NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1370474207|ref|XP_024307083|]
View 

ATP-binding cassette sub-family A member 7 isoform X1 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
rim_protein super family cl31083
retinal-specific rim ABC transporter; This model describes the photoreceptor protein (rim ...
1-2114 0e+00

retinal-specific rim ABC transporter; This model describes the photoreceptor protein (rim protein) in eukaryotes. It is the member of ABC transporter superfamily. Rim protein is a membrane glycoprotein which is localized in the photoreceptor outer segment discs. Mutation/s in its genetic loci is implicated in the recessive Stargardt's disease. [Transport and binding proteins, Other]


The actual alignment was detected with superfamily member TIGR01257:

Pssm-ID: 130324 [Multi-domain]  Cd Length: 2272  Bit Score: 1996.43  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207    1 MAFWTQLMLLLWKNFMYRRRQPVQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLICNVNNT 80
Cdd:TIGR01257    1 MGFLRQIQLLLWKNWTLRKRQKIRFVVELVWPLSLFLVLIWLRNANPLYSQHECHFPNKAMPSAGMLPWLQGIFCNVNNP 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207   81 CFPQLTPGEEPGRLSNFNDSLVSRLLADARTVLGGA--SAH-----RTLAGLGKLIATLR------AAR----------- 136
Cdd:TIGR01257   81 CFQSPTPGESPGIVSNYNNSILARVYRDFQELLMDApeSQHlgqvwAELRTLSQFMDTLRthperiAGRgirirdilkde 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  137 -----------------------STAQPQPTKQSPLEPPMLDVA---ELLTSLL-----------RTESLGLALGQAQ-- 177
Cdd:TIGR01257  161 ealtlflmkniglsdsvvyllvnSQVRPEQFAYGVPDLELKDIAcseALLERFIifsqrrgaqtvRDALCSLSQGTLQwi 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  178 --------------EPLHSLLEAAE-------------DLA---QELLALRSLVEL----RALLQR--PRGTSGPLELLS 221
Cdd:TIGR01257  241 edtlyanvdffklfHVLPTLLDSRSqginlrswggilsDMSpriQEFIHRPSVQDLlwvtRPLLQNggPETFTQLMGILS 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  222 EALCSV-RGPSSTVGpSLNWYEASDLMELVGQEPESALP----DSSLSPACSELIGALDSHPLSRLLWRRLKPLILGKLL 296
Cdd:TIGR01257  321 DLLCGYpEGGGSRVF-SFNWYEDNNYKAFLGIDSTRKDPiysyDKRTTSFCNALIQSLESNPLTKIAWRAAKPLLMGKIL 399
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  297 FAPDTPFTRKLMAQVNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQ---MQDEGRRQPRPGGRDhMEAL 373
Cdd:TIGR01257  400 FTPDSPAARRILKNANSTFEELERVRKLVKAWEEVGPQIWYFFDKSTQMTMIRDTLQnptVKDFINRQLGEEGIT-AEAV 478
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  374 RSFLDPGS--------GGYSWQDAHADVGHLVGTLGRVTECLSLDKLEAAPSEAALVSRALQLLAEHRFWAGVVFlgped 445
Cdd:TIGR01257  479 LNFLYNGPrekqaddmTNFDWRDIFNITDRFLRLANQYLECLVLDKFESYDDEVQLTQRALSLLEENRFWAGVVF----- 553
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  446 ssdPTEHPTPDLGPGHVRIKIRMDIDVVTRTNKIRDRFWDPGPAADPLTDLRYVWGGFVYLQDLVERAAVRVLSGANPRA 525
Cdd:TIGR01257  554 ---PDMYPWTSSLPPHVKYKIRMDIDVVEKTNKIKDRYWDSGPRADPVEDFRYIWGGFAYLQDMVEQGITRSQMQAEPPV 630
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  526 GLYLQQMPYPCYVDDVFLRVLSRSLPLFLTLAWIYSVTLTVKAVVREKETRLRDTMRAMGLSRAVLWLGWFLSCLGPFLL 605
Cdd:TIGR01257  631 GIYLQQMPYPCFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKSIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMSM 710
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  606 SAALLVLVLKLGDILPYSHPGVVFLFLAAFAVATVTQSFLLSAFFSRANLAAACGGLAYFSLYLPYVLCVAWRDRLPAGG 685
Cdd:TIGR01257  711 SIFLLTIFIMHGRILHYSDPFILFLFLLAFSTATIMQCFLLSTFFSKASLAAACSGVIYFTLYLPHILCFAWQDRMTADL 790
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  686 RVAASLLSPVAFGFGCESLALLEEQGEGAQWHNVGTRPT-ADVFSLAQVSGLLLLDAALYGLATWYLEAVCPGQYGIPEP 764
Cdd:TIGR01257  791 KTAVSLLSPVAFGFGTEYLVRFEEQGLGLQWSNIGNSPLeGDEFSFLLSMKMMLLDAALYGLLAWYLDQVFPGDYGTPLP 870
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  765 WNFPFRRSYWCG--------PRPPKSPAPCPTPL-DPK-------VLVEEAPPGLSPGVSVRSLEKRFPGSPQPALRGLS 828
Cdd:TIGR01257  871 WYFLLQESYWLGgegcstreERALEKTEPLTEEMeDPEhpegindSFFERELPGLVPGVCVKNLVKIFEPSGRPAVDRLN 950
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  829 LDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYGRL 908
Cdd:TIGR01257  951 ITFYENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLVGGKDIETNLDAVRQSLGMCPQHNILFHHLTVAEHILFYAQL 1030
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  909 KGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELLLKYREG 988
Cdd:TIGR01257 1031 KGRSWEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDAKVVVLDEPTSGVDPYSRRSIWDLLLKYRSG 1110
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  989 RTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEK--------ADTDMEGSVDT 1060
Cdd:TIGR01257 1111 RTIIMSTHHMDEADLLGDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGgcegtcscTSKGFSTRCPA 1190
                         1210      1220      1230      1240      1250      1260      1270      1280
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1061 RQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLE 1140
Cdd:TIGR01257 1191 RVDEITPEQVLDGDVNELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLE 1270
                         1290      1300      1310      1320      1330      1340      1350      1360
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1141 EIFLKVVEECAADTDMEDGSCGQ-------HLCTGiagldVTLRLKMPPQETALEN-GEPA----GSAPETDQGSGPDAV 1208
Cdd:TIGR01257 1271 EIFLKVTEDADSGSLFAGGAQQKrenanlrHPCSG-----PTEKAGQTPQASHTCSpGQPAahpeGQPPPEPEDPGVPLN 1345
                         1370      1380      1390      1400      1410      1420      1430      1440
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1209 grvQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIVPPFGHYPALRLSPTMYGAQVSFFSEDAP 1288
Cdd:TIGR01257 1346 ---TGARLILQHVQALLVKRFQHTIRSHKDFLAQIVLPATFVFLALMLSIIIPPFGEYPALTLHPWMYGQQYTFFSMDEP 1422
                         1450      1460      1470      1480      1490      1500      1510      1520
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1289 GDPGRARLLEALLQEAG----------LEEPPVQHSShRFSAPEVPAEVAKVLASGNWTPESPSPACQCSRPGARRLLPD 1358
Cdd:TIGR01257 1423 NSEHLEVLADVLLNKPGfgnrclkeewLPEYPCGNST-PWKTPSVSPNITHLFQKQKWTAAHPSPSCRCSTREKLTMLPE 1501
                         1530      1540      1550      1560      1570      1580      1590      1600
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1359 CPAAAGGPPPPQAVTGSGEVVQNLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLP-SGQELGRSVE 1437
Cdd:TIGR01257 1502 CPEGAGGLPPPQRTQRSTEILQDLTDRNISDFLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPAIPiTGEALVGFLS 1581
                         1610      1620      1630      1640      1650      1660      1670      1680
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1438 ELWALLSpLPGGALDR-VLKNLTAWAHSLDAQDSLKIWFNNKGWHSMVAFVNRASNAILRAHLPPGPARHAHSITTLNHP 1516
Cdd:TIGR01257 1582 DLGQMMN-VSGGPVTReASKEMPDFLKHLETEDNIKVWFNNKGWHALVSFLNVAHNAILRASLPKDRDPEEYGITVISQP 1660
                         1690      1700      1710      1720      1730      1740      1750      1760
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1517 LNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEERVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPAC 1596
Cdd:TIGR01257 1661 LNLTKEQLSEITVLTTSVDAVVAICVIFAMSFVPASFVLYLIQERVNKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAG 1740
                         1770      1780      1790      1800      1810      1820      1830      1840
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1597 IVVLIFLAFQQRAYVAPANLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLELFSDQK 1676
Cdd:TIGR01257 1741 LVVGIFIGFQKKAYTSPENLPALVALLMLYGWAVIPMMYPASFLFDVPSTAYVALSCANLFIGINSSAITFVLELFENNR 1820
                         1850      1860      1870      1880      1890      1900      1910      1920
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1677 -LQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLGDRQFQSPLRWEVVGKNLLAMVIQGPLFLLFTLLLQHRS 1755
Cdd:TIGR01257 1821 tLLRFNAMLRKLLIVFPHFCLGRGLIDLALSQAVTDVYAQFGEEHSANPFQWDLIGKNLVAMAVEGVVYFLLTLLIQHHF 1900
                         1930      1940      1950      1960      1970      1980      1990      2000
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1756 QLLPQYSVPRPRvrslPLLgEEDEDVARERERVVQGATQGDVLVLRNLTKVYRGQRMPAVDRLCLGIPPGECFGLLGVNG 1835
Cdd:TIGR01257 1901 FLSRWIAEPAKE----PIF-DEDDDVAEERQRIISGGNKTDILRLNELTKVYSGTSSPAVDRLCVGVRPGECFGLLGVNG 1975
                         2010      2020      2030      2040      2050      2060      2070      2080
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1836 AGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGL 1915
Cdd:TIGR01257 1976 AGKTTTFKMLTGDTTVTSGDATVAGKSILTNISDVHQNMGYCPQFDAIDDLLTGREHLYLYARLRGVPAEEIEKVANWSI 2055
                         2090      2100      2110      2120      2130      2140      2150      2160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1916 ARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEA 1995
Cdd:TIGR01257 2056 QSLGLSLYADRLAGTYSGGNKRKLSTAIALIGCPPLVLLDEPTTGMDPQARRMLWNTIVSIIREGRAVVLTSHSMEECEA 2135
                         2170      2180      2190      2200      2210      2220      2230      2240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1996 LCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVPAARSQ------PAAAFVAAEFPGAELREAHGGRLRFQLPPGgr 2069
Cdd:TIGR01257 2136 LCTRLAIMVKGAFQCLGTIQHLKSKFGDGYIVTMKIKSPKDDllpdlnPVEQFFQGNFPGSVQRERHYNMLQFQVSSS-- 2213
                         2250      2260      2270      2280
                   ....*....|....*....|....*....|....*....|....*
gi 1370474207 2070 cALARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYFSKDQGKDED 2114
Cdd:TIGR01257 2214 -SLARIFQLLISHKDSLLIEEYSVTQTTLDQVFVNFAKQQTETYD 2257
 
Name Accession Description Interval E-value
rim_protein TIGR01257
retinal-specific rim ABC transporter; This model describes the photoreceptor protein (rim ...
1-2114 0e+00

retinal-specific rim ABC transporter; This model describes the photoreceptor protein (rim protein) in eukaryotes. It is the member of ABC transporter superfamily. Rim protein is a membrane glycoprotein which is localized in the photoreceptor outer segment discs. Mutation/s in its genetic loci is implicated in the recessive Stargardt's disease. [Transport and binding proteins, Other]


Pssm-ID: 130324 [Multi-domain]  Cd Length: 2272  Bit Score: 1996.43  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207    1 MAFWTQLMLLLWKNFMYRRRQPVQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLICNVNNT 80
Cdd:TIGR01257    1 MGFLRQIQLLLWKNWTLRKRQKIRFVVELVWPLSLFLVLIWLRNANPLYSQHECHFPNKAMPSAGMLPWLQGIFCNVNNP 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207   81 CFPQLTPGEEPGRLSNFNDSLVSRLLADARTVLGGA--SAH-----RTLAGLGKLIATLR------AAR----------- 136
Cdd:TIGR01257   81 CFQSPTPGESPGIVSNYNNSILARVYRDFQELLMDApeSQHlgqvwAELRTLSQFMDTLRthperiAGRgirirdilkde 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  137 -----------------------STAQPQPTKQSPLEPPMLDVA---ELLTSLL-----------RTESLGLALGQAQ-- 177
Cdd:TIGR01257  161 ealtlflmkniglsdsvvyllvnSQVRPEQFAYGVPDLELKDIAcseALLERFIifsqrrgaqtvRDALCSLSQGTLQwi 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  178 --------------EPLHSLLEAAE-------------DLA---QELLALRSLVEL----RALLQR--PRGTSGPLELLS 221
Cdd:TIGR01257  241 edtlyanvdffklfHVLPTLLDSRSqginlrswggilsDMSpriQEFIHRPSVQDLlwvtRPLLQNggPETFTQLMGILS 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  222 EALCSV-RGPSSTVGpSLNWYEASDLMELVGQEPESALP----DSSLSPACSELIGALDSHPLSRLLWRRLKPLILGKLL 296
Cdd:TIGR01257  321 DLLCGYpEGGGSRVF-SFNWYEDNNYKAFLGIDSTRKDPiysyDKRTTSFCNALIQSLESNPLTKIAWRAAKPLLMGKIL 399
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  297 FAPDTPFTRKLMAQVNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQ---MQDEGRRQPRPGGRDhMEAL 373
Cdd:TIGR01257  400 FTPDSPAARRILKNANSTFEELERVRKLVKAWEEVGPQIWYFFDKSTQMTMIRDTLQnptVKDFINRQLGEEGIT-AEAV 478
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  374 RSFLDPGS--------GGYSWQDAHADVGHLVGTLGRVTECLSLDKLEAAPSEAALVSRALQLLAEHRFWAGVVFlgped 445
Cdd:TIGR01257  479 LNFLYNGPrekqaddmTNFDWRDIFNITDRFLRLANQYLECLVLDKFESYDDEVQLTQRALSLLEENRFWAGVVF----- 553
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  446 ssdPTEHPTPDLGPGHVRIKIRMDIDVVTRTNKIRDRFWDPGPAADPLTDLRYVWGGFVYLQDLVERAAVRVLSGANPRA 525
Cdd:TIGR01257  554 ---PDMYPWTSSLPPHVKYKIRMDIDVVEKTNKIKDRYWDSGPRADPVEDFRYIWGGFAYLQDMVEQGITRSQMQAEPPV 630
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  526 GLYLQQMPYPCYVDDVFLRVLSRSLPLFLTLAWIYSVTLTVKAVVREKETRLRDTMRAMGLSRAVLWLGWFLSCLGPFLL 605
Cdd:TIGR01257  631 GIYLQQMPYPCFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKSIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMSM 710
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  606 SAALLVLVLKLGDILPYSHPGVVFLFLAAFAVATVTQSFLLSAFFSRANLAAACGGLAYFSLYLPYVLCVAWRDRLPAGG 685
Cdd:TIGR01257  711 SIFLLTIFIMHGRILHYSDPFILFLFLLAFSTATIMQCFLLSTFFSKASLAAACSGVIYFTLYLPHILCFAWQDRMTADL 790
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  686 RVAASLLSPVAFGFGCESLALLEEQGEGAQWHNVGTRPT-ADVFSLAQVSGLLLLDAALYGLATWYLEAVCPGQYGIPEP 764
Cdd:TIGR01257  791 KTAVSLLSPVAFGFGTEYLVRFEEQGLGLQWSNIGNSPLeGDEFSFLLSMKMMLLDAALYGLLAWYLDQVFPGDYGTPLP 870
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  765 WNFPFRRSYWCG--------PRPPKSPAPCPTPL-DPK-------VLVEEAPPGLSPGVSVRSLEKRFPGSPQPALRGLS 828
Cdd:TIGR01257  871 WYFLLQESYWLGgegcstreERALEKTEPLTEEMeDPEhpegindSFFERELPGLVPGVCVKNLVKIFEPSGRPAVDRLN 950
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  829 LDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYGRL 908
Cdd:TIGR01257  951 ITFYENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLVGGKDIETNLDAVRQSLGMCPQHNILFHHLTVAEHILFYAQL 1030
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  909 KGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELLLKYREG 988
Cdd:TIGR01257 1031 KGRSWEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDAKVVVLDEPTSGVDPYSRRSIWDLLLKYRSG 1110
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  989 RTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEK--------ADTDMEGSVDT 1060
Cdd:TIGR01257 1111 RTIIMSTHHMDEADLLGDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGgcegtcscTSKGFSTRCPA 1190
                         1210      1220      1230      1240      1250      1260      1270      1280
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1061 RQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLE 1140
Cdd:TIGR01257 1191 RVDEITPEQVLDGDVNELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLE 1270
                         1290      1300      1310      1320      1330      1340      1350      1360
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1141 EIFLKVVEECAADTDMEDGSCGQ-------HLCTGiagldVTLRLKMPPQETALEN-GEPA----GSAPETDQGSGPDAV 1208
Cdd:TIGR01257 1271 EIFLKVTEDADSGSLFAGGAQQKrenanlrHPCSG-----PTEKAGQTPQASHTCSpGQPAahpeGQPPPEPEDPGVPLN 1345
                         1370      1380      1390      1400      1410      1420      1430      1440
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1209 grvQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIVPPFGHYPALRLSPTMYGAQVSFFSEDAP 1288
Cdd:TIGR01257 1346 ---TGARLILQHVQALLVKRFQHTIRSHKDFLAQIVLPATFVFLALMLSIIIPPFGEYPALTLHPWMYGQQYTFFSMDEP 1422
                         1450      1460      1470      1480      1490      1500      1510      1520
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1289 GDPGRARLLEALLQEAG----------LEEPPVQHSShRFSAPEVPAEVAKVLASGNWTPESPSPACQCSRPGARRLLPD 1358
Cdd:TIGR01257 1423 NSEHLEVLADVLLNKPGfgnrclkeewLPEYPCGNST-PWKTPSVSPNITHLFQKQKWTAAHPSPSCRCSTREKLTMLPE 1501
                         1530      1540      1550      1560      1570      1580      1590      1600
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1359 CPAAAGGPPPPQAVTGSGEVVQNLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLP-SGQELGRSVE 1437
Cdd:TIGR01257 1502 CPEGAGGLPPPQRTQRSTEILQDLTDRNISDFLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPAIPiTGEALVGFLS 1581
                         1610      1620      1630      1640      1650      1660      1670      1680
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1438 ELWALLSpLPGGALDR-VLKNLTAWAHSLDAQDSLKIWFNNKGWHSMVAFVNRASNAILRAHLPPGPARHAHSITTLNHP 1516
Cdd:TIGR01257 1582 DLGQMMN-VSGGPVTReASKEMPDFLKHLETEDNIKVWFNNKGWHALVSFLNVAHNAILRASLPKDRDPEEYGITVISQP 1660
                         1690      1700      1710      1720      1730      1740      1750      1760
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1517 LNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEERVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPAC 1596
Cdd:TIGR01257 1661 LNLTKEQLSEITVLTTSVDAVVAICVIFAMSFVPASFVLYLIQERVNKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAG 1740
                         1770      1780      1790      1800      1810      1820      1830      1840
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1597 IVVLIFLAFQQRAYVAPANLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLELFSDQK 1676
Cdd:TIGR01257 1741 LVVGIFIGFQKKAYTSPENLPALVALLMLYGWAVIPMMYPASFLFDVPSTAYVALSCANLFIGINSSAITFVLELFENNR 1820
                         1850      1860      1870      1880      1890      1900      1910      1920
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1677 -LQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLGDRQFQSPLRWEVVGKNLLAMVIQGPLFLLFTLLLQHRS 1755
Cdd:TIGR01257 1821 tLLRFNAMLRKLLIVFPHFCLGRGLIDLALSQAVTDVYAQFGEEHSANPFQWDLIGKNLVAMAVEGVVYFLLTLLIQHHF 1900
                         1930      1940      1950      1960      1970      1980      1990      2000
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1756 QLLPQYSVPRPRvrslPLLgEEDEDVARERERVVQGATQGDVLVLRNLTKVYRGQRMPAVDRLCLGIPPGECFGLLGVNG 1835
Cdd:TIGR01257 1901 FLSRWIAEPAKE----PIF-DEDDDVAEERQRIISGGNKTDILRLNELTKVYSGTSSPAVDRLCVGVRPGECFGLLGVNG 1975
                         2010      2020      2030      2040      2050      2060      2070      2080
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1836 AGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGL 1915
Cdd:TIGR01257 1976 AGKTTTFKMLTGDTTVTSGDATVAGKSILTNISDVHQNMGYCPQFDAIDDLLTGREHLYLYARLRGVPAEEIEKVANWSI 2055
                         2090      2100      2110      2120      2130      2140      2150      2160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1916 ARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEA 1995
Cdd:TIGR01257 2056 QSLGLSLYADRLAGTYSGGNKRKLSTAIALIGCPPLVLLDEPTTGMDPQARRMLWNTIVSIIREGRAVVLTSHSMEECEA 2135
                         2170      2180      2190      2200      2210      2220      2230      2240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1996 LCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVPAARSQ------PAAAFVAAEFPGAELREAHGGRLRFQLPPGgr 2069
Cdd:TIGR01257 2136 LCTRLAIMVKGAFQCLGTIQHLKSKFGDGYIVTMKIKSPKDDllpdlnPVEQFFQGNFPGSVQRERHYNMLQFQVSSS-- 2213
                         2250      2260      2270      2280
                   ....*....|....*....|....*....|....*....|....*
gi 1370474207 2070 cALARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYFSKDQGKDED 2114
Cdd:TIGR01257 2214 -SLARIFQLLISHKDSLLIEEYSVTQTTLDQVFVNFAKQQTETYD 2257
ABC_subfamily_A cd03263
ATP-binding cassette domain of the lipid transporters, subfamily A; The ABCA subfamily ...
1798-2018 2.57e-107

ATP-binding cassette domain of the lipid transporters, subfamily A; The ABCA subfamily mediates the transport of a variety of lipid compounds. Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.


Pssm-ID: 213230 [Multi-domain]  Cd Length: 220  Bit Score: 341.41  E-value: 2.57e-107
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1798 LVLRNLTKVYRGQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYC 1877
Cdd:cd03263      1 LQIRNLTKTYKKGTKPAVDDLSLNVYKGEIFGLLGHNGAGKTTTLKMLTGELRPTSGTAYINGYSIRTDRKAARQSLGYC 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1878 PQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEP 1957
Cdd:cd03263     81 PQFDALFDELTVREHLRFYARLKGLPKSEIKEEVELLLRVLGLTDKANKRARTLSGGMKRKLSLAIALIGGPSVLLLDEP 160
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1370474207 1958 TTGMDPSARRFLWNSLLAvVREGRSVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHLK 2018
Cdd:cd03263    161 TSGLDPASRRAIWDLILE-VRKGRSIILTTHSMDEAEALCDRIAIMSDGKLRCIGSPQELK 220
CcmA COG1131
ABC-type multidrug transport system, ATPase component [Defense mechanisms];
807-1045 7.85e-75

ABC-type multidrug transport system, ATPase component [Defense mechanisms];


Pssm-ID: 224054 [Multi-domain]  Cd Length: 293  Bit Score: 251.07  E-value: 7.85e-75
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  807 VSVRSLEKRFpGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVC 886
Cdd:COG1131      5 IEVRNLTKKY-GGDKTALDGVSFEVEPGEIFGLLGPNGAGKTTLLKILAGLLKPTSGEILVLGYDVVKEPAKVRRRIGYV 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  887 PQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEP 966
Cdd:COG1131     84 PQEPSLYPELTVRENLEFFARLYGLSKEEAEERIEELLELFGLEDKANKKVRTLSGGMKQRLSIALALLHDPELLILDEP 163
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  967 TAGVDPASRRGIWELLLKYRE--GRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPL 1044
Cdd:COG1131    164 TSGLDPESRREIWELLRELAKegGVTILLSTHILEEAEELCDRVIILNDGKIIAEGTPEELKEKFGGKGVIELEPERLEL 243

                   .
gi 1370474207 1045 T 1045
Cdd:COG1131    244 A 244
PRK13537 PRK13537
nodulation ABC transporter NodI; Provisional
1797-2017 2.63e-44

nodulation ABC transporter NodI; Provisional


Pssm-ID: 237420 [Multi-domain]  Cd Length: 306  Bit Score: 163.82  E-value: 2.63e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1797 VLVLRNLTKVYrGQRMpAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGY 1876
Cdd:PRK13537     7 PIDFRNVEKRY-GDKL-VVDGLSFHVQRGECFGLLGPNGAGKTTTLRMLLGLTHPDAGSISLCGEPVPSRARHARQRVGV 84
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1877 CPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDE 1956
Cdd:PRK13537    85 VPQFDNLDPDFTVRENLLVFGRYFGLSAAAARALVPPLLEFAKLENKADAKVGELSGGMKRRLTLARALVNDPDVLVLDE 164
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1370474207 1957 PTTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHL 2017
Cdd:PRK13537   165 PTTGLDPQARHLMWERLRSLLARGKTILLTTHFMEEAERLCDRLCVIEEGRKIAEGAPHAL 225
ABC_tran pfam00005
ABC transporter; ABC transporters for a large family of proteins responsible for translocation ...
824-968 5.36e-39

ABC transporter; ABC transporters for a large family of proteins responsible for translocation of a variety of compounds across biological membranes. ABC transporters are the largest family of proteins in many completely sequenced bacteria. ABC transporters are composed of two copies of this domain and two copies of a transmembrane domain pfam00664. These four domains may belong to a single polypeptide as in CFTR, or belong in different polypeptide chains.


Pssm-ID: 333758 [Multi-domain]  Cd Length: 150  Bit Score: 142.78  E-value: 5.36e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  824 LRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRS-SMAAIRPHLGVCPQYNVLFDMLTVDEHV 902
Cdd:pfam00005    1 LKNVSLTLNPGEIVALVGPNGAGKSTLLKLISGLLSPTEGTILLDGQDLTDdERKSLRKEIGYVFQDPQLFPRLTVRENL 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  903 WFYGRLKGLSAAVVGPEQDRLLQDVGLV----SKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTA 968
Cdd:pfam00005   81 RLGLRLKGLSKAEKDARAEEALEKLGLGdlldRPVGENPGTLSGGQRQRVAIARALLTKPKLLLLDEPTA 150
AAA smart00382
ATPases associated with a variety of cellular activities; AAA - ATPases associated with a ...
833-1003 3.35e-05

ATPases associated with a variety of cellular activities; AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.


Pssm-ID: 214640 [Multi-domain]  Cd Length: 148  Bit Score: 45.83  E-value: 3.35e-05
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207   833 QGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFIlghdvrssmaairphlgvcpqynvlfdmltvdehvwfygrlkgls 912
Cdd:smart00382    1 PGEVILIVGPPGSGKTTLARALARELGPPGGGVIY--------------------------------------------- 35
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207   913 aaVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELL-------LKY 985
Cdd:smart00382   36 --IDGEDILEEVLDQLLLIIVGGKKASGSGELRLRLALALARKLKPDVLILDEITSLLDAEQEALLLLLEelrllllLKS 113
                           170       180
                    ....*....|....*....|.
gi 1370474207   986 REGRTLILSTHH---LDEAEL 1003
Cdd:smart00382  114 EKNLTVILTTNDekdLGPALL 134
 
Name Accession Description Interval E-value
rim_protein TIGR01257
retinal-specific rim ABC transporter; This model describes the photoreceptor protein (rim ...
1-2114 0e+00

retinal-specific rim ABC transporter; This model describes the photoreceptor protein (rim protein) in eukaryotes. It is the member of ABC transporter superfamily. Rim protein is a membrane glycoprotein which is localized in the photoreceptor outer segment discs. Mutation/s in its genetic loci is implicated in the recessive Stargardt's disease. [Transport and binding proteins, Other]


Pssm-ID: 130324 [Multi-domain]  Cd Length: 2272  Bit Score: 1996.43  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207    1 MAFWTQLMLLLWKNFMYRRRQPVQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLICNVNNT 80
Cdd:TIGR01257    1 MGFLRQIQLLLWKNWTLRKRQKIRFVVELVWPLSLFLVLIWLRNANPLYSQHECHFPNKAMPSAGMLPWLQGIFCNVNNP 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207   81 CFPQLTPGEEPGRLSNFNDSLVSRLLADARTVLGGA--SAH-----RTLAGLGKLIATLR------AAR----------- 136
Cdd:TIGR01257   81 CFQSPTPGESPGIVSNYNNSILARVYRDFQELLMDApeSQHlgqvwAELRTLSQFMDTLRthperiAGRgirirdilkde 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  137 -----------------------STAQPQPTKQSPLEPPMLDVA---ELLTSLL-----------RTESLGLALGQAQ-- 177
Cdd:TIGR01257  161 ealtlflmkniglsdsvvyllvnSQVRPEQFAYGVPDLELKDIAcseALLERFIifsqrrgaqtvRDALCSLSQGTLQwi 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  178 --------------EPLHSLLEAAE-------------DLA---QELLALRSLVEL----RALLQR--PRGTSGPLELLS 221
Cdd:TIGR01257  241 edtlyanvdffklfHVLPTLLDSRSqginlrswggilsDMSpriQEFIHRPSVQDLlwvtRPLLQNggPETFTQLMGILS 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  222 EALCSV-RGPSSTVGpSLNWYEASDLMELVGQEPESALP----DSSLSPACSELIGALDSHPLSRLLWRRLKPLILGKLL 296
Cdd:TIGR01257  321 DLLCGYpEGGGSRVF-SFNWYEDNNYKAFLGIDSTRKDPiysyDKRTTSFCNALIQSLESNPLTKIAWRAAKPLLMGKIL 399
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  297 FAPDTPFTRKLMAQVNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQ---MQDEGRRQPRPGGRDhMEAL 373
Cdd:TIGR01257  400 FTPDSPAARRILKNANSTFEELERVRKLVKAWEEVGPQIWYFFDKSTQMTMIRDTLQnptVKDFINRQLGEEGIT-AEAV 478
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  374 RSFLDPGS--------GGYSWQDAHADVGHLVGTLGRVTECLSLDKLEAAPSEAALVSRALQLLAEHRFWAGVVFlgped 445
Cdd:TIGR01257  479 LNFLYNGPrekqaddmTNFDWRDIFNITDRFLRLANQYLECLVLDKFESYDDEVQLTQRALSLLEENRFWAGVVF----- 553
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  446 ssdPTEHPTPDLGPGHVRIKIRMDIDVVTRTNKIRDRFWDPGPAADPLTDLRYVWGGFVYLQDLVERAAVRVLSGANPRA 525
Cdd:TIGR01257  554 ---PDMYPWTSSLPPHVKYKIRMDIDVVEKTNKIKDRYWDSGPRADPVEDFRYIWGGFAYLQDMVEQGITRSQMQAEPPV 630
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  526 GLYLQQMPYPCYVDDVFLRVLSRSLPLFLTLAWIYSVTLTVKAVVREKETRLRDTMRAMGLSRAVLWLGWFLSCLGPFLL 605
Cdd:TIGR01257  631 GIYLQQMPYPCFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKSIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMSM 710
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  606 SAALLVLVLKLGDILPYSHPGVVFLFLAAFAVATVTQSFLLSAFFSRANLAAACGGLAYFSLYLPYVLCVAWRDRLPAGG 685
Cdd:TIGR01257  711 SIFLLTIFIMHGRILHYSDPFILFLFLLAFSTATIMQCFLLSTFFSKASLAAACSGVIYFTLYLPHILCFAWQDRMTADL 790
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  686 RVAASLLSPVAFGFGCESLALLEEQGEGAQWHNVGTRPT-ADVFSLAQVSGLLLLDAALYGLATWYLEAVCPGQYGIPEP 764
Cdd:TIGR01257  791 KTAVSLLSPVAFGFGTEYLVRFEEQGLGLQWSNIGNSPLeGDEFSFLLSMKMMLLDAALYGLLAWYLDQVFPGDYGTPLP 870
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  765 WNFPFRRSYWCG--------PRPPKSPAPCPTPL-DPK-------VLVEEAPPGLSPGVSVRSLEKRFPGSPQPALRGLS 828
Cdd:TIGR01257  871 WYFLLQESYWLGgegcstreERALEKTEPLTEEMeDPEhpegindSFFERELPGLVPGVCVKNLVKIFEPSGRPAVDRLN 950
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  829 LDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYGRL 908
Cdd:TIGR01257  951 ITFYENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLVGGKDIETNLDAVRQSLGMCPQHNILFHHLTVAEHILFYAQL 1030
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  909 KGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELLLKYREG 988
Cdd:TIGR01257 1031 KGRSWEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDAKVVVLDEPTSGVDPYSRRSIWDLLLKYRSG 1110
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  989 RTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEK--------ADTDMEGSVDT 1060
Cdd:TIGR01257 1111 RTIIMSTHHMDEADLLGDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGgcegtcscTSKGFSTRCPA 1190
                         1210      1220      1230      1240      1250      1260      1270      1280
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1061 RQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLE 1140
Cdd:TIGR01257 1191 RVDEITPEQVLDGDVNELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLE 1270
                         1290      1300      1310      1320      1330      1340      1350      1360
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1141 EIFLKVVEECAADTDMEDGSCGQ-------HLCTGiagldVTLRLKMPPQETALEN-GEPA----GSAPETDQGSGPDAV 1208
Cdd:TIGR01257 1271 EIFLKVTEDADSGSLFAGGAQQKrenanlrHPCSG-----PTEKAGQTPQASHTCSpGQPAahpeGQPPPEPEDPGVPLN 1345
                         1370      1380      1390      1400      1410      1420      1430      1440
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1209 grvQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIVPPFGHYPALRLSPTMYGAQVSFFSEDAP 1288
Cdd:TIGR01257 1346 ---TGARLILQHVQALLVKRFQHTIRSHKDFLAQIVLPATFVFLALMLSIIIPPFGEYPALTLHPWMYGQQYTFFSMDEP 1422
                         1450      1460      1470      1480      1490      1500      1510      1520
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1289 GDPGRARLLEALLQEAG----------LEEPPVQHSShRFSAPEVPAEVAKVLASGNWTPESPSPACQCSRPGARRLLPD 1358
Cdd:TIGR01257 1423 NSEHLEVLADVLLNKPGfgnrclkeewLPEYPCGNST-PWKTPSVSPNITHLFQKQKWTAAHPSPSCRCSTREKLTMLPE 1501
                         1530      1540      1550      1560      1570      1580      1590      1600
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1359 CPAAAGGPPPPQAVTGSGEVVQNLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLP-SGQELGRSVE 1437
Cdd:TIGR01257 1502 CPEGAGGLPPPQRTQRSTEILQDLTDRNISDFLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPAIPiTGEALVGFLS 1581
                         1610      1620      1630      1640      1650      1660      1670      1680
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1438 ELWALLSpLPGGALDR-VLKNLTAWAHSLDAQDSLKIWFNNKGWHSMVAFVNRASNAILRAHLPPGPARHAHSITTLNHP 1516
Cdd:TIGR01257 1582 DLGQMMN-VSGGPVTReASKEMPDFLKHLETEDNIKVWFNNKGWHALVSFLNVAHNAILRASLPKDRDPEEYGITVISQP 1660
                         1690      1700      1710      1720      1730      1740      1750      1760
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1517 LNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEERVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPAC 1596
Cdd:TIGR01257 1661 LNLTKEQLSEITVLTTSVDAVVAICVIFAMSFVPASFVLYLIQERVNKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAG 1740
                         1770      1780      1790      1800      1810      1820      1830      1840
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1597 IVVLIFLAFQQRAYVAPANLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLELFSDQK 1676
Cdd:TIGR01257 1741 LVVGIFIGFQKKAYTSPENLPALVALLMLYGWAVIPMMYPASFLFDVPSTAYVALSCANLFIGINSSAITFVLELFENNR 1820
                         1850      1860      1870      1880      1890      1900      1910      1920
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1677 -LQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLGDRQFQSPLRWEVVGKNLLAMVIQGPLFLLFTLLLQHRS 1755
Cdd:TIGR01257 1821 tLLRFNAMLRKLLIVFPHFCLGRGLIDLALSQAVTDVYAQFGEEHSANPFQWDLIGKNLVAMAVEGVVYFLLTLLIQHHF 1900
                         1930      1940      1950      1960      1970      1980      1990      2000
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1756 QLLPQYSVPRPRvrslPLLgEEDEDVARERERVVQGATQGDVLVLRNLTKVYRGQRMPAVDRLCLGIPPGECFGLLGVNG 1835
Cdd:TIGR01257 1901 FLSRWIAEPAKE----PIF-DEDDDVAEERQRIISGGNKTDILRLNELTKVYSGTSSPAVDRLCVGVRPGECFGLLGVNG 1975
                         2010      2020      2030      2040      2050      2060      2070      2080
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1836 AGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGL 1915
Cdd:TIGR01257 1976 AGKTTTFKMLTGDTTVTSGDATVAGKSILTNISDVHQNMGYCPQFDAIDDLLTGREHLYLYARLRGVPAEEIEKVANWSI 2055
                         2090      2100      2110      2120      2130      2140      2150      2160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1916 ARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEA 1995
Cdd:TIGR01257 2056 QSLGLSLYADRLAGTYSGGNKRKLSTAIALIGCPPLVLLDEPTTGMDPQARRMLWNTIVSIIREGRAVVLTSHSMEECEA 2135
                         2170      2180      2190      2200      2210      2220      2230      2240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1996 LCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVPAARSQ------PAAAFVAAEFPGAELREAHGGRLRFQLPPGgr 2069
Cdd:TIGR01257 2136 LCTRLAIMVKGAFQCLGTIQHLKSKFGDGYIVTMKIKSPKDDllpdlnPVEQFFQGNFPGSVQRERHYNMLQFQVSSS-- 2213
                         2250      2260      2270      2280
                   ....*....|....*....|....*....|....*....|....*
gi 1370474207 2070 cALARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYFSKDQGKDED 2114
Cdd:TIGR01257 2214 -SLARIFQLLISHKDSLLIEEYSVTQTTLDQVFVNFAKQQTETYD 2257
ABC_subfamily_A cd03263
ATP-binding cassette domain of the lipid transporters, subfamily A; The ABCA subfamily ...
1798-2018 2.57e-107

ATP-binding cassette domain of the lipid transporters, subfamily A; The ABCA subfamily mediates the transport of a variety of lipid compounds. Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.


Pssm-ID: 213230 [Multi-domain]  Cd Length: 220  Bit Score: 341.41  E-value: 2.57e-107
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1798 LVLRNLTKVYRGQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYC 1877
Cdd:cd03263      1 LQIRNLTKTYKKGTKPAVDDLSLNVYKGEIFGLLGHNGAGKTTTLKMLTGELRPTSGTAYINGYSIRTDRKAARQSLGYC 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1878 PQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEP 1957
Cdd:cd03263     81 PQFDALFDELTVREHLRFYARLKGLPKSEIKEEVELLLRVLGLTDKANKRARTLSGGMKRKLSLAIALIGGPSVLLLDEP 160
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1370474207 1958 TTGMDPSARRFLWNSLLAvVREGRSVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHLK 2018
Cdd:cd03263    161 TSGLDPASRRAIWDLILE-VRKGRSIILTTHSMDEAEALCDRIAIMSDGKLRCIGSPQELK 220
ABC_subfamily_A cd03263
ATP-binding cassette domain of the lipid transporters, subfamily A; The ABCA subfamily ...
807-1026 1.78e-104

ATP-binding cassette domain of the lipid transporters, subfamily A; The ABCA subfamily mediates the transport of a variety of lipid compounds. Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.


Pssm-ID: 213230 [Multi-domain]  Cd Length: 220  Bit Score: 333.32  E-value: 1.78e-104
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  807 VSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVC 886
Cdd:cd03263      1 LQIRNLTKTYKKGTKPAVDDLSLNVYKGEIFGLLGHNGAGKTTTLKMLTGELRPTSGTAYINGYSIRTDRKAARQSLGYC 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  887 PQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEP 966
Cdd:cd03263     81 PQFDALFDELTVREHLRFYARLKGLPKSEIKEEVELLLRVLGLTDKANKRARTLSGGMKRKLSLAIALIGGPSVLLLDEP 160
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  967 TAGVDPASRRGIWELLLKYREGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLR 1026
Cdd:cd03263    161 TSGLDPASRRAIWDLILEVRKGRSIILTTHSMDEAEALCDRIAIMSDGKLRCIGSPQELK 220
CcmA COG1131
ABC-type multidrug transport system, ATPase component [Defense mechanisms];
807-1045 7.85e-75

ABC-type multidrug transport system, ATPase component [Defense mechanisms];


Pssm-ID: 224054 [Multi-domain]  Cd Length: 293  Bit Score: 251.07  E-value: 7.85e-75
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  807 VSVRSLEKRFpGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVC 886
Cdd:COG1131      5 IEVRNLTKKY-GGDKTALDGVSFEVEPGEIFGLLGPNGAGKTTLLKILAGLLKPTSGEILVLGYDVVKEPAKVRRRIGYV 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  887 PQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEP 966
Cdd:COG1131     84 PQEPSLYPELTVRENLEFFARLYGLSKEEAEERIEELLELFGLEDKANKKVRTLSGGMKQRLSIALALLHDPELLILDEP 163
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  967 TAGVDPASRRGIWELLLKYRE--GRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPL 1044
Cdd:COG1131    164 TSGLDPESRREIWELLRELAKegGVTILLSTHILEEAEELCDRVIILNDGKIIAEGTPEELKEKFGGKGVIELEPERLEL 243

                   .
gi 1370474207 1045 T 1045
Cdd:COG1131    244 A 244
CcmA COG1131
ABC-type multidrug transport system, ATPase component [Defense mechanisms];
1797-2104 7.25e-71

ABC-type multidrug transport system, ATPase component [Defense mechanisms];


Pssm-ID: 224054 [Multi-domain]  Cd Length: 293  Bit Score: 239.90  E-value: 7.25e-71
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1797 VLVLRNLTKVYRGQRmPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGY 1876
Cdd:COG1131      4 VIEVRNLTKKYGGDK-TALDGVSFEVEPGEIFGLLGPNGAGKTTLLKILAGLLKPTSGEILVLGYDVVKEPAKVRRRIGY 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1877 CPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDE 1956
Cdd:COG1131     83 VPQEPSLYPELTVRENLEFFARLYGLSKEEAEERIEELLELFGLEDKANKKVRTLSGGMKQRLSIALALLHDPELLILDE 162
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1957 PTTGMDPSARRFLWNSLLAVVREG-RSVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVPAAR 2035
Cdd:COG1131    163 PTSGLDPESRREIWELLRELAKEGgVTILLSTHILEEAEELCDRVIILNDGKIIAEGTPEELKEKFGGKGVIELEPERLE 242
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1370474207 2036 SQPAAAFVAAEFPGAELREAhggrlrfqlppggrcalarvfgELAVHGAEHGVEDFSVSQTMLEEVFLY 2104
Cdd:COG1131    243 LAELLEGLKLVKGEEELAEI----------------------LEALLEEGVKIESIEVKEPSLEDVFLE 289
drrA TIGR01188
daunorubicin resistance ABC transporter ATP-binding subunit; This model describes daunorubicin ...
1805-2105 1.67e-66

daunorubicin resistance ABC transporter ATP-binding subunit; This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc. [Transport and binding proteins, Other]


Pssm-ID: 130256 [Multi-domain]  Cd Length: 302  Bit Score: 227.66  E-value: 1.67e-66
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1805 KVYRGqrMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYCPQSDAIF 1884
Cdd:TIGR01188    1 KVYGD--FKAVDGVNFKVREGEVFGFLGPNGAGKTTTIRMLTTLLRPTSGTARVAGYDVVREPRKVRRSIGIVPQYASVD 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1885 ELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPS 1964
Cdd:TIGR01188   79 EDLTGRENLEMMGRLYGLPKDEAEERAEELLELFELGEAADRPVGTYSGGMRRRLDIAASLIHQPDVLFLDEPTTGLDPR 158
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1965 ARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGRfAAGHTLTLRVPAARS-QPAAAFV 2043
Cdd:TIGR01188  159 TRRAIWDYIRALKEEGVTILLTTHYMEEADKLCDRIAIIDHGRIIAEGTPEELKRR-LGKDTLESRPRDIQSlKVEVSML 237
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1370474207 2044 AAEFP--GAELREAH--GGRLRFQLPPGGRcALARVFGELAVHGAEhgVEDFSVSQTMLEEVFLYF 2105
Cdd:TIGR01188  238 IAELGetGLGLLAVTvdSDRIKILVPDGDE-TVPEIVEAAIRNGIR--IRSISTERPSLDDVFLKL 300
ABC_DrrA cd03265
Daunorubicin/doxorubicin resistance ATP-binding protein; DrrA is the ATP-binding protein ...
1798-2018 3.44e-65

Daunorubicin/doxorubicin resistance ATP-binding protein; DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin. In addition to DrrA, the complex includes an integral membrane protein called DrrB. DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called P-glycoprotein. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213232 [Multi-domain]  Cd Length: 220  Bit Score: 220.70  E-value: 3.44e-65
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1798 LVLRNLTKVYRGQRmpAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYC 1877
Cdd:cd03265      1 IEVENLVKKYGDFE--AVRGVSFRVRRGEIFGLLGPNGAGKTTTIKMLTTLLKPTSGRATVAGHDVVREPREVRRRIGIV 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1878 PQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEP 1957
Cdd:cd03265     79 FQDLSVDDELTGWENLYIHARLYGVPGAERRERIDELLDFVGLLEAADRLVKTYSGGMRRRLEIARSLVHRPEVLFLDEP 158
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1370474207 1958 TTGMDPSARRFLWNSLLAVVRE-GRSVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHLK 2018
Cdd:cd03265    159 TIGLDPQTRAHVWEYIEKLKEEfGMTILLTTHYMEEAEQLCDRVAIIDHGRIIAEGTPEELK 220
ABC_DR_subfamily_A cd03230
ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily ...
807-1016 4.61e-63

ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A; This family of ATP-binding proteins belongs to a multi-subunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity. In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins. Eukaryotic systems of the ABCA subfamily display ABC domains that are quite similar to this family. The ATP-binding domain shows the highest similarity between all members of the ABC transporter family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213197 [Multi-domain]  Cd Length: 173  Bit Score: 212.64  E-value: 4.61e-63
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  807 VSVRSLEKRFPGspQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVC 886
Cdd:cd03230      1 IEVRNLSKRYGK--KTALDDISLTVEKGEIYGLLGPNGAGKTTLIKIILGLLKPDSGEIKVLGKDIKKEPEEVKRRIGYL 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  887 PQYNVLFDMLTVDEHVwfygrlkglsaavvgpeqdrllqdvglvskqsvqtrHLSGGMQRKLSVAIAFVGGSQVVILDEP 966
Cdd:cd03230     79 PEEPSLYENLTVRENL------------------------------------KLSGGMKQRLALAQALLHDPELLILDEP 122
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1370474207  967 TAGVDPASRRGIWELLLKYR-EGRTLILSTHHLDEAELLGDRVAVVAGGRL 1016
Cdd:cd03230    123 TSGLDPESRREFWELLRELKkEGKTILLSSHILEEAERLCDRVAILNNGRI 173
ABC_DR_subfamily_A cd03230
ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily ...
1798-2008 2.22e-58

ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A; This family of ATP-binding proteins belongs to a multi-subunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity. In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins. Eukaryotic systems of the ABCA subfamily display ABC domains that are quite similar to this family. The ATP-binding domain shows the highest similarity between all members of the ABC transporter family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213197 [Multi-domain]  Cd Length: 173  Bit Score: 199.16  E-value: 2.22e-58
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1798 LVLRNLTKVYRGQrmPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYC 1877
Cdd:cd03230      1 IEVRNLSKRYGKK--TALDDISLTVEKGEIYGLLGPNGAGKTTLIKIILGLLKPDSGEIKVLGKDIKKEPEEVKRRIGYL 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1878 PQSDAIFELLTGREHLEllarlrgvpeaqvaqtagsglarlglswyadrpagtYSGGNKRKLATALALVGDPAVVFLDEP 1957
Cdd:cd03230     79 PEEPSLYENLTVRENLK------------------------------------LSGGMKQRLALAQALLHDPELLILDEP 122
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1370474207 1958 TTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGRF 2008
Cdd:cd03230    123 TSGLDPESRREFWELLRELKKEGKTILLSSHILEEAERLCDRVAILNNGRI 173
drrA TIGR01188
daunorubicin resistance ABC transporter ATP-binding subunit; This model describes daunorubicin ...
822-1031 7.67e-57

daunorubicin resistance ABC transporter ATP-binding subunit; This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc. [Transport and binding proteins, Other]


Pssm-ID: 130256 [Multi-domain]  Cd Length: 302  Bit Score: 199.92  E-value: 7.67e-57
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  822 PALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEH 901
Cdd:TIGR01188    7 KAVDGVNFKVREGEVFGFLGPNGAGKTTTIRMLTTLLRPTSGTARVAGYDVVREPRKVRRSIGIVPQYASVDEDLTGREN 86
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  902 VWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWEL 981
Cdd:TIGR01188   87 LEMMGRLYGLPKDEAEERAEELLELFELGEAADRPVGTYSGGMRRRLDIAASLIHQPDVLFLDEPTTGLDPRTRRAIWDY 166
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1370474207  982 LLKYRE-GRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGS 1031
Cdd:TIGR01188  167 IRALKEeGVTILLTTHYMEEADKLCDRIAIIDHGRIIAEGTPEELKRRLGK 217
ABC_DrrA cd03265
Daunorubicin/doxorubicin resistance ATP-binding protein; DrrA is the ATP-binding protein ...
807-1022 5.22e-56

Daunorubicin/doxorubicin resistance ATP-binding protein; DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin. In addition to DrrA, the complex includes an integral membrane protein called DrrB. DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called P-glycoprotein. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213232 [Multi-domain]  Cd Length: 220  Bit Score: 194.13  E-value: 5.22e-56
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  807 VSVRSLEKRFPGSPqpALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVC 886
Cdd:cd03265      1 IEVENLVKKYGDFE--AVRGVSFRVRRGEIFGLLGPNGAGKTTTIKMLTTLLKPTSGRATVAGHDVVREPREVRRRIGIV 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  887 PQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEP 966
Cdd:cd03265     79 FQDLSVDDELTGWENLYIHARLYGVPGAERRERIDELLDFVGLLEAADRLVKTYSGGMRRRLEIARSLVHRPEVLFLDEP 158
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 1370474207  967 TAGVDPASRRGIWELL--LKYREGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSP 1022
Cdd:cd03265    159 TIGLDPQTRAHVWEYIekLKEEFGMTILLTTHYMEEAEQLCDRVAIIDHGRIIAEGTP 216
ABC_drug_resistance_like cd03264
ABC-type multidrug transport system, ATPase component; The biological function of this family ...
1798-2009 1.86e-49

ABC-type multidrug transport system, ATPase component; The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213231 [Multi-domain]  Cd Length: 211  Bit Score: 175.07  E-value: 1.86e-49
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1798 LVLRNLTKVYRGQRmpAVDRLCLGIPPGeCFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYC 1877
Cdd:cd03264      1 LQLENLTKRYGKKR--ALDGVSLTLGPG-MYGLLGPNGAGKTTLMRILATLTPPSSGTIRIDGQDVLKQPQKLRRRIGYL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1878 PQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEP 1957
Cdd:cd03264     78 PQEFGVYPNFTVREFLDYIAWLKGIPSKEVKARVDEVLELVNLGDRAKKKIGSLSGGMRRRVGIAQALVGDPSILIVDEP 157
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|...
gi 1370474207 1958 TTGMDPSAR-RFLwnSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGRFR 2009
Cdd:cd03264    158 TAGLDPEERiRFR--NLLSELGEDRIVILSTHIVEDVESLCNQVAVLNKGKLV 208
ABC_NatA_sodium_exporter cd03266
ATP-binding cassette domain of the Na+ transporter; NatA is the ATPase component of a ...
1798-2012 3.64e-49

ATP-binding cassette domain of the Na+ transporter; NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the proton-motive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunorubicin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single integral membrane protein.


Pssm-ID: 213233 [Multi-domain]  Cd Length: 218  Bit Score: 174.48  E-value: 3.64e-49
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1798 LVLRNLTKVYRGQRMP--AVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMG 1875
Cdd:cd03266      2 ITADALTKRFRDVKKTvqAVDGVSFTVKPGEVTGLLGPNGAGKTTTLRMLAGLLEPDAGFATVDGFDVVKEPAEARRRLG 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1876 YCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLD 1955
Cdd:cd03266     82 FVSDSTGLYDRLTARENLEYFAGLYGLKGDELTARLEELADRLGMEELLDRRVGGFSTGMRQKVAIARALVHDPPVLLLD 161
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 1370474207 1956 EPTTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGRFRCLG 2012
Cdd:cd03266    162 EPTTGLDVMATRALREFIRQLRALGKCILFSTHIMQEVERLCDRVVVLHRGRVVYEG 218
ABC_drug_resistance_like cd03264
ABC-type multidrug transport system, ATPase component; The biological function of this family ...
807-1020 1.43e-48

ABC-type multidrug transport system, ATPase component; The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213231 [Multi-domain]  Cd Length: 211  Bit Score: 172.38  E-value: 1.43e-48
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  807 VSVRSLEKRFPGspQPALRGLSLDFYQGhITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVC 886
Cdd:cd03264      1 LQLENLTKRYGK--KRALDGVSLTLGPG-MYGLLGPNGAGKTTLMRILATLTPPSSGTIRIDGQDVLKQPQKLRRRIGYL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  887 PQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGL--VSKQSVQTrhLSGGMQRKLSVAIAFVGGSQVVILD 964
Cdd:cd03264     78 PQEFGVYPNFTVREFLDYIAWLKGIPSKEVKARVDEVLELVNLgdRAKKKIGS--LSGGMRRRVGIAQALVGDPSILIVD 155
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 1370474207  965 EPTAGVDPASRRGIWELLLKYREGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCG 1020
Cdd:cd03264    156 EPTAGLDPEERIRFRNLLSELGEDRIVILSTHIVEDVESLCNQVAVLNKGKLVFEG 211
ABC_cobalt_CbiO_domain1 cd03225
First domain of the ATP-binding cassette component of cobalt transport system; Domain I of the ...
808-1015 3.62e-48

First domain of the ATP-binding cassette component of cobalt transport system; Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.


Pssm-ID: 213192 [Multi-domain]  Cd Length: 211  Bit Score: 171.50  E-value: 3.62e-48
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  808 SVRSLEKRFPGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRS-SMAAIRPHLGVC 886
Cdd:cd03225      1 ELKNLSFSYPDGARPALDDISLTIKKGEFVLIVGPNGSGKSTLLRLLNGLLGPTSGEVLVDGKDLTKlSLKELRRKVGLV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  887 PQY-NVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDE 965
Cdd:cd03225     81 FQNpDDQFFGPTVEEEVAFGLENLGLPEEEIEERVEEALELVGLEGLRDRSPFTLSGGQKQRVAIAGVLAMDPDILLLDE 160
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1370474207  966 PTAGVDPASRRGIWELLLKY-REGRTLILSTHHLDEAELLGDRVAVVAGGR 1015
Cdd:cd03225    161 PTAGLDPAGRRELLELLKKLkAEGKTIIIVTHDLDLLLELADRVIVLEDGK 211
ABC_BcrA_bacitracin_resist cd03268
ATP-binding cassette domain of the bacitracin-resistance transporter; The BcrA subfamily ...
807-1016 5.71e-45

ATP-binding cassette domain of the bacitracin-resistance transporter; The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance. Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multi-enzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.


Pssm-ID: 213235 [Multi-domain]  Cd Length: 208  Bit Score: 162.00  E-value: 5.71e-45
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  807 VSVRSLEKRFPGspQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRpHLGVC 886
Cdd:cd03268      1 LKTNDLTKTYGK--KRVLDDISLHVKKGEIYGFLGPNGAGKTTTMKIILGLIKPDSGEITFDGKSYQKNIEALR-RIGAL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  887 PQYNVLFDMLTVDEHVWFYGRLKGLSAAvvgpEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEP 966
Cdd:cd03268     78 IEAPGFYPNLTARENLRLLARLLGIRKK----RIDEVLDVVGLKDSAKKKVKGFSLGMKQRLGIALALLGNPDLLILDEP 153
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1370474207  967 TAGVDPASRRGIWELLLKYR-EGRTLILSTHHLDEAELLGDRVAVVAGGRL 1016
Cdd:cd03268    154 TNGLDPDGIKELRELILSLRdQGITVLISSHLLSEIQKVADRIGIINKGKL 204
ABC_BcrA_bacitracin_resist cd03268
ATP-binding cassette domain of the bacitracin-resistance transporter; The BcrA subfamily ...
1798-2007 1.58e-44

ATP-binding cassette domain of the bacitracin-resistance transporter; The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance. Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multi-enzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.


Pssm-ID: 213235 [Multi-domain]  Cd Length: 208  Bit Score: 160.85  E-value: 1.58e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1798 LVLRNLTKVYRGQRmpAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHlSMGYC 1877
Cdd:cd03268      1 LKTNDLTKTYGKKR--VLDDISLHVKKGEIYGFLGPNGAGKTTTMKIILGLIKPDSGEITFDGKSYQKNIEALR-RIGAL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1878 PQSDAIFELLTGREHLELLARLRGVPEAQVAQTagsgLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEP 1957
Cdd:cd03268     78 IEAPGFYPNLTARENLRLLARLLGIRKKRIDEV----LDVVGLKDSAKKKVKGFSLGMKQRLGIALALLGNPDLLILDEP 153
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1958 TTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGR 2007
Cdd:cd03268    154 TNGLDPDGIKELRELILSLRDQGITVLISSHLLSEIQKVADRIGIINKGK 203
PRK13537 PRK13537
nodulation ABC transporter NodI; Provisional
1797-2017 2.63e-44

nodulation ABC transporter NodI; Provisional


Pssm-ID: 237420 [Multi-domain]  Cd Length: 306  Bit Score: 163.82  E-value: 2.63e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1797 VLVLRNLTKVYrGQRMpAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGY 1876
Cdd:PRK13537     7 PIDFRNVEKRY-GDKL-VVDGLSFHVQRGECFGLLGPNGAGKTTTLRMLLGLTHPDAGSISLCGEPVPSRARHARQRVGV 84
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1877 CPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDE 1956
Cdd:PRK13537    85 VPQFDNLDPDFTVRENLLVFGRYFGLSAAAARALVPPLLEFAKLENKADAKVGELSGGMKRRLTLARALVNDPDVLVLDE 164
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1370474207 1957 PTTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHL 2017
Cdd:PRK13537   165 PTTGLDPQARHLMWERLRSLLARGKTILLTTHFMEEAERLCDRLCVIEEGRKIAEGAPHAL 225
ABC_putative_ATPase cd03269
ATP-binding cassette domain of an uncharacterized transporter; This subgroup is related to the ...
1798-2012 7.66e-44

ATP-binding cassette domain of an uncharacterized transporter; This subgroup is related to the subfamily A transporters involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity. In eubacteria and archaea, the typical organization consists of one ABC and one or two integral membranes. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213236 [Multi-domain]  Cd Length: 210  Bit Score: 158.98  E-value: 7.66e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1798 LVLRNLTKVYRgqRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAhlsMGYC 1877
Cdd:cd03269      1 LEVENVTKRFG--RVTALDDISFSVEKGEIFGLLGPNGAGKTTTIRMILGIILPDSGEVLFDGKPLDIAARNR---IGYL 75
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1878 PQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEP 1957
Cdd:cd03269     76 PEERGLYPKMKVIDQLVYLAQLKGLKKEEARRRIDEWLERLELSEYANKRVEELSKGNQQKVQFIAAVIHDPELLILDEP 155
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 1370474207 1958 TTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGRFRCLG 2012
Cdd:cd03269    156 FSGLDPVNVELLKDVIRELARAGKTVILSTHQMELVEELCDRVLLLNKGRAVLYG 210
NatA COG4555
ABC-type Na+ transport system, ATPase component NatA [Energy production and conversion, ...
807-1022 8.06e-44

ABC-type Na+ transport system, ATPase component NatA [Energy production and conversion, Inorganic ion transport and metabolism];


Pssm-ID: 226927 [Multi-domain]  Cd Length: 245  Bit Score: 160.27  E-value: 8.06e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  807 VSVRSLEKRFpGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVC 886
Cdd:COG4555      2 LEVTDLTKSY-GSKVQAVRDVSFEAEEGEITGLLGENGAGKTTLLRMIATLLIPDSGKVTIDGVDTVRDPSFVRRKIGVL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  887 PQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEP 966
Cdd:COG4555     81 FGERGLYARLTARENLKYFARLNGLSRKEIKARIAELSKRLQLLEYLDRRVGEFSTGMKQKVAIARALVHDPSILVLDEP 160
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 1370474207  967 TAGVDPASRRGIWELLLKYR-EGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSP 1022
Cdd:COG4555    161 TSGLDIRTRRKFHDFIKQLKnEGRAVIFSSHIMQEVEALCDRVIVLHKGEVVLEGSI 217
NatA COG4555
ABC-type Na+ transport system, ATPase component NatA [Energy production and conversion, ...
1797-2020 2.90e-43

ABC-type Na+ transport system, ATPase component NatA [Energy production and conversion, Inorganic ion transport and metabolism];


Pssm-ID: 226927 [Multi-domain]  Cd Length: 245  Bit Score: 158.73  E-value: 2.90e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1797 VLVLRNLTKVYrGQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGY 1876
Cdd:COG4555      1 MLEVTDLTKSY-GSKVQAVRDVSFEAEEGEITGLLGENGAGKTTLLRMIATLLIPDSGKVTIDGVDTVRDPSFVRRKIGV 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1877 CPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDE 1956
Cdd:COG4555     80 LFGERGLYARLTARENLKYFARLNGLSRKEIKARIAELSKRLQLLEYLDRRVGEFSTGMKQKVAIARALVHDPSILVLDE 159
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1370474207 1957 PTTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGR 2020
Cdd:COG4555    160 PTSGLDIRTRRKFHDFIKQLKNEGRAVIFSSHIMQEVEALCDRVIVLHKGEVVLEGSIEALDAR 223
ABC_NatA_sodium_exporter cd03266
ATP-binding cassette domain of the Na+ transporter; NatA is the ATPase component of a ...
807-1016 5.70e-43

ATP-binding cassette domain of the Na+ transporter; NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the proton-motive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunorubicin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single integral membrane protein.


Pssm-ID: 213233 [Multi-domain]  Cd Length: 218  Bit Score: 156.76  E-value: 5.70e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  807 VSVRSLEKRF--PGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLG 884
Cdd:cd03266      2 ITADALTKRFrdVKKTVQAVDGVSFTVKPGEVTGLLGPNGAGKTTTLRMLAGLLEPDAGFATVDGFDVVKEPAEARRRLG 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  885 VCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILD 964
Cdd:cd03266     82 FVSDSTGLYDRLTARENLEYFAGLYGLKGDELTARLEELADRLGMEELLDRRVGGFSTGMRQKVAIARALVHDPPVLLLD 161
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|...
gi 1370474207  965 EPTAGVDPASRRGIWELLLKYRE-GRTLILSTHHLDEAELLGDRVAVVAGGRL 1016
Cdd:cd03266    162 EPTTGLDVMATRALREFIRQLRAlGKCILFSTHIMQEVERLCDRVVVLHRGRV 214
PRK13536 PRK13536
nodulation factor exporter subunit NodI; Provisional
1766-2017 8.00e-43

nodulation factor exporter subunit NodI; Provisional


Pssm-ID: 237419 [Multi-domain]  Cd Length: 340  Bit Score: 160.77  E-value: 8.00e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1766 PRVRSLPLLGEEDEDVARERERVVqGATQGDVLVLRNLTKVYRGQrmPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMV 1845
Cdd:PRK13536    11 PRRLELSPIERKHQGISEAKASIP-GSMSTVAIDLAGVSKSYGDK--AVVNGLSFTVASGECFGLLGPNGAGKSTIARMI 87
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1846 TGDTLASRGEAVLAGHSVAREPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYAD 1925
Cdd:PRK13536    88 LGMTSPDAGKITVLGVPVPARARLARARIGVVPQFDNLDLEFTVRENLLVFGRYFGMSTREIEAVIPSLLEFARLESKAD 167
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1926 RPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVN 2005
Cdd:PRK13536   168 ARVSDLSGGMKRRLTLARALINDPQLLILDEPTTGLDPHARHLIWERLRSLLARGKTILLTTHFMEEAERLCDRLCVLEA 247
                          250
                   ....*....|..
gi 1370474207 2006 GRFRCLGSPQHL 2017
Cdd:PRK13536   248 GRKIAEGRPHAL 259
nodI TIGR01288
ATP-binding ABC transporter family nodulation protein NodI; This protein is required for ...
1800-2017 1.21e-41

ATP-binding ABC transporter family nodulation protein NodI; This protein is required for normal nodulation by nitrogen-fixing root nodule bacteria such as Mesorhizobium loti. It is a member of the family of ABC transporter ATP binding proteins and works with NodJ to export a nodulation signal molecule. This model does not recognize the highly divergent NodI from Azorhizobium caulinodans. [Cellular processes, Other, Transport and binding proteins, Other]


Pssm-ID: 130355 [Multi-domain]  Cd Length: 303  Bit Score: 155.86  E-value: 1.21e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1800 LRNLTKVYRGQRMpaVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYCPQ 1879
Cdd:TIGR01288    7 LVGVSKSYGDKVV--VNDLSFTIARGECFGLLGPNGAGKSTIARMLLGMISPDRGKITVLGEPVPSRARLARVAIGVVPQ 84
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1880 SDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTT 1959
Cdd:TIGR01288   85 FDNLDPEFTVRENLLVFGRYFGMSTREIEAVIPSLLEFARLESKADVRVALLSGGMKRRLTLARALINDPQLLILDEPTT 164
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 1370474207 1960 GMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHL 2017
Cdd:TIGR01288  165 GLDPHARHLIWERLRSLLARGKTILLTTHFMEEAERLCDRLCVLESGRKIAEGRPHAL 222
ABC_putative_ATPase cd03269
ATP-binding cassette domain of an uncharacterized transporter; This subgroup is related to the ...
807-1015 2.44e-40

ATP-binding cassette domain of an uncharacterized transporter; This subgroup is related to the subfamily A transporters involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity. In eubacteria and archaea, the typical organization consists of one ABC and one or two integral membranes. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213236 [Multi-domain]  Cd Length: 210  Bit Score: 148.97  E-value: 2.44e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  807 VSVRSLEKRFpGSPQpALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRssmAAIRPHLGVC 886
Cdd:cd03269      1 LEVENVTKRF-GRVT-ALDDISFSVEKGEIFGLLGPNGAGKTTTIRMILGIILPDSGEVLFDGKPLD---IAARNRIGYL 75
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  887 PQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEP 966
Cdd:cd03269     76 PEERGLYPKMKVIDQLVYLAQLKGLKKEEARRRIDEWLERLELSEYANKRVEELSKGNQQKVQFIAAVIHDPELLILDEP 155
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|
gi 1370474207  967 TAGVDPASRRGIWELLLKY-REGRTLILSTHHLDEAELLGDRVAVVAGGR 1015
Cdd:cd03269    156 FSGLDPVNVELLKDVIRELaRAGKTVILSTHQMELVEELCDRVLLLNKGR 205
ABC_Org_Solvent_Resistant cd03261
ATP-binding cassette transport system involved in resistant to organic solvents; ABC ...
807-1022 7.01e-40

ATP-binding cassette transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213228 [Multi-domain]  Cd Length: 235  Bit Score: 148.42  E-value: 7.01e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  807 VSVRSLEKRFPGspQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDV----RSSMAAIRPH 882
Cdd:cd03261      1 IELRGLTKSFGG--RTVLKGVDLDVRRGEILAIIGPSGSGKSTLLRLIVGLLRPDSGEVLIDGEDIsglsEAELYRLRRR 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  883 LGVCPQYNVLFDMLTVDEHVWFYGRLKG-LSAAVVGpEQDRL-LQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQV 960
Cdd:cd03261     79 MGMLFQSGALFDSLTVFENVAFPLREHTrLSEEEIR-EIVLEkLEAVGLRGAEDLYPAELSGGMKKRVALARALALDPEL 157
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1370474207  961 VILDEPTAGVDPASRRGIWELLLKYRE--GRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSP 1022
Cdd:cd03261    158 LLYDEPTAGLDPIASGVIDDLIRSLKKelGLTSIMVTHDLDTAFAIADRIAVLYDGKIVAEGTP 221
PRK13537 PRK13537
nodulation ABC transporter NodI; Provisional
801-1022 4.65e-39

nodulation ABC transporter NodI; Provisional


Pssm-ID: 237420 [Multi-domain]  Cd Length: 306  Bit Score: 148.41  E-value: 4.65e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  801 PGLSPGVSVRSLEKRFpgSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIR 880
Cdd:PRK13537     2 PMSVAPIDFRNVEKRY--GDKLVVDGLSFHVQRGECFGLLGPNGAGKTTTLRMLLGLTHPDAGSISLCGEPVPSRARHAR 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  881 PHLGVCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQV 960
Cdd:PRK13537    80 QRVGVVPQFDNLDPDFTVRENLLVFGRYFGLSAAAARALVPPLLEFAKLENKADAKVGELSGGMKRRLTLARALVNDPDV 159
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1370474207  961 VILDEPTAGVDPASRRGIWELLLK-YREGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSP 1022
Cdd:PRK13537   160 LVLDEPTTGLDPQARHLMWERLRSlLARGKTILLTTHFMEEAERLCDRLCVIEEGRKIAEGAP 222
ABC_tran pfam00005
ABC transporter; ABC transporters for a large family of proteins responsible for translocation ...
824-968 5.36e-39

ABC transporter; ABC transporters for a large family of proteins responsible for translocation of a variety of compounds across biological membranes. ABC transporters are the largest family of proteins in many completely sequenced bacteria. ABC transporters are composed of two copies of this domain and two copies of a transmembrane domain pfam00664. These four domains may belong to a single polypeptide as in CFTR, or belong in different polypeptide chains.


Pssm-ID: 333758 [Multi-domain]  Cd Length: 150  Bit Score: 142.78  E-value: 5.36e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  824 LRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRS-SMAAIRPHLGVCPQYNVLFDMLTVDEHV 902
Cdd:pfam00005    1 LKNVSLTLNPGEIVALVGPNGAGKSTLLKLISGLLSPTEGTILLDGQDLTDdERKSLRKEIGYVFQDPQLFPRLTVRENL 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  903 WFYGRLKGLSAAVVGPEQDRLLQDVGLV----SKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTA 968
Cdd:pfam00005   81 RLGLRLKGLSKAEKDARAEEALEKLGLGdlldRPVGENPGTLSGGQRQRVAIARALLTKPKLLLLDEPTA 150
EcfA2 COG1122
Energy-coupling factor transporter ATP-binding protein EcfA2 [Inorganic ion transport and ...
804-1022 1.56e-38

Energy-coupling factor transporter ATP-binding protein EcfA2 [Inorganic ion transport and metabolism, General function prediction only];


Pssm-ID: 224047 [Multi-domain]  Cd Length: 235  Bit Score: 144.71  E-value: 1.56e-38
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  804 SPGVSVRSLEKRFPGSPqPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRS--SMAAIRP 881
Cdd:COG1122      1 LRMIEAENLSFRYPGRK-AALKDVSLEIEKGERVLLIGPNGSGKSTLLKLLNGLLKPTSGEVLVDGLDTSSekSLLELRQ 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  882 HLGVCPQY--NVLFdMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQ 959
Cdd:COG1122     80 KVGLVFQNpdDQLF-GPTVEDEVAFGLENLGLPREEIEERVAEALELVGLEELLDRPPFNLSGGQKQRVAIAGVLAMGPE 158
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1370474207  960 VVILDEPTAGVDPASRRGIWELLLKYRE--GRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSP 1022
Cdd:COG1122    159 ILLLDEPTAGLDPKGRRELLELLKKLKEegGKTIIIVTHDLELVLEYADRVVVLDDGKILADGDP 223
YhaQ COG4152
ABC-type uncharacterized transport system, ATPase component [General function prediction only] ...
1798-2103 1.03e-37

ABC-type uncharacterized transport system, ATPase component [General function prediction only];


Pssm-ID: 226631 [Multi-domain]  Cd Length: 300  Bit Score: 144.43  E-value: 1.03e-37
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1798 LVLRNLTKVYrgQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAahlSMGYC 1877
Cdd:COG4152      3 LEIEGVTKSF--GDKKAVDNISFEVPPGEIFGLLGPNGAGKTTTFRMILGLLEPTEGEITWNGGPLSQEIKN---RIGYL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1878 PQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEP 1957
Cdd:COG4152     78 PEERGLYPKMTVEDQLKYLAELKGMPKAEIQKKLQAWLERLEIVGKKTKKIKELSKGNQQKIQFISAVIHEPELLILDEP 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1958 TTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAaghtltlrvpaarsq 2037
Cdd:COG4152    158 FSGLDPVNVELLKDAIFELKEEGATIIFSSHRMEHVEELCDRLLMLKKGQTVLYGTVEDIRRSFG--------------- 222
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1370474207 2038 PAAAFVAAEFPGAELrEAHGGRLRFQLPPGG--RCALAR------VFGELAVHGAehgVEDFSVSQTMLEEVFL 2103
Cdd:COG4152    223 KKRLVIESDLSLEEL-ANIPGILKITETKDGswRIQIENetvareIFQEVARDGY---IQRFELQEPSLHDIFI 292
FepC COG1120
ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component [Inorganic ion ...
805-1022 1.08e-37

ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component [Inorganic ion transport and metabolism, Coenzyme transport and metabolism];


Pssm-ID: 224045 [Multi-domain]  Cd Length: 258  Bit Score: 143.09  E-value: 1.08e-37
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  805 PGVSVRSLEKRFPGspQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRS-SMAAIRPHL 883
Cdd:COG1120      1 MMLEVENLSFGYGG--KPILDDLSFSIPKGEITGILGPNGSGKSTLLKCLAGLLKPKSGEVLLDGKDIASlSPKELAKKL 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  884 GVCPQYNVLFDMLTVDEHVWfYGRLKGLSAAVVGPEQDRL-----LQDVGLV--SKQSVQTrhLSGGMQRKLSVAIAFVG 956
Cdd:COG1120     79 AYVPQSPSAPFGLTVYELVL-LGRYPHLGLFGRPSKEDEEiveeaLELLGLEhlADRPVDE--LSGGERQRVLIARALAQ 155
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1370474207  957 GSQVVILDEPTAGVDPASRRGIWELL--LKYREGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSP 1022
Cdd:COG1120    156 ETPILLLDEPTSHLDIAHQIEVLELLrdLNREKGLTVVMVLHDLNLAARYADHLILLKDGKIVAQGTP 223
ABC_Mj1267_LivG_branched cd03219
ATP-binding cassette component of branched chain amino acids transport system; The Mj1267/LivG ...
1798-2016 1.58e-37

ATP-binding cassette component of branched chain amino acids transport system; The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).


Pssm-ID: 213186 [Multi-domain]  Cd Length: 236  Bit Score: 141.81  E-value: 1.58e-37
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1798 LVLRNLTKVYRGQRmpAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSA--AHLSMG 1875
Cdd:cd03219      1 LEVRGLTKRFGGLV--ALDDVSFSVRPGEIHGLIGPNGAGKTTLFNLISGFLRPTSGSVLFDGEDITGLPPHeiARLGIG 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207 1876 YCPQSDAIFELLTGREHLELLARLRGVP----------EAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALAL 1945
Cdd:cd03219     79 RTFQIPRLFPELTVLENVMVAAQARTGSglllararreEREARERAEELLERVGLADLADRPAGELSYGQQRRLEIARAL 158
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1370474207 1946 VGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQH 2016
Cdd:cd03219    159 ATDPKLLLLDEPAAGLNPEETEELAELIRELRERGITVLLVEHDMDVVMSLADRVTVLDQGRVIAEGTPDE 229
GldA_ABC_ATP TIGR03522
gliding motility-associated ABC transporter ATP-binding subunit GldA; Members of this protein ...
807-1016 1.58e-37

gliding motility-associated ABC transporter ATP-binding subunit GldA; Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.


Pssm-ID: 132561 [Multi-domain]  Cd Length: 301  Bit Score: 144.15  E-value: 1.58e-37
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  807 VSVRSLEKRFpgSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVC 886
Cdd:TIGR03522    3 IRVSSLTKLY--GTQNALDEVSFEAQKGRIVGFLGPNGAGKSTTMKIITGYLPPDSGSVQVCGEDVLQNPKEVQRNIGYL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  887 PQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEP 966
Cdd:TIGR03522   81 PEHNPLYLDMYVREYLQFIAGIYGMKGQLLKQRVEEMIELVGLRPEQHKKIGQLSKGYRQRVGLAQALIHDPKVLILDEP 160
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|
gi 1370474207  967 TAGVDPASRRGIWELLLKYREGRTLILSTHHLDEAELLGDRVAVVAGGRL 1016
Cdd:TIGR03522  161 TTGLDPNQLVEIRNVIKNIGKDKTIILSTHIMQEVEAICDRVIIINKGKI 210
ABC_ATPase cd00267
ATP-binding cassette transporter nucleotide-binding domain; ABC transporters are a large ...
808-1015 1.69e-37

ATP-binding cassette transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213179 [Multi-domain]  Cd Length: 157  Bit Score: 138.53  E-value: 1.69e-37
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  808 SVRSLEKRFPGspQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDV-RSSMAAIRPHLGVC 886
Cdd:cd00267      1 EIENLSFRYGG--RTALDNVSLTLKAGEIVALVGPNGSGKSTLLRAIAGLLKPTSGEILIDGKDIaKLPLEELRRRIGYV 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  887 PQynvlfdmltvdehvwfygrlkglsaavvgpeqdrllqdvglvskqsvqtrhLSGGMQRKLSVAIAFVGGSQVVILDEP 966
Cdd:cd00267     79 PQ---------------------------------------------------LSGGQRQRVALARALLLNPDLLLLDEP 107
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|
gi 1370474207  967 TAGVDPASRRGIWELLLKY-REGRTLILSTHHLDEAELLGDRVAVVAGGR 1015
Cdd:cd00267    108 TSGLDPASRERLLELLRELaEEGRTVIIVTHDPELAELAADRVIVLKDGK 157
ABCC_MRP_Like cd03228
ATP-binding cassette domain of multidrug resistance protein-like transporters; The MRP ...
807-1015 6.04e-37

ATP-binding cassette domain of multidrug resistance protein-like transporters; The MRP (Multidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213195 [Multi-domain]  Cd Length: 171  Bit Score: 137.51  E-value: 6.04e-37
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  807 VSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRS-SMAAIRPHLGV 885
Cdd:cd03228      1 IEFKNVSFSYPGRPKPVLKDVSLTIKPGEKVAIVGPSGSGKSTLLKLLLRLYDPTSGEILIDGVDLRDlDLESLRKNIAY 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  886 CPQYNVLFDMlTVDEHVwfygrlkglsaavvgpeqdrllqdvglvskqsvqtrhLSGGMQRKLSVAIAFVGGSQVVILDE 965
Cdd:cd03228     81 VPQDPFLFSG-TIRENI-------------------------------------LSGGQRQRIAIARALLRDPPILILDE 122
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|
gi 1370474207  966 PTAGVDPASRRGIWELLLKYREGRTLILSTHHLDEAElLGDRVAVVAGGR 1015
Cdd:cd03228    123 ATSALDPETEALILEALRALAKGKTVIVIAHRLSTIR-DADRIIVLDDGR 171
nodI TIGR01288
ATP-binding ABC transporter family nodulation protein NodI; This protein is required for ...
827-1022 1.57e-36

ATP-binding ABC transporter family nodulation protein NodI; This protein is required for normal nodulation by nitrogen-fixing root nodule bacteria such as Mesorhizobium loti. It is a member of the family of ABC transporter ATP binding proteins and works with NodJ to export a nodulation signal molecule. This model does not recognize the highly divergent NodI from Azorhizobium caulinodans. [Cellular processes, Other, Transport and binding proteins, Other]


Pssm-ID: 130355 [Multi-domain]  Cd Length: 303  Bit Score: 141.22  E-value: 1.57e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  827 LSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYG 906
Cdd:TIGR01288   23 LSFTIARGECFGLLGPNGAGKSTIARMLLGMISPDRGKITVLGEPVPSRARLARVAIGVVPQFDNLDPEFTVRENLLVFG 102
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  907 RLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELLLK-Y 985
Cdd:TIGR01288  103 RYFGMSTREIEAVIPSLLEFARLESKADVRVALLSGGMKRRLTLARALINDPQLLILDEPTTGLDPHARHLIWERLRSlL 182
                          170       180       190
                   ....*....|....*....|....*....|....*..
gi 1370474207  986 REGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSP 1022
Cdd:TIGR01288  183 ARGKTILLTTHFMEEAERLCDRLCVLESGRKIAEGRP 219
YhaQ COG4152
ABC-type uncharacterized transport system, ATPase component [General function prediction only] ...
805-1015 4.05e-36

ABC-type uncharacterized transport system, ATPase component [General function prediction only];


Pssm-ID: 226631 [Multi-domain]  Cd Length: 300  Bit Score: 139.80  E-value: 4.05e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  805 PGVSVRSLEKRFpGSPQpALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRssmAAIRPHLG 884
Cdd:COG4152      1 MALEIEGVTKSF-GDKK-AVDNISFEVPPGEIFGLLGPNGAGKTTTFRMILGLLEPTEGEITWNGGPLS---QEIKNRIG 75
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  885 VCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILD 964
Cdd:COG4152     76 YLPEERGLYPKMTVEDQLKYLAELKGMPKAEIQKKLQAWLERLEIVGKKTKKIKELSKGNQQKIQFISAVIHEPELLILD 155
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|..
gi 1370474207  965 EPTAGVDPASRRGIWELLLKYR-EGRTLILSTHHLDEAELLGDRVAVVAGGR 1015
Cdd:COG4152    156 EPFSGLDPVNVELLKDAIFELKeEGATIIFSSHRMEHVEELCDRLLMLKKGQ 207
ABC_NrtD_SsuB_transporters cd03293
ATP-binding cassette domain of the nitrate and sulfonate transporters; NrtD and SsuB are the ...
807-1013 7.49e-36

ATP-binding cassette domain of the nitrate and sulfonate transporters; NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213260 [Multi-domain]  Cd Length: 220  Bit Score: 136.45  E-value: 7.49e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  807 VSVRSLEKRFP--GSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGhdvrSSMAAIRPHLG 884
Cdd:cd03293      1 LEVRNVSKTYGggGGAVTALEDISLSVEEGEFVALVGPSGCGKSTLLRIIAGLERPTSGEVLVDG----EPVTGPGPDRG 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  885 VCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILD 964
Cdd:cd03293     77 YVFQQDALLPWLTVLDNVALGLELQGVPKAEARERAEELLELVGLSGFENAYPHQLSGGMRQRVALARALAVDPDVLLLD 156
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|.
gi 1370474207  965 EPTAGVDPASRRGIWELLLK--YREGRTLILSTHHLDEAELLGDRVAVVAG 1013
Cdd:cd03293    157 EPFSALDALTREQLQEELLDiwRETGKTVLLVTHDIDEAVFLADRVVVLSA 207
PRK13536 PRK13536
nodulation factor exporter subunit NodI; Provisional
796-1022 1.22e-35

nodulation factor exporter subunit NodI; Provisional


Pssm-ID: 237419 [Multi-domain]  Cd Length: 340  Bit Score: 139.58  E-value: 1.22e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  796 VEEAPPGLSPGVSVR--SLEKRFPGspQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVR 873
Cdd:PRK13536    29 AKASIPGSMSTVAIDlaGVSKSYGD--KAVVNGLSFTVASGECFGLLGPNGAGKSTIARMILGMTSPDAGKITVLGVPVP 106
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  874 SSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIA 953
Cdd:PRK13536   107 ARARLARARIGVVPQFDNLDLEFTVRENLLVFGRYFGMSTREIEAVIPSLLEFARLESKADARVSDLSGGMKRRLTLARA 186
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  954 FVGGSQVVILDEPTAGVDPASRRGIWELLLK-YREGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSP 1022
Cdd:PRK13536   187 LINDPQLLILDEPTTGLDPHARHLIWERLRSlLARGKTILLTTHFMEEAERLCDRLCVLEAGRKIAEGRP 256
ABC_Mj1267_LivG_branched cd03219
ATP-binding cassette component of branched chain amino acids transport system; The Mj1267/LivG ...
808-1022 1.37e-35

ATP-binding cassette component of branched chain amino acids transport system; The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).


Pssm-ID: 213186 [Multi-domain]  Cd Length: 236  Bit Score: 136.03  E-value: 1.37e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  808 SVRSLEKRFPGSPqpALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCP 887
Cdd:cd03219      2 EVRGLTKRFGGLV--ALDDVSFSVRPGEIHGLIGPNGAGKTTLFNLISGFLRPTSGSVLFDGEDITGLPPHEIARLGIGR 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  888 --QYNVLFDMLTVDEHV------------WFYGRLKGLSAAVvgpEQ-DRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAI 952
Cdd:cd03219     80 tfQIPRLFPELTVLENVmvaaqartgsglLLARARREEREAR---ERaEELLERVGLADLADRPAGELSYGQQRRLEIAR 156
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1370474207  953 AFVGGSQVVILDEPTAGVDPASRRGIWELLLKYRE-GRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSP 1022
Cdd:cd03219    157 ALATDPKLLLLDEPAAGLNPEETEELAELIRELRErGITVLLVEHDMDVVMSLADRVTVLDQGRVIAEGTP 227
MlaF COG1127
ABC-type transporter Mla maintaining outer membrane lipid asymmetry, ATPase component MlaF ...
804-1022 2.75e-35

ABC-type transporter Mla maintaining outer membrane lipid asymmetry, ATPase component MlaF [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 224052 [Multi-domain]  Cd Length: 263  Bit Score: 136.18  E-value: 2.75e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370474207  804 SPGVSVRSLEKRFPGspQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMA----AI 879
Cdd:COG1127      6 EPLIEVRGVTKSFGD--RVILDGVDLD