NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1370506787|ref|XP_024302028|]
View 

securin isoform X1 [Homo sapiens]

Protein Classification

Securin domain-containing protein (domain architecture ID 10522101)

Securin domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Securin pfam04856
Securin sister-chromatid separation inhibitor; Securin is also known as pituitary ...
47-201 3.37e-48

Securin sister-chromatid separation inhibitor; Securin is also known as pituitary tumor-transforming gene product. Over-expression of securin is associated with a number of tumors, and it has been proposed that this may be due to erroneous chromatid separation leading to chromosome gain or loss.


:

Pssm-ID: 282682  Cd Length: 214  Bit Score: 157.04  E-value: 3.37e-48
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370506787  47 GRSQVSTPRFGKTFDAPPALPKATRKALGTVNrateKSVKTKGPLKQKQPSFSAKKMTEKTVKAKSSVPASDDAYPEIEK 126
Cdd:pfam04856  46 GSSSVKLPRYGSVAGAGLNLPKPSTKSLVLKD----IEVKSKTELESESDELSDKKIFPLSKKLKSSLEADIEYAPERQK 121
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370506787 127 FFPFNPLDFESFDLPEEHQIAHLPLSGVPLMI--LDEERELEKLFQLGPPSPVKMPSPPWESNLLQ-------------- 190
Cdd:pfam04856 122 ELPYQPLGYEPFDLPEENDIEKLKLRNSPLMIeyLTEDREQEPLLDLDELSPLEKPSLDEESSSDTtrrnklasnlsips 201
                         170
                  ....*....|...
gi 1370506787 191 --SPSSILSTLDV 201
Cdd:pfam04856 202 pnSPLSGLSTLEL 214
 
Name Accession Description Interval E-value
Securin pfam04856
Securin sister-chromatid separation inhibitor; Securin is also known as pituitary ...
47-201 3.37e-48

Securin sister-chromatid separation inhibitor; Securin is also known as pituitary tumor-transforming gene product. Over-expression of securin is associated with a number of tumors, and it has been proposed that this may be due to erroneous chromatid separation leading to chromosome gain or loss.


Pssm-ID: 282682  Cd Length: 214  Bit Score: 157.04  E-value: 3.37e-48
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370506787  47 GRSQVSTPRFGKTFDAPPALPKATRKALGTVNrateKSVKTKGPLKQKQPSFSAKKMTEKTVKAKSSVPASDDAYPEIEK 126
Cdd:pfam04856  46 GSSSVKLPRYGSVAGAGLNLPKPSTKSLVLKD----IEVKSKTELESESDELSDKKIFPLSKKLKSSLEADIEYAPERQK 121
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370506787 127 FFPFNPLDFESFDLPEEHQIAHLPLSGVPLMI--LDEERELEKLFQLGPPSPVKMPSPPWESNLLQ-------------- 190
Cdd:pfam04856 122 ELPYQPLGYEPFDLPEENDIEKLKLRNSPLMIeyLTEDREQEPLLDLDELSPLEKPSLDEESSSDTtrrnklasnlsips 201
                         170
                  ....*....|...
gi 1370506787 191 --SPSSILSTLDV 201
Cdd:pfam04856 202 pnSPLSGLSTLEL 214
 
Name Accession Description Interval E-value
Securin pfam04856
Securin sister-chromatid separation inhibitor; Securin is also known as pituitary ...
47-201 3.37e-48

Securin sister-chromatid separation inhibitor; Securin is also known as pituitary tumor-transforming gene product. Over-expression of securin is associated with a number of tumors, and it has been proposed that this may be due to erroneous chromatid separation leading to chromosome gain or loss.


Pssm-ID: 282682  Cd Length: 214  Bit Score: 157.04  E-value: 3.37e-48
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370506787  47 GRSQVSTPRFGKTFDAPPALPKATRKALGTVNrateKSVKTKGPLKQKQPSFSAKKMTEKTVKAKSSVPASDDAYPEIEK 126
Cdd:pfam04856  46 GSSSVKLPRYGSVAGAGLNLPKPSTKSLVLKD----IEVKSKTELESESDELSDKKIFPLSKKLKSSLEADIEYAPERQK 121
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1370506787 127 FFPFNPLDFESFDLPEEHQIAHLPLSGVPLMI--LDEERELEKLFQLGPPSPVKMPSPPWESNLLQ-------------- 190
Cdd:pfam04856 122 ELPYQPLGYEPFDLPEENDIEKLKLRNSPLMIeyLTEDREQEPLLDLDELSPLEKPSLDEESSSDTtrrnklasnlsips 201
                         170
                  ....*....|...
gi 1370506787 191 --SPSSILSTLDV 201
Cdd:pfam04856 202 pnSPLSGLSTLEL 214
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH