NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|568956754|ref|XP_006531041.1|]
View 

PREDICTED: differentially expressed in FDCP 8 isoform X3 [Mus musculus]

Protein Classification

C1 and zf-RING_9 domain-containing protein (domain architecture ID 10207237)

C1 and zf-RING_9 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
zf-RING_9 pfam13901
Putative zinc-RING and/or ribbon; This is a family of cysteine-rich proteins. Many members ...
233-430 1.89e-89

Putative zinc-RING and/or ribbon; This is a family of cysteine-rich proteins. Many members also carry a pleckstrin-homology domain, pfam00169


:

Pssm-ID: 338995  Cd Length: 196  Bit Score: 269.80  E-value: 1.89e-89
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568956754  233 CDYTGQYYCSHCHWNDLAVIPARVVHNWDFEPRKVSRCSMRYLALMVSRPVLRLREINPLLFNYVEELVEIRKLRQDILL 312
Cdd:pfam13901   2 CDYTGKYYCSGCHWNDTSVIPARILHNWDFKKYPVSRFAKQLLDSIYDKPLLNLSDLNPKLYSKVEELAKVRRLRKQLRL 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568956754  313 MKPYFITCKEAMEARLLLQLQDRQHFVENDEMYSIQDLLEVHMGRLSCSLTEIHTLFAKHIKlDCERCQAKGFVCELCKE 392
Cdd:pfam13901  82 MKDYLLTCRFAAEERLLKLLGPREHLLEDPHLYSLADLVDIKSGSLLKQLEKLVQFAEKHVT-NCELCQGKGFICELCNS 160
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 568956754  393 GDVLFPFDSH-TSVCNDCSAVFHRDCYYDNsttCPKCAR 430
Cdd:pfam13901 161 DDIIFPFQIDtTSRCPKCGAVFHKSCFRKS---CPKCLR 196
C1 super family cl00040
Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of ...
136-186 1.88e-05

Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).


The actual alignment was detected with superfamily member cd00029:

Pssm-ID: 350872  Cd Length: 50  Bit Score: 41.71  E-value: 1.88e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 568956754 136 HRFyKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCCYRCHSKCLNLISKPC 186
Cdd:cd00029    1 HRF-VRKSFFKPTFCDVCRKSIWGLFKQGLRCSWCKVKCHKKCADKVPPSC 50
 
Name Accession Description Interval E-value
zf-RING_9 pfam13901
Putative zinc-RING and/or ribbon; This is a family of cysteine-rich proteins. Many members ...
233-430 1.89e-89

Putative zinc-RING and/or ribbon; This is a family of cysteine-rich proteins. Many members also carry a pleckstrin-homology domain, pfam00169


Pssm-ID: 338995  Cd Length: 196  Bit Score: 269.80  E-value: 1.89e-89
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568956754  233 CDYTGQYYCSHCHWNDLAVIPARVVHNWDFEPRKVSRCSMRYLALMVSRPVLRLREINPLLFNYVEELVEIRKLRQDILL 312
Cdd:pfam13901   2 CDYTGKYYCSGCHWNDTSVIPARILHNWDFKKYPVSRFAKQLLDSIYDKPLLNLSDLNPKLYSKVEELAKVRRLRKQLRL 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568956754  313 MKPYFITCKEAMEARLLLQLQDRQHFVENDEMYSIQDLLEVHMGRLSCSLTEIHTLFAKHIKlDCERCQAKGFVCELCKE 392
Cdd:pfam13901  82 MKDYLLTCRFAAEERLLKLLGPREHLLEDPHLYSLADLVDIKSGSLLKQLEKLVQFAEKHVT-NCELCQGKGFICELCNS 160
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 568956754  393 GDVLFPFDSH-TSVCNDCSAVFHRDCYYDNsttCPKCAR 430
Cdd:pfam13901 161 DDIIFPFQIDtTSRCPKCGAVFHKSCFRKS---CPKCLR 196
C1 cd00029
Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of ...
136-186 1.88e-05

Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).


Pssm-ID: 237996  Cd Length: 50  Bit Score: 41.71  E-value: 1.88e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 568956754 136 HRFyKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCCYRCHSKCLNLISKPC 186
Cdd:cd00029    1 HRF-VRKSFFKPTFCDVCRKSIWGLFKQGLRCSWCKVKCHKKCADKVPPSC 50
C1_1 pfam00130
Phorbol esters/diacylglycerol binding domain (C1 domain); This domain is also known as the ...
136-186 1.09e-04

Phorbol esters/diacylglycerol binding domain (C1 domain); This domain is also known as the Protein kinase C conserved region 1 (C1) domain.


Pssm-ID: 333864  Cd Length: 51  Bit Score: 39.34  E-value: 1.09e-04
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|.
gi 568956754  136 HRFyKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCCYRCHSKCLNLISKPC 186
Cdd:pfam00130   1 HHF-VHRTFKQPTFCDHCGEFLWGLGKQGLKCSWCKLNVHKRCHEKVPPEC 50
C1 smart00109
Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains); Some bind phorbol ...
139-186 1.44e-04

Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains); Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.


Pssm-ID: 197519  Cd Length: 50  Bit Score: 38.99  E-value: 1.44e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*...
gi 568956754   139 YKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCCYRCHSKCLNLISKPC 186
Cdd:smart00109   3 HVFRTFTKPTFCCVCRKSIWGSFKQGLRCSECKVKCHKKCADKVPKAC 50
 
Name Accession Description Interval E-value
zf-RING_9 pfam13901
Putative zinc-RING and/or ribbon; This is a family of cysteine-rich proteins. Many members ...
233-430 1.89e-89

Putative zinc-RING and/or ribbon; This is a family of cysteine-rich proteins. Many members also carry a pleckstrin-homology domain, pfam00169


Pssm-ID: 338995  Cd Length: 196  Bit Score: 269.80  E-value: 1.89e-89
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568956754  233 CDYTGQYYCSHCHWNDLAVIPARVVHNWDFEPRKVSRCSMRYLALMVSRPVLRLREINPLLFNYVEELVEIRKLRQDILL 312
Cdd:pfam13901   2 CDYTGKYYCSGCHWNDTSVIPARILHNWDFKKYPVSRFAKQLLDSIYDKPLLNLSDLNPKLYSKVEELAKVRRLRKQLRL 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568956754  313 MKPYFITCKEAMEARLLLQLQDRQHFVENDEMYSIQDLLEVHMGRLSCSLTEIHTLFAKHIKlDCERCQAKGFVCELCKE 392
Cdd:pfam13901  82 MKDYLLTCRFAAEERLLKLLGPREHLLEDPHLYSLADLVDIKSGSLLKQLEKLVQFAEKHVT-NCELCQGKGFICELCNS 160
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 568956754  393 GDVLFPFDSH-TSVCNDCSAVFHRDCYYDNsttCPKCAR 430
Cdd:pfam13901 161 DDIIFPFQIDtTSRCPKCGAVFHKSCFRKS---CPKCLR 196
C1 cd00029
Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of ...
136-186 1.88e-05

Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).


Pssm-ID: 237996  Cd Length: 50  Bit Score: 41.71  E-value: 1.88e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 568956754 136 HRFyKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCCYRCHSKCLNLISKPC 186
Cdd:cd00029    1 HRF-VRKSFFKPTFCDVCRKSIWGLFKQGLRCSWCKVKCHKKCADKVPPSC 50
C1_1 pfam00130
Phorbol esters/diacylglycerol binding domain (C1 domain); This domain is also known as the ...
136-186 1.09e-04

Phorbol esters/diacylglycerol binding domain (C1 domain); This domain is also known as the Protein kinase C conserved region 1 (C1) domain.


Pssm-ID: 333864  Cd Length: 51  Bit Score: 39.34  E-value: 1.09e-04
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|.
gi 568956754  136 HRFyKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCCYRCHSKCLNLISKPC 186
Cdd:pfam00130   1 HHF-VHRTFKQPTFCDHCGEFLWGLGKQGLKCSWCKLNVHKRCHEKVPPEC 50
C1 smart00109
Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains); Some bind phorbol ...
139-186 1.44e-04

Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains); Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.


Pssm-ID: 197519  Cd Length: 50  Bit Score: 38.99  E-value: 1.44e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*...
gi 568956754   139 YKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCCYRCHSKCLNLISKPC 186
Cdd:smart00109   3 HVFRTFTKPTFCCVCRKSIWGSFKQGLRCSECKVKCHKKCADKVPKAC 50
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH