2JR8: Solution structure of Manduca sexta moricin

Citation:
Abstract
In response to wounding or infection, insects produce a battery of antimicrobial peptides (AMPs) and other defense molecules to kill the invading pathogens. To study their structures, functions, and transcriptional regulation, we synthesized Manduca sexta moricin, a 42-residue peptide (GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH, 4539 Da). The compound exhibited potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentration of 1.4 microM. The mRNA levels of M. sexta moricin increased substantially in fat body and hemocytes after the larvae were challenged with bacterial cells. We determined the solution structure of this AMP by two-dimensional 1H-1H -nuclear magnetic resonance spectroscopy. The tertiary structure is composed of an eight-turn alpha-helix spanning almost the entire peptide. Insights of relationships between the structure and function are also presented.
PDB ID: 2JR8Download
MMDB ID: 63214
PDB Deposition Date: 2007/6/21
Updated in MMDB: 2009/07
Experimental Method:
solution nmr
Similar Structures:
Molecular Components in 2JR8
Label Count Molecule
Protein (1 molecule)
1
Antimicrobial Peptide Moricin
Molecule annotation
* Click molecule labels to explore molecular sequence information.

Citing MMDB
.