI
YMJ5_Ce KIELVEDKVVAVHSQNLERNMLEKEISRVIEPYSEIELSYIARVIGMTVPPVERAIARMI
FUS6_ARATH KSNLLLDIHLHDHVDTLYDQIRKKALIQYTLPFVSVDLSRMADAFKTSVSGLEKELEALI
COS41.8_Ci QLMPHQKAITADGSNILHRAVTEHNLLSASKLYNNIRFTELGALLEIPHQMAEKVASQMI
644879 KDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSADMHRMAAAFNTTVAALEDELTQLI
YPR108w_Sc ANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFI
eif-3p110_Hs DLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMI
T23D8.4_Ce NLFHNAETVKGMVVRRIQEESLRTYLLTYSTVYATVSLKKLADLFELSKKDVHSIISKMI
YD95_Sp VNHLKCDQFLVAHYRYYVREMRRRAYAQLLESYRALSIDSMAASFGVSVDYIDRDLASFI
KIAA0107_Hs EQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFI
F49C12.8_Hs SERFKFDRYLSPHFNYYSRGMRHRAYEQFLTPYKTVRIDMMAKDFGVSRAFIDRELHRLI
Int-6_Mm ESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLI

26SPS9_Hs LDKKFHGILDQGEGVLIIFDEPP
F57B9_Ce LDQKLSGSLDQGEGMLIVFEIAV
YDL097c_Sc LDKIFYGVLDQGNGWLYVYETPN
YMJ5_Ce LDKKLMGSIDQHGDTVVVYPKAD
FUS6_ARATH TDNQIQARIDSHNKILYARHADQ
COS41.8_Ci CESRMKGHIDQIDGIVFFERRET
644879 LEGLISARVDSHSKILYARDVDQ
YPR108w_Sc PNKQLNCVIDRVNGIVETNRPDN
eif-3p110_Hs INEELMASLDQPTQTVVMHRTEP
T23D8.4_Ce IQEELSATLDEPTDCLIMHRVEP
YD95_Sp PDNKLNCVIDRVNGVVFTNRPDE
KIAA0107_Hs AAGRLHCKIDKVNEIVETNRPDS
F49C12.8_Hs ATGQLQCRIDAVNGVIEVNHRDS
Int-6_Mm RNARLDAKIDSKLGHVVMGNNAV
Copyright Notice

BLAST is a Registered Trademark of the National Library of Medicine

Bookshelf ID: NBK569842

Views

Other titles in this collection

Recent Activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...