NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1034657467|ref|XP_016868293|]
View 

general transcription factor II-I repeat domain-containing protein 1 isoform X4 [Homo sapiens]

Protein Classification

GTF2I domain-containing protein (domain architecture ID 10502974)

GTF2I domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
GTF2I pfam02946
GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of ...
787-859 4.55e-35

GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of proteins including GTF2I. It has been suggested that this may be a DNA binding domain.


:

Pssm-ID: 308544  Cd Length: 73  Bit Score: 127.66  E-value: 4.55e-35
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034657467 787 LREQVKELFNEKYGEALGLNRPVLVPYKLIRDSPDAVEVTGLPDDIPFRNPNTYDIHRLEKILKAREHVRMVI 859
Cdd:pfam02946   1 LRKQVEDLFNKKYGEALGKSEPVPVPYEKILSDPEDVVVEGLPEGVPFRRPSTYGIPTLEKILEASSRIKFVI 73
GTF2I pfam02946
GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of ...
690-762 2.67e-34

GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of proteins including GTF2I. It has been suggested that this may be a DNA binding domain.


:

Pssm-ID: 308544  Cd Length: 73  Bit Score: 125.35  E-value: 2.67e-34
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034657467 690 LREQVQDLFNKKYGEALGIKYPVQVPYKRIKSNPGSVIIEGLPPGIPFRKPCTFGSQNLERILAVADKIKFTV 762
Cdd:pfam02946   1 LRKQVEDLFNKKYGEALGKSEPVPVPYEKILSDPEDVVVEGLPEGVPFRRPSTYGIPTLEKILEASSRIKFVI 73
GTF2I pfam02946
GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of ...
565-637 3.97e-34

GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of proteins including GTF2I. It has been suggested that this may be a DNA binding domain.


:

Pssm-ID: 308544  Cd Length: 73  Bit Score: 124.96  E-value: 3.97e-34
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034657467 565 LRKQVELLFNTRYAKAIGISEPVKVPYSKFLMHPEELFVVGLPEGISLRRPNCFGIAKLRKILEASNSIQFVI 637
Cdd:pfam02946   1 LRKQVEDLFNKKYGEALGKSEPVPVPYEKILSDPEDVVVEGLPEGVPFRRPSTYGIPTLEKILEASSRIKFVI 73
GTF2I pfam02946
GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of ...
351-423 2.88e-33

GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of proteins including GTF2I. It has been suggested that this may be a DNA binding domain.


:

Pssm-ID: 308544  Cd Length: 73  Bit Score: 122.26  E-value: 2.88e-33
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034657467 351 LRECVQILFNSRYAEALGLDHMVPVPYRKIACDPEAVEIVGIPDKIPFKRPCTYGVPKLKRILEERHSIHFII 423
Cdd:pfam02946   1 LRKQVEDLFNKKYGEALGKSEPVPVPYEKILSDPEDVVVEGLPEGVPFRRPSTYGIPTLEKILEASSRIKFVI 73
GTF2I pfam02946
GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of ...
128-200 3.94e-32

GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of proteins including GTF2I. It has been suggested that this may be a DNA binding domain.


:

Pssm-ID: 308544  Cd Length: 73  Bit Score: 119.18  E-value: 3.94e-32
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034657467 128 LRKMVEEVFDVLYSEALGRASVVPLPYERLLREPGLLAVQGLPEGLAFRRPAEYDPKALMAILEHSHRIRFKL 200
Cdd:pfam02946   1 LRKQVEDLFNKKYGEALGKSEPVPVPYEKILSDPEDVVVEGLPEGVPFRRPSTYGIPTLEKILEASSRIKFVI 73
 
Name Accession Description Interval E-value
GTF2I pfam02946
GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of ...
787-859 4.55e-35

GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of proteins including GTF2I. It has been suggested that this may be a DNA binding domain.


Pssm-ID: 308544  Cd Length: 73  Bit Score: 127.66  E-value: 4.55e-35
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034657467 787 LREQVKELFNEKYGEALGLNRPVLVPYKLIRDSPDAVEVTGLPDDIPFRNPNTYDIHRLEKILKAREHVRMVI 859
Cdd:pfam02946   1 LRKQVEDLFNKKYGEALGKSEPVPVPYEKILSDPEDVVVEGLPEGVPFRRPSTYGIPTLEKILEASSRIKFVI 73
GTF2I pfam02946
GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of ...
690-762 2.67e-34

GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of proteins including GTF2I. It has been suggested that this may be a DNA binding domain.


Pssm-ID: 308544  Cd Length: 73  Bit Score: 125.35  E-value: 2.67e-34
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034657467 690 LREQVQDLFNKKYGEALGIKYPVQVPYKRIKSNPGSVIIEGLPPGIPFRKPCTFGSQNLERILAVADKIKFTV 762
Cdd:pfam02946   1 LRKQVEDLFNKKYGEALGKSEPVPVPYEKILSDPEDVVVEGLPEGVPFRRPSTYGIPTLEKILEASSRIKFVI 73
GTF2I pfam02946
GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of ...
565-637 3.97e-34

GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of proteins including GTF2I. It has been suggested that this may be a DNA binding domain.


Pssm-ID: 308544  Cd Length: 73  Bit Score: 124.96  E-value: 3.97e-34
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034657467 565 LRKQVELLFNTRYAKAIGISEPVKVPYSKFLMHPEELFVVGLPEGISLRRPNCFGIAKLRKILEASNSIQFVI 637
Cdd:pfam02946   1 LRKQVEDLFNKKYGEALGKSEPVPVPYEKILSDPEDVVVEGLPEGVPFRRPSTYGIPTLEKILEASSRIKFVI 73
GTF2I pfam02946
GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of ...
351-423 2.88e-33

GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of proteins including GTF2I. It has been suggested that this may be a DNA binding domain.


Pssm-ID: 308544  Cd Length: 73  Bit Score: 122.26  E-value: 2.88e-33
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034657467 351 LRECVQILFNSRYAEALGLDHMVPVPYRKIACDPEAVEIVGIPDKIPFKRPCTYGVPKLKRILEERHSIHFII 423
Cdd:pfam02946   1 LRKQVEDLFNKKYGEALGKSEPVPVPYEKILSDPEDVVVEGLPEGVPFRRPSTYGIPTLEKILEASSRIKFVI 73
GTF2I pfam02946
GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of ...
128-200 3.94e-32

GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of proteins including GTF2I. It has been suggested that this may be a DNA binding domain.


Pssm-ID: 308544  Cd Length: 73  Bit Score: 119.18  E-value: 3.94e-32
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034657467 128 LRKMVEEVFDVLYSEALGRASVVPLPYERLLREPGLLAVQGLPEGLAFRRPAEYDPKALMAILEHSHRIRFKL 200
Cdd:pfam02946   1 LRKQVEDLFNKKYGEALGKSEPVPVPYEKILSDPEDVVVEGLPEGVPFRRPSTYGIPTLEKILEASSRIKFVI 73
 
Name Accession Description Interval E-value
GTF2I pfam02946
GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of ...
787-859 4.55e-35

GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of proteins including GTF2I. It has been suggested that this may be a DNA binding domain.


Pssm-ID: 308544  Cd Length: 73  Bit Score: 127.66  E-value: 4.55e-35
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034657467 787 LREQVKELFNEKYGEALGLNRPVLVPYKLIRDSPDAVEVTGLPDDIPFRNPNTYDIHRLEKILKAREHVRMVI 859
Cdd:pfam02946   1 LRKQVEDLFNKKYGEALGKSEPVPVPYEKILSDPEDVVVEGLPEGVPFRRPSTYGIPTLEKILEASSRIKFVI 73
GTF2I pfam02946
GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of ...
690-762 2.67e-34

GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of proteins including GTF2I. It has been suggested that this may be a DNA binding domain.


Pssm-ID: 308544  Cd Length: 73  Bit Score: 125.35  E-value: 2.67e-34
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034657467 690 LREQVQDLFNKKYGEALGIKYPVQVPYKRIKSNPGSVIIEGLPPGIPFRKPCTFGSQNLERILAVADKIKFTV 762
Cdd:pfam02946   1 LRKQVEDLFNKKYGEALGKSEPVPVPYEKILSDPEDVVVEGLPEGVPFRRPSTYGIPTLEKILEASSRIKFVI 73
GTF2I pfam02946
GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of ...
565-637 3.97e-34

GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of proteins including GTF2I. It has been suggested that this may be a DNA binding domain.


Pssm-ID: 308544  Cd Length: 73  Bit Score: 124.96  E-value: 3.97e-34
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034657467 565 LRKQVELLFNTRYAKAIGISEPVKVPYSKFLMHPEELFVVGLPEGISLRRPNCFGIAKLRKILEASNSIQFVI 637
Cdd:pfam02946   1 LRKQVEDLFNKKYGEALGKSEPVPVPYEKILSDPEDVVVEGLPEGVPFRRPSTYGIPTLEKILEASSRIKFVI 73
GTF2I pfam02946
GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of ...
351-423 2.88e-33

GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of proteins including GTF2I. It has been suggested that this may be a DNA binding domain.


Pssm-ID: 308544  Cd Length: 73  Bit Score: 122.26  E-value: 2.88e-33
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034657467 351 LRECVQILFNSRYAEALGLDHMVPVPYRKIACDPEAVEIVGIPDKIPFKRPCTYGVPKLKRILEERHSIHFII 423
Cdd:pfam02946   1 LRKQVEDLFNKKYGEALGKSEPVPVPYEKILSDPEDVVVEGLPEGVPFRRPSTYGIPTLEKILEASSRIKFVI 73
GTF2I pfam02946
GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of ...
128-200 3.94e-32

GTF2I-like repeat; This region of sequence similarity is found up to six times in a variety of proteins including GTF2I. It has been suggested that this may be a DNA binding domain.


Pssm-ID: 308544  Cd Length: 73  Bit Score: 119.18  E-value: 3.94e-32
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034657467 128 LRKMVEEVFDVLYSEALGRASVVPLPYERLLREPGLLAVQGLPEGLAFRRPAEYDPKALMAILEHSHRIRFKL 200
Cdd:pfam02946   1 LRKQVEDLFNKKYGEALGKSEPVPVPYEKILSDPEDVVVEGLPEGVPFRRPSTYGIPTLEKILEASSRIKFVI 73
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH