NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|578837493|ref|XP_006724423.1|]
View 

PREDICTED: Hermansky-Pudlak syndrome 4 protein isoform X16 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
dnaA super family cl28271
chromosomal replication initiation protein; Provisional
243-360 8.01e-03

chromosomal replication initiation protein; Provisional


The actual alignment was detected with superfamily member PRK14086:

Pssm-ID: 333091  Cd Length: 617  Bit Score: 38.65  E-value: 8.01e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 578837493 243 PTPPEDTAISSLRPPSAPEMLTQHGAQEQLEDHPGHSSQAPIPRADPlPRRTRRPLLLPRLDPGQRGNKLPTGEQGLDED 322
Cdd:PRK14086 174 FPPRAPYASPASYAPEQERDREPYDAGRPEYDQRRRDYDHPRPDWDR-PRRDRTDRPEPPPGAGHVHRGGPGPPERDDAP 252
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 578837493 323 VdgVCESHAAPGLECSSGSANCQGAGPSAdgissRLTP 360
Cdd:PRK14086 253 V--VPIRPSAPGPLAAQPAPAPGPGEPTA-----RLNP 283
 
Name Accession Description Interval E-value
dnaA PRK14086
chromosomal replication initiation protein; Provisional
243-360 8.01e-03

chromosomal replication initiation protein; Provisional


Pssm-ID: 237605  Cd Length: 617  Bit Score: 38.65  E-value: 8.01e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 578837493 243 PTPPEDTAISSLRPPSAPEMLTQHGAQEQLEDHPGHSSQAPIPRADPlPRRTRRPLLLPRLDPGQRGNKLPTGEQGLDED 322
Cdd:PRK14086 174 FPPRAPYASPASYAPEQERDREPYDAGRPEYDQRRRDYDHPRPDWDR-PRRDRTDRPEPPPGAGHVHRGGPGPPERDDAP 252
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 578837493 323 VdgVCESHAAPGLECSSGSANCQGAGPSAdgissRLTP 360
Cdd:PRK14086 253 V--VPIRPSAPGPLAAQPAPAPGPGEPTA-----RLNP 283
 
Name Accession Description Interval E-value
dnaA PRK14086
chromosomal replication initiation protein; Provisional
243-360 8.01e-03

chromosomal replication initiation protein; Provisional


Pssm-ID: 237605  Cd Length: 617  Bit Score: 38.65  E-value: 8.01e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 578837493 243 PTPPEDTAISSLRPPSAPEMLTQHGAQEQLEDHPGHSSQAPIPRADPlPRRTRRPLLLPRLDPGQRGNKLPTGEQGLDED 322
Cdd:PRK14086 174 FPPRAPYASPASYAPEQERDREPYDAGRPEYDQRRRDYDHPRPDWDR-PRRDRTDRPEPPPGAGHVHRGGPGPPERDDAP 252
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 578837493 323 VdgVCESHAAPGLECSSGSANCQGAGPSAdgissRLTP 360
Cdd:PRK14086 253 V--VPIRPSAPGPLAAQPAPAPGPGEPTA-----RLNP 283
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH