NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|971417927|ref|XP_015149323.1|]
View 

endoplasmic reticulum-Golgi intermediate compartment protein 1 isoform X1 [Gallus gallus]

Protein Classification

ERGIC_N and COPIIcoated_ERV domain-containing protein (domain architecture ID 10620102)

ERGIC_N and COPIIcoated_ERV domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
COPIIcoated_ERV super family cl06835
Endoplasmic reticulum vesicle transporter; This family is conserved from plants and fungi to ...
104-271 6.02e-47

Endoplasmic reticulum vesicle transporter; This family is conserved from plants and fungi to humans. Erv46 works in close conjunction with Erv41 and together they form a complex which cycles between the endoplasmic reticulum and Golgi complex. Erv46-41 interacts strongly with the endoplasmic reticulum glucosidase II. Mammalian glucosidase II comprises a catalytic alpha-subunit and a 58 kDa beta subunit, which is required for ER localization. All proteins identified biochemically as Erv41p-Erv46p interactors are localized to the early secretory pathway and are involved in protein maturation and processing in the ER and/or sorting into COPII vesicles for transport to the Golgi.


The actual alignment was detected with superfamily member pfam07970:

Pssm-ID: 311775  Cd Length: 223  Bit Score: 159.68  E-value: 6.02e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 971417927  104 SMKIPLNNGDGCRFEGHFSINKVPGNFHV----STHSAT--------AQPQNPDMTHIIHKLSFGDKLqvqnvHGAFNAL 171
Cdd:pfam07970  44 VEKIKEQLNEGCRIKGTLEVNKVAGNFHIapgrSFQQGGghvhdlspYDSDKFNFSHTIHHLSFGPDI-----PGEVNPL 118
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 971417927  172 EGADKLSSNPLAS-HDYILKIVPTVYEDMSGKQRYSYQYTV------ANKEYVAYSHTGriIPAIWFRYDLSPITVKYTE 244
Cdd:pfam07970 119 DGTKTVQTDTGNYmFQYFLKVVPTRYEFLDGKTIETNQYSVtshdrpLTGGRDEDGRGG--LPGVFFNYDISPLKVINTE 196
                         170       180
                  ....*....|....*....|....*..
gi 971417927  245 RRQPLYRFITSICAIIGGTFTVAGILD 271
Cdd:pfam07970 197 QRRSFSHFLTSVCAIIGGVFTVASLID 223
ERGIC_N pfam13850
Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC); This family is the N-terminal of ...
5-94 3.32e-35

Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC); This family is the N-terminal of ERGIC proteins, ER-Golgi intermediate compartment clusters, otherwise known as Ervs, and is associated with family COPIIcoated_ERV, pfam07970.


:

Pssm-ID: 316374  Cd Length: 87  Bit Score: 124.47  E-value: 3.32e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 971417927    5 FRRFDIYRKVPKDLTQPTYTGAIISVCCCLFILFLFLSELTGFIATEIVNELYVddpDKDSGGKIEVNLNISLPNLHCEL 84
Cdd:pfam13850   1 LKRFDAFPKTPEDLRVRTSSGGIITLISILIILFLFLSELGSYLTGEVVPELVV---DKSRGEKLQINLDITFPAMPCDL 77
                          90
                  ....*....|
gi 971417927   85 VGLDIQDEMG 94
Cdd:pfam13850  78 LSVDVQDASG 87
 
Name Accession Description Interval E-value
COPIIcoated_ERV pfam07970
Endoplasmic reticulum vesicle transporter; This family is conserved from plants and fungi to ...
104-271 6.02e-47

Endoplasmic reticulum vesicle transporter; This family is conserved from plants and fungi to humans. Erv46 works in close conjunction with Erv41 and together they form a complex which cycles between the endoplasmic reticulum and Golgi complex. Erv46-41 interacts strongly with the endoplasmic reticulum glucosidase II. Mammalian glucosidase II comprises a catalytic alpha-subunit and a 58 kDa beta subunit, which is required for ER localization. All proteins identified biochemically as Erv41p-Erv46p interactors are localized to the early secretory pathway and are involved in protein maturation and processing in the ER and/or sorting into COPII vesicles for transport to the Golgi.


Pssm-ID: 311775  Cd Length: 223  Bit Score: 159.68  E-value: 6.02e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 971417927  104 SMKIPLNNGDGCRFEGHFSINKVPGNFHV----STHSAT--------AQPQNPDMTHIIHKLSFGDKLqvqnvHGAFNAL 171
Cdd:pfam07970  44 VEKIKEQLNEGCRIKGTLEVNKVAGNFHIapgrSFQQGGghvhdlspYDSDKFNFSHTIHHLSFGPDI-----PGEVNPL 118
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 971417927  172 EGADKLSSNPLAS-HDYILKIVPTVYEDMSGKQRYSYQYTV------ANKEYVAYSHTGriIPAIWFRYDLSPITVKYTE 244
Cdd:pfam07970 119 DGTKTVQTDTGNYmFQYFLKVVPTRYEFLDGKTIETNQYSVtshdrpLTGGRDEDGRGG--LPGVFFNYDISPLKVINTE 196
                         170       180
                  ....*....|....*....|....*..
gi 971417927  245 RRQPLYRFITSICAIIGGTFTVAGILD 271
Cdd:pfam07970 197 QRRSFSHFLTSVCAIIGGVFTVASLID 223
ERGIC_N pfam13850
Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC); This family is the N-terminal of ...
5-94 3.32e-35

Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC); This family is the N-terminal of ERGIC proteins, ER-Golgi intermediate compartment clusters, otherwise known as Ervs, and is associated with family COPIIcoated_ERV, pfam07970.


Pssm-ID: 316374  Cd Length: 87  Bit Score: 124.47  E-value: 3.32e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 971417927    5 FRRFDIYRKVPKDLTQPTYTGAIISVCCCLFILFLFLSELTGFIATEIVNELYVddpDKDSGGKIEVNLNISLPNLHCEL 84
Cdd:pfam13850   1 LKRFDAFPKTPEDLRVRTSSGGIITLISILIILFLFLSELGSYLTGEVVPELVV---DKSRGEKLQINLDITFPAMPCDL 77
                          90
                  ....*....|
gi 971417927   85 VGLDIQDEMG 94
Cdd:pfam13850  78 LSVDVQDASG 87
 
Name Accession Description Interval E-value
COPIIcoated_ERV pfam07970
Endoplasmic reticulum vesicle transporter; This family is conserved from plants and fungi to ...
104-271 6.02e-47

Endoplasmic reticulum vesicle transporter; This family is conserved from plants and fungi to humans. Erv46 works in close conjunction with Erv41 and together they form a complex which cycles between the endoplasmic reticulum and Golgi complex. Erv46-41 interacts strongly with the endoplasmic reticulum glucosidase II. Mammalian glucosidase II comprises a catalytic alpha-subunit and a 58 kDa beta subunit, which is required for ER localization. All proteins identified biochemically as Erv41p-Erv46p interactors are localized to the early secretory pathway and are involved in protein maturation and processing in the ER and/or sorting into COPII vesicles for transport to the Golgi.


Pssm-ID: 311775  Cd Length: 223  Bit Score: 159.68  E-value: 6.02e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 971417927  104 SMKIPLNNGDGCRFEGHFSINKVPGNFHV----STHSAT--------AQPQNPDMTHIIHKLSFGDKLqvqnvHGAFNAL 171
Cdd:pfam07970  44 VEKIKEQLNEGCRIKGTLEVNKVAGNFHIapgrSFQQGGghvhdlspYDSDKFNFSHTIHHLSFGPDI-----PGEVNPL 118
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 971417927  172 EGADKLSSNPLAS-HDYILKIVPTVYEDMSGKQRYSYQYTV------ANKEYVAYSHTGriIPAIWFRYDLSPITVKYTE 244
Cdd:pfam07970 119 DGTKTVQTDTGNYmFQYFLKVVPTRYEFLDGKTIETNQYSVtshdrpLTGGRDEDGRGG--LPGVFFNYDISPLKVINTE 196
                         170       180
                  ....*....|....*....|....*..
gi 971417927  245 RRQPLYRFITSICAIIGGTFTVAGILD 271
Cdd:pfam07970 197 QRRSFSHFLTSVCAIIGGVFTVASLID 223
ERGIC_N pfam13850
Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC); This family is the N-terminal of ...
5-94 3.32e-35

Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC); This family is the N-terminal of ERGIC proteins, ER-Golgi intermediate compartment clusters, otherwise known as Ervs, and is associated with family COPIIcoated_ERV, pfam07970.


Pssm-ID: 316374  Cd Length: 87  Bit Score: 124.47  E-value: 3.32e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 971417927    5 FRRFDIYRKVPKDLTQPTYTGAIISVCCCLFILFLFLSELTGFIATEIVNELYVddpDKDSGGKIEVNLNISLPNLHCEL 84
Cdd:pfam13850   1 LKRFDAFPKTPEDLRVRTSSGGIITLISILIILFLFLSELGSYLTGEVVPELVV---DKSRGEKLQINLDITFPAMPCDL 77
                          90
                  ....*....|
gi 971417927   85 VGLDIQDEMG 94
Cdd:pfam13850  78 LSVDVQDASG 87
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH