NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|568961221|ref|XP_006511105.1|]
View 

PREDICTED: tropomyosin alpha-1 chain isoform X5 [Mus musculus]

Protein Classification

Tropomyosin domain-containing protein (domain architecture ID 11991670)

Tropomyosin domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Tropomyosin pfam00261
Tropomyosin;
48-282 1.64e-69

Tropomyosin;


:

Pssm-ID: 306717  Cd Length: 235  Bit Score: 218.33  E-value: 1.64e-69
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   48 KLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGM 127
Cdd:pfam00261   1 KKMQQIEEELDEAEERLEAAQKKLEEAEKRAEKAEAEVAALNRRIQLLEEELERTEERLATALEKLEEAEKAADESERGR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  128 KVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSL 207
Cdd:pfam00261  81 KVLENRALKDEERMEQLEAQLKEAKEIAEEADRKYEEVARKLVVVEGDLERAEERAELAESKIVELEEELKVVGNNLKSL 160
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 568961221  208 EAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMT 282
Cdd:pfam00261 161 EASEEKASQREDEYEEEIRFLTEKLKEAETRAEFAERSVQKLEKEVDRLEDELYAEKEKYKAISEELDQTLAELT 235
 
Name Accession Description Interval E-value
Tropomyosin pfam00261
Tropomyosin;
48-282 1.64e-69

Tropomyosin;


Pssm-ID: 306717  Cd Length: 235  Bit Score: 218.33  E-value: 1.64e-69
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   48 KLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGM 127
Cdd:pfam00261   1 KKMQQIEEELDEAEERLEAAQKKLEEAEKRAEKAEAEVAALNRRIQLLEEELERTEERLATALEKLEEAEKAADESERGR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  128 KVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSL 207
Cdd:pfam00261  81 KVLENRALKDEERMEQLEAQLKEAKEIAEEADRKYEEVARKLVVVEGDLERAEERAELAESKIVELEEELKVVGNNLKSL 160
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 568961221  208 EAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMT 282
Cdd:pfam00261 161 EASEEKASQREDEYEEEIRFLTEKLKEAETRAEFAERSVQKLEKEVDRLEDELYAEKEKYKAISEELDQTLAELT 235
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
37-284 2.77e-12

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 66.62  E-value: 2.77e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    37 KQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEA 116
Cdd:TIGR02168  687 EELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIEEL 766
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   117 EKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEE 196
Cdd:TIGR02168  767 EERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAATERRLEDLEEQ 846
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   197 LKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDH 276
Cdd:TIGR02168  847 IEELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKRSELRRELEELREKLAQ 926

                   ....*...
gi 568961221   277 ALNDMTSI 284
Cdd:TIGR02168  927 LELRLEGL 934
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
12-284 4.98e-12

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 65.89  E-value: 4.98e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   12 KLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRR 91
Cdd:COG1196   666 KRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEE 745
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   92 IQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVI 171
Cdd:COG1196   746 LEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRER 825
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  172 IESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEK 251
Cdd:COG1196   826 LEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELKE 905
                         250       260       270
                  ....*....|....*....|....*....|...
gi 568961221  252 SIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284
Cdd:COG1196   906 EIEKLRERLEELEAKLERLEVELPELEEELEEE 938
PTZ00121 PTZ00121
MAEBL; Provisional
5-258 2.25e-06

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 48.98  E-value: 2.25e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    5 KKKMQMLKLDKENALDRAEQ---AEADKKAAEDRSKQLEEDIAAKEKLLRASE----DERDRVLEELHKAEDSLLAADET 77
Cdd:PTZ00121 1390 KKKADEAKKKAEEDKKKADElkkAAAAKKKADEAKKKAEEKKKADEAKKKAEEakkaDEAKKKAEEAKKAEEAKKKAEEA 1469
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   78 AAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIES-RAQKDEEKMEIQEIQLKEAKHIAE 156
Cdd:PTZ00121 1470 KKADEAKKKAEEAKKADEAKKKAEEAKKKADEAKKAAEAKKKADEAKKAEEAKKAdEAKKAEEAKKADEAKKAEEKKKAD 1549
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  157 DADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAE 236
Cdd:PTZ00121 1550 ELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELKKAE 1629
                         250       260
                  ....*....|....*....|..
gi 568961221  237 TRAEFAERSVTKLEKSIDDLED 258
Cdd:PTZ00121 1630 EEKKKVEQLKKKEAEEKKKAEE 1651
 
Name Accession Description Interval E-value
Tropomyosin pfam00261
Tropomyosin;
48-282 1.64e-69

Tropomyosin;


Pssm-ID: 306717  Cd Length: 235  Bit Score: 218.33  E-value: 1.64e-69
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   48 KLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGM 127
Cdd:pfam00261   1 KKMQQIEEELDEAEERLEAAQKKLEEAEKRAEKAEAEVAALNRRIQLLEEELERTEERLATALEKLEEAEKAADESERGR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  128 KVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSL 207
Cdd:pfam00261  81 KVLENRALKDEERMEQLEAQLKEAKEIAEEADRKYEEVARKLVVVEGDLERAEERAELAESKIVELEEELKVVGNNLKSL 160
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 568961221  208 EAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMT 282
Cdd:pfam00261 161 EASEEKASQREDEYEEEIRFLTEKLKEAETRAEFAERSVQKLEKEVDRLEDELYAEKEKYKAISEELDQTLAELT 235
Tropomyosin_1 pfam12718
Tropomyosin like; This family is a set of eukaryotic tropomyosins. Within the yeast Tmp1 and ...
7-152 1.04e-18

Tropomyosin like; This family is a set of eukaryotic tropomyosins. Within the yeast Tmp1 and Tmp2, biochemical and sequence analyses indicate that Tpm2p spans four actin monomers along a filament, whereas Tpmlp spans five. Despite its shorter length, Tpm2p can compete with Tpm1p for binding to F-actin. Over-expression of Tpm2p in vivo alters the axial budding of haploids to a bipolar pattern, and this can be partially suppressed by co-over-expression of Tpm1p. This suggests distinct functions for the two tropomyosins, and indicates that the ratio between them is important for correct morphogenesis. The family also contains higher eukaryote Tmp3 members.


Pssm-ID: 315401  Cd Length: 142  Bit Score: 80.80  E-value: 1.04e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    7 KMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEAdva 86
Cdd:pfam12718   1 KMNSLKLEAENAQERAEEAEEKVKQLEQENLEKEQEIKSLTHKNQQLEEEVEKLEEQLKEAKEKAEESEKLKTNNEA--- 77
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 568961221   87 sLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAK 152
Cdd:pfam12718  78 -LNRRIQLLEEELEESDKRLKETTEKLRETDVKAEHSERKVQALEQERDQWEEKYEELEEKYKEAK 142
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
37-284 2.77e-12

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 66.62  E-value: 2.77e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    37 KQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEA 116
Cdd:TIGR02168  687 EELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIEEL 766
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   117 EKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEE 196
Cdd:TIGR02168  767 EERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAATERRLEDLEEQ 846
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   197 LKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDH 276
Cdd:TIGR02168  847 IEELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKRSELRRELEELREKLAQ 926

                   ....*...
gi 568961221   277 ALNDMTSI 284
Cdd:TIGR02168  927 LELRLEGL 934
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
12-284 4.98e-12

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 65.89  E-value: 4.98e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   12 KLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRR 91
Cdd:COG1196   666 KRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEE 745
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   92 IQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVI 171
Cdd:COG1196   746 LEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRER 825
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  172 IESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEK 251
Cdd:COG1196   826 LEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELKE 905
                         250       260       270
                  ....*....|....*....|....*....|...
gi 568961221  252 SIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284
Cdd:COG1196   906 EIEKLRERLEELEAKLERLEVELPELEEELEEE 938
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
23-276 7.73e-12

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 65.46  E-value: 7.73e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    23 EQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRIQLVEEELDRA 102
Cdd:TIGR02168  680 EELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTEL 759
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   103 QERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEER 182
Cdd:TIGR02168  760 EAEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAATERR 839
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   183 AELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQK-------EDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDD 255
Cdd:TIGR02168  840 LEDLEEQIEELSEDIESLAAEIEELEELIEELESEleallneRASLEEALALLRSELEELSEELRELESKRSELRRELEE 919
                          250       260
                   ....*....|....*....|.
gi 568961221   256 LEDELYAQKLKYKAISEELDH 276
Cdd:TIGR02168  920 LREKLAQLELRLEGLEVRIDN 940
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
11-260 2.72e-11

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 63.54  E-value: 2.72e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    11 LKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNR 90
Cdd:TIGR02168  230 LVLRLEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKELYALANEISRLEQQKQILRE 309
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    91 RIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLV 170
Cdd:TIGR02168  310 RLANLERQLEELEAQLEELESKLDELAEELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVA 389
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   171 IIE-------SDLERAEERAELSEGKCAELEEELKTVTNNLKslEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAE 243
Cdd:TIGR02168  390 QLElqiaslnNEIERLEARLERLEDRRERLQQEIEELLKKLE--EAELKELQAELEELEEELEELQEELERLEEALEELR 467
                          250
                   ....*....|....*..
gi 568961221   244 RSVTKLEKSIDDLEDEL 260
Cdd:TIGR02168  468 EELEEAEQALDAAEREL 484
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
2-270 9.49e-11

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 62.00  E-value: 9.49e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221     2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKA 81
Cdd:TIGR02168  708 EELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEIEEL 787
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    82 EADVASLNRRIQLVEEELDRAQERL-------ATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHI 154
Cdd:TIGR02168  788 EAQIEQLKEELKALREALDELRAELtllneeaANLRERLESLERRIAATERRLEDLEEQIEELSEDIESLAAEIEELEEL 867
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   155 AEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKE 234
Cdd:TIGR02168  868 IEELESELEALLNERASLEEALALLRSELEELSEELRELESKRSELRRELEELREKLAQLELRLEGLEVRIDNLQERLSE 947
                          250       260       270
                   ....*....|....*....|....*....|....*..
gi 568961221   235 -AETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAI 270
Cdd:TIGR02168  948 eYSLTLEEAEALENKIEDDEEEARRRLKRLENKIKEL 984
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
3-266 1.17e-10

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 61.65  E-value: 1.17e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    3 AIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAE 82
Cdd:COG1196   692 SLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLE 771
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   83 ADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEiqeiqlkEAKHIAEDADRKY 162
Cdd:COG1196   772 EALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIE-------ELEEEIEELEEKL 844
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  163 EEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFA 242
Cdd:COG1196   845 DELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLERL 924
                         250       260
                  ....*....|....*....|....
gi 568961221  243 ERSVTKLEKSIDDLEDELYAQKLK 266
Cdd:COG1196   925 EVELPELEEELEEEYEDTLETELE 948
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
1-281 2.61e-10

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 60.88  E-value: 2.61e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAK 80
Cdd:COG1196   213 ERYQELKAELRELELALLLAKLKELRKELEELEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLE 292
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   81 AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAadesergmkvIESRAQKDEEKMEIQEIQLKEAKHIAEDADR 160
Cdd:COG1196   293 LKEEIEELEGEISLLRERLEELENELEELEERLEELKEK----------IEALKEELEERETLLEELEQLLAELEEAKEE 362
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  161 KYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE 240
Cdd:COG1196   363 LEEKLSALLEELEELFEALREELAELEAELAEIRNELEELKREIESLEERLERLSERLEDLKEELKELEAELEELQTELE 442
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|.
gi 568961221  241 FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDM 281
Cdd:COG1196   443 ELNEELEELEEQLEELRDRLKELERELAELQEELQRLEKEL 483
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
24-266 1.25e-09

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 58.53  E-value: 1.25e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    24 QAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRIQLVEEELDRAQ 103
Cdd:TIGR02168  208 QAEKAERYKELKAELRELELALLVLRLEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQ 287
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   104 ERLATALQKLEEaekaadesergmkvIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERA 183
Cdd:TIGR02168  288 KELYALANEISR--------------LEQQKQILRERLANLERQLEELEAQLEELESKLDELAEELAELEEKLEELKEEL 353
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   184 ELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQ 263
Cdd:TIGR02168  354 ESLEAELEELEAELEELESRLEELEEQLETLRSKVAQLELQIASLNNEIERLEARLERLEDRRERLQQEIEELLKKLEEA 433

                   ...
gi 568961221   264 KLK 266
Cdd:TIGR02168  434 ELK 436
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
1-266 1.46e-09

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 58.57  E-value: 1.46e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEdsllaadETAAK 80
Cdd:COG1196   697 LRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELE-------EELES 769
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   81 AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADR 160
Cdd:COG1196   770 LEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEE 849
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  161 KYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE 240
Cdd:COG1196   850 ELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLERLEVELP 929
                         250       260
                  ....*....|....*....|....*.
gi 568961221  241 FAERSVTKLEKSIDDLEDELYAQKLK 266
Cdd:COG1196   930 ELEEELEEEYEDTLETELEREIERLE 955
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
18-260 7.00e-09

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 56.60  E-value: 7.00e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    18 ALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRIQLVEE 97
Cdd:TIGR02168  703 LRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIEELEERLEEAEEELAEAEA 782
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    98 ELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLE 177
Cdd:TIGR02168  783 EIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAATERRLEDLEEQIEELSEDIESLAAEIE 862
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   178 RAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLE 257
Cdd:TIGR02168  863 ELEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKRSELRRELEELREKLAQLELRLEGLEVRIDNLQ 942

                   ...
gi 568961221   258 DEL 260
Cdd:TIGR02168  943 ERL 945
NtpI COG1269
Archaeal/vacuolar-type H+-ATPase subunit I/STV1 [Energy production and conversion];
38-278 2.79e-08

Archaeal/vacuolar-type H+-ATPase subunit I/STV1 [Energy production and conversion];


Pssm-ID: 224188  Cd Length: 660  Bit Score: 54.29  E-value: 2.79e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  38 QLEEDIAAKEKLLRASEDERDRV-LEELHKAEDSLLAADETAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEA 116
Cdd:COG1269   25 LHDFGLVHLEDLEEGEKGLKELEkLKVAEVAQISLSSLLSEVLDYLRSVKGLEGRLFILPEEVEKLEAELKSLEEVIKPA 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221 117 EKAADES-ERGMKVIESRAQKDEEKMEI--QEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEgkcAEL 193
Cdd:COG1269  105 EKFSSEVeELTRKLEERLSELDEELEDLedLLEELEPLAYLDFDLSLLRGLKFLLVRLGLVRREKLEALVGVIE---DEV 181
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221 194 EEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAEtraEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEE 273
Cdd:COG1269  182 ALYGENVEASVVIVVAHGAEDLDKVSKILNELGFELYEVPEFD---GGPSELISELEEVIAEIQDELESLRSELEALAEK 258

                 ....*
gi 568961221 274 LDHAL 278
Cdd:COG1269  259 IAEEL 263
COG4372 COG4372
Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];
36-258 7.77e-08

Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];


Pssm-ID: 226809  Cd Length: 499  Bit Score: 53.10  E-value: 7.77e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  36 SKQLEEDIAAKEKLLRASEDERdrvlEELHKAEDSLLAADETAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEE 115
Cdd:COG4372   66 NRNLRSGVFQLDDIRPQLRALR----TELGTAQGEKRAAETEREAARSELQKARQEREAVRQELAAARQNLAKAQQELAR 141
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221 116 -AEKAADESERGMKVIESRAQKDEEKMEI--QEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAE 192
Cdd:COG4372  142 lTKQAQDLQTRLKTLAEQRRQLEAQAQSLqaSQKQLQASATQLKSQVLDLKLRSAQIEQEAQNLATRANAAQARTEELAR 221
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 568961221 193 LEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLED 258
Cdd:COG4372  222 RAAAAQQTAQAIQQRDAQISQKAQQIAARAEQIRERERQLQRLETAQARLEQEVAQLEAYYQAYVR 287
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
39-246 1.35e-07

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 52.38  E-value: 1.35e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    39 LEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEK 118
Cdd:TIGR02169  299 LEAEIASLERSIAEKERELEDAEERLAKLEAEIDKLLAEIEELEREIEEERKRRDKLTEEYAELKEELEDLRAELEEVDK 378
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   119 AADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELK 198
Cdd:TIGR02169  379 EFAETRDELKDYREKLEKLKREINELKRELDRLQEELQRLSEELADLNAAIAGIEAKINELEEEKEDKALEIKKQEWKLE 458
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*...
gi 568961221   199 TVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSV 246
Cdd:TIGR02169  459 QLAADLSKYEQELYDLKEEYDRVEKELSKLQRELAEAEAQARASEERV 506
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
76-280 1.91e-07

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 51.98  E-value: 1.91e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    76 ETAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIA 155
Cdd:TIGR02168  684 EKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEI 763
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   156 EDADRKYE-------EVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVL 228
Cdd:TIGR02168  764 EELEERLEeaeeelaEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAATERRLEDL 843
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|..
gi 568961221   229 SDKLKEAETRAEFAERSVTKLEKSIDDLEDELyAQKLKYKAISEELDHALND 280
Cdd:TIGR02168  844 EEQIEELSEDIESLAAEIEELEELIEELESEL-EALLNERASLEEALALLRS 894
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
28-246 2.53e-07

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278  Cd Length: 420  Bit Score: 51.26  E-value: 2.53e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  28 DKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRIQLVEEELDRAQERLA 107
Cdd:COG4942   32 SAAADDKQLKQIQKEIAALEKKIREQQDQRAKLEKQLKSLETEIASLEAQLIETADDLKKLRKQIADLNARLNALEVQER 111
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221 108 TALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSE 187
Cdd:COG4942  112 EQRRRLAEQLAALQRSGRNPPPALLVSPEDAQRSVRLAIYYGALNPARAERIDALKATLKQLAAVRAEIAAEQAELTTLL 191
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 568961221 188 GKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSV 246
Cdd:COG4942  192 SEQRAQQAKLAQLLEERKKTLAQLNSELSADQKKLEELRANESRLKNEIASAEAAAAKA 250
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
2-284 3.88e-07

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 51.22  E-value: 3.88e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221     2 DAIKKKMQMLKLDKENALD-RAEQAEADKKAAEDRSKQLEEDIAAKEKLLRasedERDRVLEELHKAEDSLLAADETAAK 80
Cdd:TIGR02169  194 DEKRQQLERLRREREKAERyQALLKEKREYEGYELLKEKEALERQKEAIER----QLASLEEELEKLTEEISELEKRLEE 269
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    81 AEADVASLNRRIQ-LVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLkeakhiaEDAD 159
Cdd:TIGR02169  270 IEQLLEELNKKIKdLGEEEQLRVKEKIGELEAEIASLERSIAEKERELEDAEERLAKLEAEIDKLLAEI-------EELE 342
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   160 RKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRA 239
Cdd:TIGR02169  343 REIEEERKRRDKLTEEYAELKEELEDLRAELEEVDKEFAETRDELKDYREKLEKLKREINELKRELDRLQEELQRLSEEL 422
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....*
gi 568961221   240 EFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284
Cdd:TIGR02169  423 ADLNAAIAGIEAKINELEEEKEDKALEIKKQEWKLEQLAADLSKY 467
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
20-276 4.63e-07

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 50.84  E-value: 4.63e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    20 DRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRIQLVEEEL 99
Cdd:TIGR02169  681 ERLEGLKRELSSLQSELRRIENRLDELSQELSDASRKIGEIEKEIEQLEQEEEKLKERLEELEEDLSSLEQEIENVKSEL 760
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   100 DRAQERLATALQKLEEAEKAADESERgmKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERA 179
Cdd:TIGR02169  761 KELEARIEELEEDLHKLEEALNDLEA--RLSHSRIPEIQAELSKLEEEVSRIEARLREIEQKLNRLTLEKEYLEKEIQEL 838
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   180 EERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDE 259
Cdd:TIGR02169  839 QEQRIDLKEQIKSIEKEIENLNGKKEELEEELEELEAALRDLESRLGDLKKERDELEAQLRELERKIEELEAQIEKKRKR 918
                          250
                   ....*....|....*..
gi 568961221   260 LYAQKLKYKAISEELDH 276
Cdd:TIGR02169  919 LSELKAKLEALEEELSE 935
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
1-235 1.42e-06

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 49.33  E-value: 1.42e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAK 80
Cdd:COG1196   767 LESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDE 846
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   81 AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADR 160
Cdd:COG1196   847 LEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLERLEV 926
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  161 KYEEVARKLVIIESDL--ERAEERAELSEGKCAELE-------EELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDK 231
Cdd:COG1196   927 ELPELEEELEEEYEDTleTELEREIERLEEEIEALGpvnlraiEEYEEVEERYEELKSQREDLEEAKEKLLEVIEELDKE 1006

                  ....
gi 568961221  232 LKEA 235
Cdd:COG1196  1007 KRER 1010
PTZ00121 PTZ00121
MAEBL; Provisional
5-258 2.25e-06

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 48.98  E-value: 2.25e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    5 KKKMQMLKLDKENALDRAEQ---AEADKKAAEDRSKQLEEDIAAKEKLLRASE----DERDRVLEELHKAEDSLLAADET 77
Cdd:PTZ00121 1390 KKKADEAKKKAEEDKKKADElkkAAAAKKKADEAKKKAEEKKKADEAKKKAEEakkaDEAKKKAEEAKKAEEAKKKAEEA 1469
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   78 AAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIES-RAQKDEEKMEIQEIQLKEAKHIAE 156
Cdd:PTZ00121 1470 KKADEAKKKAEEAKKADEAKKKAEEAKKKADEAKKAAEAKKKADEAKKAEEAKKAdEAKKAEEAKKADEAKKAEEKKKAD 1549
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  157 DADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAE 236
Cdd:PTZ00121 1550 ELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELKKAE 1629
                         250       260
                  ....*....|....*....|..
gi 568961221  237 TRAEFAERSVTKLEKSIDDLED 258
Cdd:PTZ00121 1630 EEKKKVEQLKKKEAEEKKKAEE 1651
PTZ00121 PTZ00121
MAEBL; Provisional
14-226 2.41e-06

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 48.60  E-value: 2.41e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   14 DKENALDRAEQA-EADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVlEELHKAEDSLLAADETAAKAEADVASLNRRI 92
Cdd:PTZ00121 1575 DKNMALRKAEEAkKAEEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKA-EELKKAEEEKKKVEQLKKKEAEEKKKAEELK 1653
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   93 QLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVII 172
Cdd:PTZ00121 1654 KAEEENKIKAAEEAKKAEEDKKKAEEAKKAEEDEKKAAEALKKEAEEAKKAEELKKKEAEEKKKAEELKKAEEENKIKAE 1733
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....
gi 568961221  173 ESDLERAEERAELSEGKCAElEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIK 226
Cdd:PTZ00121 1734 EAKKEAEEDKKKAEEAKKDE-EEKKKIAHLKKEEEKKAEEIRKEKEAVIEEELD 1786
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
1-260 2.46e-06

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 48.56  E-value: 2.46e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAK 80
Cdd:COG1196   241 LEELEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRERLEELENELEE 320
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   81 AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIEsraQKDEEKMEIQEIQLKEAKHIAEDADR 160
Cdd:COG1196   321 LEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALL---EELEELFEALREELAELEAELAEIRN 397
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  161 KYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE 240
Cdd:COG1196   398 ELEELKREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAELQEELQ 477
                         250       260
                  ....*....|....*....|
gi 568961221  241 FAERSVTKLEKSIDDLEDEL 260
Cdd:COG1196   478 RLEKELSSLEARLDRLEAEQ 497
PRK02224 PRK02224
chromosome segregation protein; Provisional
2-258 2.79e-06

chromosome segregation protein; Provisional


Pssm-ID: 179385  Cd Length: 880  Bit Score: 48.50  E-value: 2.79e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKA 81
Cdd:PRK02224 324 EELRDRLEECRVAAQAHNEEAESLREDADDLEERAEELREEAAELESELEEAREAVEDRREEIEELEEEIEELRERFGDA 403
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  82 EADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESER----------GMKVIES----RAQKDEEKMEIQEIQ 147
Cdd:PRK02224 404 PVDLGNAEDFLEELREERDELREREAELEATLRTARERVEEAEAlleagkcpecGQPVEGSphveTIEEDRERVEELEAE 483
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221 148 LKEAKHIAEDADRKYEEvARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKV 227
Cdd:PRK02224 484 LEDLEEEVEEVEERLER-AEDLVEAEDRIERLEERREDLEELIAERRETIEEKRERAEELRERAAELEAEAEEKREAAAE 562
                        250       260       270
                 ....*....|....*....|....*....|.
gi 568961221 228 LSDKLKEAETRAEFAERSVTKLEKSIDDLED 258
Cdd:PRK02224 563 AEEEAEEAREEVAELNSKLAELKERIESLER 593
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
18-259 3.28e-06

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 48.14  E-value: 3.28e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    18 ALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLnrRIQLVEE 97
Cdd:TIGR02169  707 LSQELSDASRKIGEIEKEIEQLEQEEEKLKERLEELEEDLSSLEQEIENVKSELKELEARIEELEEDLHKL--EEALNDL 784
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    98 ELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLE 177
Cdd:TIGR02169  785 EARLSHSRIPEIQAELSKLEEEVSRIEARLREIEQKLNRLTLEKEYLEKEIQELQEQRIDLKEQIKSIEKEIENLNGKKE 864
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   178 RAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLE 257
Cdd:TIGR02169  865 ELEEELEELEAALRDLESRLGDLKKERDELEAQLRELERKIEELEAQIEKKRKRLSELKAKLEALEEELSEIEDPKGEDE 944

                   ..
gi 568961221   258 DE 259
Cdd:TIGR02169  945 EI 946
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
15-259 3.43e-06

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 48.13  E-value: 3.43e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    15 KENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRIQL 94
Cdd:TIGR02168  763 IEELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAATERRLED 842
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    95 VEEELDRAQERLATALQKLEEAEKAADESERG-------MKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVAR 167
Cdd:TIGR02168  843 LEEQIEELSEDIESLAAEIEELEELIEELESEleallneRASLEEALALLRSELEELSEELRELESKRSELRRELEELRE 922
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   168 KLVIIESDLERAE-ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLS-------DKLKEAETRA 239
Cdd:TIGR02168  923 KLAQLELRLEGLEvRIDNLQERLSEEYSLTLEEAEALENKIEDDEEEARRRLKRLENKIKELGpvnlaaiEEYEELKERY 1002
                          250       260
                   ....*....|....*....|....*..
gi 568961221   240 EF-------AERSVTKLEKSIDDLEDE 259
Cdd:TIGR02168 1003 DFltaqkedLTEAKETLEEAIEEIDRE 1029
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
70-284 3.45e-06

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 48.17  E-value: 3.45e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   70 SLLAADETAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLK 149
Cdd:COG1196   661 SSLAQKRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLE 740
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  150 EAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLS 229
Cdd:COG1196   741 ELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLE 820
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 568961221  230 DKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284
Cdd:COG1196   821 QRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEEL 875
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
23-260 4.06e-06

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 47.76  E-value: 4.06e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    23 EQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLE------ELHKAEDSLLAADETAakAEADVASLNRRIQLVE 96
Cdd:TIGR02169  173 EKALEELEEVEENIERLDLIIDEKRQQLERLRREREKAERyqallkEKREYEGYELLKEKEA--LERQKEAIERQLASLE 250
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    97 EELDRAQERLATALQKLEEAEKAADE-SERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESD 175
Cdd:TIGR02169  251 EELEKLTEEISELEKRLEEIEQLLEElNKKIKDLGEEEQLRVKEKIGELEAEIASLERSIAEKERELEDAEERLAKLEAE 330
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   176 LERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDD 255
Cdd:TIGR02169  331 IDKLLAEIEELEREIEEERKRRDKLTEEYAELKEELEDLRAELEEVDKEFAETRDELKDYREKLEKLKREINELKRELDR 410

                   ....*
gi 568961221   256 LEDEL 260
Cdd:TIGR02169  411 LQEEL 415
PRK05771 PRK05771
V-type ATP synthase subunit I; Validated
28-261 4.16e-06

V-type ATP synthase subunit I; Validated


Pssm-ID: 235600  Cd Length: 646  Bit Score: 47.61  E-value: 4.16e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  28 DKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRIQLVEEELDRAQERLA 107
Cdd:PRK05771  38 EELSNERLRKLRSLLTKLSEALDKLRSYLPKLNPLREEKKKVSVKSLEELIKDVEEELEKIEKEIKELEEEISELENEIK 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221 108 TALQKLEEAEKAAD--------ESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVA---RKLVIIESDL 176
Cdd:PRK05771 118 ELEQEIERLEPWGNfdldlsllLGFKYVSVFVGTVPEDKLEELKLESDVENVEYISTDKGYVYVVVVvlkELSDEVEEEL 197
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221 177 ERAE-ERAELSEGKC-----AELEEELKTVTNNLKSLEAQAEKYSQkedKYEEEIKVLSDKL----KEAETRAEFA---- 242
Cdd:PRK05771 198 KKLGfERLELEEEGTpseliREIKEELEEIEKERESLLEELKELAK---KYLEELLALYEYLeielERAEALSKFLktdk 274
                        250       260
                 ....*....|....*....|....*...
gi 568961221 243 ---------ERSVTKLEKSIDDLEDELY 261
Cdd:PRK05771 275 tfaiegwvpEDRVKKLKELIDKATGGSA 302
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
93-284 6.27e-06

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 47.36  E-value: 6.27e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    93 QLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVII 172
Cdd:TIGR02168  221 ELRELELALLVLRLEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKELYALANEISRL 300
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   173 ESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKS 252
Cdd:TIGR02168  301 EQQKQILRERLANLERQLEELEAQLEELESKLDELAEELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQ 380
                          170       180       190
                   ....*....|....*....|....*....|..
gi 568961221   253 IDDLEDELYAQKLKYKAISEELDHALNDMTSI 284
Cdd:TIGR02168  381 LETLRSKVAQLELQIASLNNEIERLEARLERL 412
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
89-275 9.63e-06

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 46.63  E-value: 9.63e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   89 NRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARK 168
Cdd:COG1196   659 KRSSLAQKRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSR 738
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  169 LVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTK 248
Cdd:COG1196   739 LEELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELES 818
                         170       180
                  ....*....|....*....|....*..
gi 568961221  249 LEKSIDDLEDELYAQKLKYKAISEELD 275
Cdd:COG1196   819 LEQRRERLEQEIEELEEEIEELEEKLD 845
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
20-275 1.99e-05

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 45.86  E-value: 1.99e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   20 DRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKaeaDVASLNRRIQLVEEEL 99
Cdd:COG1196   172 ERKEEAERKLERTEENLERLEDLLEELEKQLEKLERQAEKAERYQELKAELRELELALLLA---KLKELRKELEELEEEL 248
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  100 DRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERA 179
Cdd:COG1196   249 SRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRERLEELENELEELEERLEEL 328
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  180 EERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEF----AERSVTKLEKSIDD 255
Cdd:COG1196   329 KEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEELFEALREELAELEAelaeIRNELEELKREIES 408
                         250       260
                  ....*....|....*....|
gi 568961221  256 LEDELYAQKLKYKAISEELD 275
Cdd:COG1196   409 LEERLERLSERLEDLKEELK 428
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
78-284 2.53e-05

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 45.43  E-value: 2.53e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    78 AAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA--------------ADESERGMKVIESRAQKDEEKMEI 143
Cdd:TIGR02168  665 SAKTNSSILERRREIEELEEKIEELEEKIAELEKALAELRKEleeleeeleqlrkeLEELSRQISALRKDLARLEAEVEQ 744
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   144 QEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEE 223
Cdd:TIGR02168  745 LEERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRE 824
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 568961221   224 EIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284
Cdd:TIGR02168  825 RLESLERRIAATERRLEDLEEQIEELSEDIESLAAEIEELEELIEELESELEALLNERASL 885
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
4-234 3.12e-05

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 45.09  E-value: 3.12e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    4 IKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLraseDERDRVLEELHKAEDSLLAADETAAKAea 83
Cdd:COG1196   293 LKEEIEELEGEISLLRERLEELENELEELEERLEELKEKIEALKEEL----EERETLLEELEQLLAELEEAKEELEEK-- 366
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   84 dvasLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYE 163
Cdd:COG1196   367 ----LSALLEELEELFEALREELAELEAELAEIRNELEELKREIESLEERLERLSERLEDLKEELKELEAELEELQTELE 442
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 568961221  164 EVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKE 234
Cdd:COG1196   443 ELNEELEELEEQLEELRDRLKELERELAELQEELQRLEKELSSLEARLDRLEAEQRASQGVRAVLEALESG 513
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
1-208 3.27e-05

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 45.05  E-value: 3.27e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221     1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAK 80
Cdd:TIGR02168  311 LANLERQLEELEAQLEELESKLDELAEELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQ 390
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    81 AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGmkviESRAQKDEEKMEIQEIQLKEAKHIA--EDA 158
Cdd:TIGR02168  391 LELQIASLNNEIERLEARLERLEDRRERLQQEIEELLKKLEEAELK----ELQAELEELEEELEELQEELERLEEalEEL 466
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|
gi 568961221   159 DRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLE 208
Cdd:TIGR02168  467 REELEEAEQALDAAERELAQLQARLDSLERLQENLEGFSEGVKALLKNQS 516
PTZ00121 PTZ00121
MAEBL; Provisional
2-258 4.44e-05

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 44.75  E-value: 4.44e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEE-DIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAaK 80
Cdd:PTZ00121 1549 DELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKaEEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELK-K 1627
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   81 AEADVASLNRRIQLVEEELDRAQE-RLATALQKLEEAEKAADESERGMKVIESR-AQKDEEKMEIQEIQLKEAKHIAEDA 158
Cdd:PTZ00121 1628 AEEEKKKVEQLKKKEAEEKKKAEElKKAEEENKIKAAEEAKKAEEDKKKAEEAKkAEEDEKKAAEALKKEAEEAKKAEEL 1707
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  159 DRKYEEVARKlviiESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQ---KEDKYEEEIKVLSDKLKEA 235
Cdd:PTZ00121 1708 KKKEAEEKKK----AEELKKAEEENKIKAEEAKKEAEEDKKKAEEAKKDEEEKKKIAHlkkEEEKKAEEIRKEKEAVIEE 1783
                         250       260
                  ....*....|....*....|...
gi 568961221  236 ETRAEfAERSVTKLEKSIDDLED 258
Cdd:PTZ00121 1784 ELDEE-DEKRRMEVDKKIKDIFD 1805
NtpI COG1269
Archaeal/vacuolar-type H+-ATPase subunit I/STV1 [Energy production and conversion];
13-284 5.43e-05

Archaeal/vacuolar-type H+-ATPase subunit I/STV1 [Energy production and conversion];


Pssm-ID: 224188  Cd Length: 660  Bit Score: 44.27  E-value: 5.43e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  13 LDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRI 92
Cdd:COG1269   43 LKELEKLKVAEVAQISLSSLLSEVLDYLRSVKGLEGRLFILPEEVEKLEAELKSLEEVIKPAEKFSSEVEELTRKLEERL 122
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  93 QLVEEELD--RAQERLATALQKLEEAEKAADESERG-MKVIESRAQKDEEKmeIQEIQLKEAKHIAEDADRKY------E 163
Cdd:COG1269  123 SELDEELEdlEDLLEELEPLAYLDFDLSLLRGLKFLlVRLGLVRREKLEAL--VGVIEDEVALYGENVEASVVivvahgA 200
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221 164 EVARKLVIIESdlERAEERAELSEGK------CAELEEELKTVTNNLKSLEAQAEKYSqkeDKYEEEIKVLSDKLKEAET 237
Cdd:COG1269  201 EDLDKVSKILN--ELGFELYEVPEFDggpselISELEEVIAEIQDELESLRSELEALA---EKIAEELLAVREILEIEKA 275
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 568961221 238 RAEFaersVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284
Cdd:COG1269  276 LGDV----LSKLARTEYTLAIEGWVPADEVEKLKKIINRATGGAAYF 318
PRK02224 PRK02224
chromosome segregation protein; Provisional
14-258 7.30e-05

chromosome segregation protein; Provisional


Pssm-ID: 179385  Cd Length: 880  Bit Score: 43.88  E-value: 7.30e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  14 DKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRIQ 93
Cdd:PRK02224 273 EREELAEEVRDLRERLEELEEERDDLLAEAGLDDADAEAVEARREELEDRDEELRDRLEECRVAAQAHNEEAESLREDAD 352
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  94 LVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIE 173
Cdd:PRK02224 353 DLEERAEELREEAAELESELEEAREAVEDRREEIEELEEEIEELRERFGDAPVDLGNAEDFLEELREERDELREREAELE 432
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221 174 SDLERAEERAE-----LSEGKCAELEEELK--TVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEfAERSV 246
Cdd:PRK02224 433 ATLRTARERVEeaealLEAGKCPECGQPVEgsPHVETIEEDRERVEELEAELEDLEEEVEEVEERLERAEDLVE-AEDRI 511
                        250
                 ....*....|..
gi 568961221 247 TKLEKSIDDLED 258
Cdd:PRK02224 512 ERLEERREDLEE 523
PTZ00121 PTZ00121
MAEBL; Provisional
2-269 8.44e-05

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 43.98  E-value: 8.44e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKA 81
Cdd:PTZ00121 1227 EAVKKAEEAKKDAEEAKKAEEERNNEEIRKFEEARMAHFARRQAAIKAEEARKADELKKAEEKKKADEAKKAEEKKKADE 1306
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   82 EADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRK 161
Cdd:PTZ00121 1307 AKKKAEEAKKADEAKKKAEEAKKKADAAKKKAEEAKKAAEAAKAEAEAAADEAEAAEEKAEAAEKKKEEAKKKADAAKKK 1386
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  162 YEEVaRKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEF 241
Cdd:PTZ00121 1387 AEEK-KKADEAKKKAEEDKKKADELKKAAAAKKKADEAKKKAEEKKKADEAKKKAEEAKKADEAKKKAEEAKKAEEAKKK 1465
                         250       260
                  ....*....|....*....|....*...
gi 568961221  242 AERSvTKLEKSIDDLEDELYAQKLKYKA 269
Cdd:PTZ00121 1466 AEEA-KKADEAKKKAEEAKKADEAKKKA 1492
PTZ00121 PTZ00121
MAEBL; Provisional
20-258 1.04e-04

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 43.59  E-value: 1.04e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   20 DRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASE---DERDRVLEELHKAE-----DSLLAADETAAKAEADVASLNRR 91
Cdd:PTZ00121 1480 EEAKKADEAKKKAEEAKKKADEAKKAAEAKKKADEakkAEEAKKADEAKKAEeakkaDEAKKAEEKKKADELKKAEELKK 1559
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   92 IQLVE--EELDRAQERLATALQKLEEAEKAadesERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKL 169
Cdd:PTZ00121 1560 AEEKKkaEEAKKAEEDKNMALRKAEEAKKA----EEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELKKAEEEKKKV 1635
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  170 VIIESDLERAEERAElsegKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKL 249
Cdd:PTZ00121 1636 EQLKKKEAEEKKKAE----ELKKAEEENKIKAAEEAKKAEEDKKKAEEAKKAEEDEKKAAEALKKEAEEAKKAEELKKKE 1711

                  ....*....
gi 568961221  250 EKSIDDLED 258
Cdd:PTZ00121 1712 AEEKKKAEE 1720
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
1-212 1.53e-04

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 43.12  E-value: 1.53e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221     1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAK 80
Cdd:TIGR02168  283 IEELQKELYALANEISRLEQQKQILRERLANLERQLEELEAQLEELESKLDELAEELAELEEKLEELKEELESLEAELEE 362
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    81 AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKhiAEDADR 160
Cdd:TIGR02168  363 LEAELEELESRLEELEEQLETLRSKVAQLELQIASLNNEIERLEARLERLEDRRERLQQEIEELLKKLEEAE--LKELQA 440
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|..
gi 568961221   161 KYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAE 212
Cdd:TIGR02168  441 ELEELEEELEELQEELERLEEALEELREELEEAEQALDAAERELAQLQARLD 492
PRK10929 PRK10929
putative mechanosensitive channel protein; Provisional
18-233 1.83e-04

putative mechanosensitive channel protein; Provisional


Pssm-ID: 236798  Cd Length: 1109  Bit Score: 42.73  E-value: 1.83e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   18 ALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLlraSEDERDRVLEELHKAEDslLAADETAAKAEADVASLNRriQLVEE 97
Cdd:PRK10929   49 ALQSALNWLEERKGSLERAKQYQQVIDNFPKL---SAELRQQLNNERDEPRS--VPPNMSTDALEQEILQVSS--QLLEK 121
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   98 ------ELDRAQE---RLATALQKLEEAEKAADESERGMKVIESRAQKDEEkmeiqeiqlkeakhiAEDADRKYEEVARK 168
Cdd:PRK10929  122 srqaqqEQDRAREisdSLSQLPQQQTEARRQLNEIERRLQTLGTPNTPLAQ---------------AQLTALQAESAALK 186
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568961221  169 LVIIESDL---------ERAEERAELSEGKCAELEEELKTVTNNLKSLEAQ-AEKYSQKEDKYEEEI----KVLSDKLK 233
Cdd:PRK10929  187 ALVDELELaqlsannrqELARLRSELAKKRSQQLDAYLQALRNQLNSQRQReAERALESTELLAEQSgdlpKSIVAQFK 265
PRK02224 PRK02224
chromosome segregation protein; Provisional
76-260 2.32e-04

chromosome segregation protein; Provisional


Pssm-ID: 179385  Cd Length: 880  Bit Score: 42.33  E-value: 2.32e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  76 ETAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVI-ESRAQKDEEKMEIQEI--QLKEAK 152
Cdd:PRK02224 206 ERLNGLESELAELDEEIERYEEQREQARETRDEADEVLEEHEERREELETLEAEIeDLRETIAETEREREELaeEVRDLR 285
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221 153 HIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKL 232
Cdd:PRK02224 286 ERLEELEEERDDLLAEAGLDDADAEAVEARREELEDRDEELRDRLEECRVAAQAHNEEAESLREDADDLEERAEELREEA 365
                        170       180
                 ....*....|....*....|....*...
gi 568961221 233 KEAETRAEFAERSVTKLEKSIDDLEDEL 260
Cdd:PRK02224 366 AELESELEEAREAVEDRREEIEELEEEI 393
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
51-284 2.49e-04

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 42.39  E-value: 2.49e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   51 RASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRIQLVEEELDR-----------AQERLATALQKLEEAEKA 119
Cdd:COG1196   659 KRSSLAQKRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRqleelerqleeLKRELAALEEELEQLQSR 738
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  120 ADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKT 199
Cdd:COG1196   739 LEELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELES 818
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  200 VTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALN 279
Cdd:COG1196   819 LEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELES 898

                  ....*
gi 568961221  280 DMTSI 284
Cdd:COG1196   899 ELAEL 903
PTZ00121 PTZ00121
MAEBL; Provisional
2-269 2.69e-04

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 42.44  E-value: 2.69e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAadETAAKA 81
Cdd:PTZ00121 1131 EEARKAEDARKAEEARKAEDAKRVEIARKAEDARKAEEARKAEDAKKAEAARKAEEVRKAEELRKAEDARKA--EAARKA 1208
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   82 EadvaslnrRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRK 161
Cdd:PTZ00121 1209 E--------EERKAEEARKAEDAKKAEAVKKAEEAKKDAEEAKKAEEERNNEEIRKFEEARMAHFARRQAAIKAEEARKA 1280
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  162 YEEVARKLVIIESDLERAEERAELSEG--------KCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLK 233
Cdd:PTZ00121 1281 DELKKAEEKKKADEAKKAEEKKKADEAkkkaeeakKADEAKKKAEEAKKKADAAKKKAEEAKKAAEAAKAEAEAAADEAE 1360
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|
gi 568961221  234 EAETRAEFAERSVTKLEKSIDDL----EDELYAQKLKYKA 269
Cdd:PTZ00121 1361 AAEEKAEAAEKKKEEAKKKADAAkkkaEEKKKADEAKKKA 1400
APG6 pfam04111
Autophagy protein Apg6; In yeast, 15 Apg proteins coordinate the formation of autophagosomes. ...
1-118 3.19e-04

Autophagy protein Apg6; In yeast, 15 Apg proteins coordinate the formation of autophagosomes. Autophagy is a bulk degradation process induced by starvation in eukaryotic cells. Apg6/Vps30p has two distinct functions in the autophagic process, either associated with the membrane or in a retrieval step of the carboxypeptidase Y sorting pathway.


Pssm-ID: 309295  Cd Length: 308  Bit Score: 41.40  E-value: 3.19e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    1 MDAIKKKMQMLKLDKEN------ALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAA 74
Cdd:pfam04111  11 LEELDKELEQLEKERDAyqeflkKLEKEKPSDEEIEALEKELEKLEKEEEELLQELEELEKEREELDAELEKLEEELEEL 90
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....
gi 568961221   75 DETAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEK 118
Cdd:pfam04111  91 DEEEEEYWREYNAFQLELLEFQDERDSLENQYEHAQDQLDRLRK 134
PTZ00121 PTZ00121
MAEBL; Provisional
20-269 3.86e-04

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 41.67  E-value: 3.86e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   20 DRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASE----DERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRIQLV 95
Cdd:PTZ00121 1421 DEAKKKAEEKKKADEAKKKAEEAKKADEAKKKAEEakkaEEAKKKAEEAKKADEAKKKAEEAKKADEAKKKAEEAKKKAD 1500
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   96 EEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDAdRKYEEVARKLVIIESD 175
Cdd:PTZ00121 1501 EAKKAAEAKKKADEAKKAEEAKKADEAKKAEEAKKADEAKKAEEKKKADELKKAEELKKAEEK-KKAEEAKKAEEDKNMA 1579
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  176 LERAEERAELSEGKCAEL----EEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEK 251
Cdd:PTZ00121 1580 LRKAEEAKKAEEARIEEVmklyEEEKKMKAEEAKKAEEAKIKAEELKKAEEEKKKVEQLKKKEAEEKKKAEELKKAEEEN 1659
                         250
                  ....*....|....*...
gi 568961221  252 SIDDLEDELYAQKLKYKA 269
Cdd:PTZ00121 1660 KIKAAEEAKKAEEDKKKA 1677
PRK02224 PRK02224
chromosome segregation protein; Provisional
2-275 5.65e-04

chromosome segregation protein; Provisional


Pssm-ID: 179385  Cd Length: 880  Bit Score: 41.18  E-value: 5.65e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKA 81
Cdd:PRK02224 310 EAVEARREELEDRDEELRDRLEECRVAAQAHNEEAESLREDADDLEERAEELREEAAELESELEEAREAVEDRREEIEEL 389
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  82 EADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEI-------QEIQLKEAKHI 154
Cdd:PRK02224 390 EEEIEELRERFGDAPVDLGNAEDFLEELREERDELREREAELEATLRTARERVEEAEALLEAgkcpecgQPVEGSPHVET 469
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221 155 AEDADRKYEEVARKLVIIESDLERAEERAELSEgKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKE 234
Cdd:PRK02224 470 IEEDRERVEELEAELEDLEEEVEEVEERLERAE-DLVEAEDRIERLEERREDLEELIAERRETIEEKRERAEELRERAAE 548
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
gi 568961221 235 AETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELD 275
Cdd:PRK02224 549 LEAEAEEKREAAAEAEEEAEEAREEVAELNSKLAELKERIE 589
PTZ00121 PTZ00121
MAEBL; Provisional
20-203 6.77e-04

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 40.89  E-value: 6.77e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   20 DRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADEtAAKAEADVASLNRRIQLVEEEL 99
Cdd:PTZ00121 1623 EELKKAEEEKKKVEQLKKKEAEEKKKAEELKKAEEENKIKAAEEAKKAEEDKKKAEE-AKKAEEDEKKAAEALKKEAEEA 1701
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  100 DRAQERLATALQKLEEAEKA-ADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLER 178
Cdd:PTZ00121 1702 KKAEELKKKEAEEKKKAEELkKAEEENKIKAEEAKKEAEEDKKKAEEAKKDEEEKKKIAHLKKEEEKKAEEIRKEKEAVI 1781
                         170       180
                  ....*....|....*....|....*
gi 568961221  179 AEERAELSEGKCAELEEELKTVTNN 203
Cdd:PTZ00121 1782 EEELDEEDEKRRMEVDKKIKDIFDN 1806
8a0101 TIGR00998
efflux pump membrane protein (multidrug resistance protein A); [Transport and binding proteins, ...
1-155 1.07e-03

efflux pump membrane protein (multidrug resistance protein A); [Transport and binding proteins, Other]


Pssm-ID: 273385  Cd Length: 334  Bit Score: 39.78  E-value: 1.07e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKllrasederdrvleELHKAEDSLLAADETAAK 80
Cdd:TIGR00998  61 TDYVKQGDVLVRLDPTNAELALAKAEANLAALVRQTKQLEITVQQLQA--------------KVESLKIKLEQAREKLLQ 126
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   81 AEADvasLNRRIQLVE------EELDRAQERLATALQKLE----EAEKAADESERGMKVIESRA-QKDEEKMEIQEIQLK 149
Cdd:TIGR00998 127 AELD---LRRRVPLFKkglisrEELDHARKALLSAKAALNaaiqEQLNANQALVRGTPLKKQPAvQEAKERLKTAWLALK 203

                  ....*.
gi 568961221  150 EAKHIA 155
Cdd:TIGR00998 204 RTVIRA 209
SMC_N pfam02463
RecF/RecN/SMC N terminal domain; This domain is found at the N terminus of SMC proteins. The ...
1-257 1.65e-03

RecF/RecN/SMC N terminal domain; This domain is found at the N terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination.


Pssm-ID: 308206  Cd Length: 1162  Bit Score: 39.57  E-value: 1.65e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221     1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAK 80
Cdd:pfam02463  261 IEKEEEKLAQVLKENKEEEKEKKLQEEELKLLAKEEEELKSELLKLERRKVDDEEKLKESEKEKKKAEKELKKEKEEIEE 340
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    81 AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGmkvIESRAQKDEEKMEIQEIQLKEAKHIAEDADR 160
Cdd:pfam02463  341 LEKELKELEIKREAEEEEEEELEKLQEKLEQLEEELLAKKKLESER---LSSAAKLKEEELELKSEEEKEAQLLLELARQ 417
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   161 KYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE 240
Cdd:pfam02463  418 LEDLLKEEKKEELEILEEEEESIELKQGKLTEEKEELEKQELKLLKDELELKKSEDLLKETQLVKLQEQLELLLSRQKLE 497
                          250
                   ....*....|....*..
gi 568961221   241 FAERSVTKLEKSIDDLE 257
Cdd:pfam02463  498 ERSQKESKARSGLKVLL 514
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
23-259 1.67e-03

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 39.67  E-value: 1.67e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    23 EQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRvlEELHKAEDSLLAADETAAKAEADVASLNRRIQLVEEELDRA 102
Cdd:TIGR02169  754 ENVKSELKELEARIEELEEDLHKLEEALNDLEARLSH--SRIPEIQAELSKLEEEVSRIEARLREIEQKLNRLTLEKEYL 831
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   103 QERLATALQKLEEAEkaADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAE---------DADRKYEEVARKLVIIE 173
Cdd:TIGR02169  832 EKEIQELQEQRIDLK--EQIKSIEKEIENLNGKKEELEEELEELEAALRDLESRlgdlkkerdELEAQLRELERKIEELE 909
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   174 SDLERAEERAELSEGKCAELEEELKTVTNNLKSL------EAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVT 247
Cdd:TIGR02169  910 AQIEKKRKRLSELKAKLEALEEELSEIEDPKGEDeeipeeELSLEDVQAELQRVEEEIRALEPVNMLAIQEYEEVLKRLD 989
                          250
                   ....*....|..
gi 568961221   248 KLEKSIDDLEDE 259
Cdd:TIGR02169  990 ELKEKRAKLEEE 1001
GumC COG3206
Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell wall/membrane ...
18-223 1.86e-03

Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 225747  Cd Length: 458  Bit Score: 39.35  E-value: 1.86e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  18 ALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDErdrvlEELHKAEDSLLAADETAAKAEADVASLNRRIQLVEE 97
Cdd:COG3206  179 QAYLADQLEAQLEAFRRASDSLDERLEELRARLQEAEAQ-----VEDFRAQHGLTDAARGQLLSEQQLSALNTQLQSARA 253
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  98 ELDRAQERLATALQKLEEAEKAADESER-GMKVIES-RAQKDEEKMEIQEIQLK-EAKHIAEDADRKYEEVARKLVIIES 174
Cdd:COG3206  254 RLAQAEARLASLLQLLPLGREAAALREVlESPTIQDlRQQYAQVRQQIADLSTElGAKHPQLVALEAQLAELRQQIAAEL 333
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*....
gi 568961221 175 DLERAEERAELsegkcAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEE 223
Cdd:COG3206  334 RQILASLPNEL-----ALLEQQEAALEKELAQLKGRLSKLPKLQVQLRE 377
PRK12472 PRK12472
hypothetical protein; Provisional
18-166 2.16e-03

hypothetical protein; Provisional


Pssm-ID: 237110  Cd Length: 508  Bit Score: 39.08  E-value: 2.16e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  18 ALDRAEQAEADKKAAEDRSKqleeDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADvaslnRRIQLVEE 97
Cdd:PRK12472 199 AEDAARAADEAKTAAAAAAR----EAAPLKASLRKLERAKARADAELKRADKALAAAKTDEAKARAE-----ERQQKAAQ 269
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568961221  98 ELDRAQERLATALQKLEEAEKAADESERGMKVIESRAqkdeekmeiqeiqlKEAKHIAEDADRKYEEVA 166
Cdd:PRK12472 270 QAAEAATQLDTAKADAEAKRAAAAATKEAAKAAAAKK--------------AETAKAATDAKLALEPVS 324
PTZ00121 PTZ00121
MAEBL; Provisional
5-273 3.17e-03

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 38.97  E-value: 3.17e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    5 KKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKllraSEDERDRVLEELHKAEDSLLAADETAAKAEAD 84
Cdd:PTZ00121 1328 KKKADAAKKKAEEAKKAAEAAKAEAEAAADEAEAAEEKAEAAEK----KKEEAKKKADAAKKKAEEKKKADEAKKKAEED 1403
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   85 VASlnrriqlvEEELDRAQErlatALQKLEEAEKAADESERGmkviESRAQKDEEKMEIQEIQLK-EAKHIAEDADRKYE 163
Cdd:PTZ00121 1404 KKK--------ADELKKAAA----AKKKADEAKKKAEEKKKA----DEAKKKAEEAKKADEAKKKaEEAKKAEEAKKKAE 1467
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  164 EVARKlviiESDLERAEERAELSEGKcaELEEELKTVTNNLKSlEAQAEKYSQKEDKYEEEIKvlSDKLKEAETRAEFAE 243
Cdd:PTZ00121 1468 EAKKA----DEAKKKAEEAKKADEAK--KKAEEAKKKADEAKK-AAEAKKKADEAKKAEEAKK--ADEAKKAEEAKKADE 1538
                         250       260       270
                  ....*....|....*....|....*....|
gi 568961221  244 RSVTKLEKSIDDLEDELYAQKLKYKAISEE 273
Cdd:PTZ00121 1539 AKKAEEKKKADELKKAEELKKAEEKKKAEE 1568
HOOK pfam05622
HOOK protein; This family consists of several HOOK1, 2 and 3 proteins from different ...
10-145 3.60e-03

HOOK protein; This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms. The different members of the human gene family are HOOK1, HOOK2 and HOOK3. Different domains have been identified in the three human HOOK proteins, and it was demonstrated that the highly conserved NH2-domain mediates attachment to microtubules, whereas the central coiled-coil motif mediates homodimerisation and the more divergent C-terminal domains are involved in binding to specific organelles (organelle-binding domains). It has been demonstrated that endogenous HOOK3 binds to Golgi membranes, whereas both HOOK1 and HOOK2 are localized to discrete but unidentified cellular structures. In mice the Hook1 gene is predominantly expressed in the testis. Hook1 function is necessary for the correct positioning of microtubular structures within the haploid germ cell. Disruption of Hook1 function in mice causes abnormal sperm head shape and fragile attachment of the flagellum to the sperm head.


Pssm-ID: 310310  Cd Length: 701  Bit Score: 38.50  E-value: 3.60e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   10 MLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEaDVASLN 89
Cdd:pfam05622 458 LIRLQHENKMLRLQQEGSEREKLTELQALLEDANRRLNELRTQNRLANQRILELQAQVEELQKALQEQGSKAE-DSSLLK 536
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 568961221   90 RRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQE 145
Cdd:pfam05622 537 KKLEEHLEKLHEAQSELQKKKEQLEELEPDLNSNKQKIDELQAALKKKDEDMKAME 592
hsdR PRK11448
type I restriction enzyme EcoKI subunit R; Provisional
144-239 5.01e-03

type I restriction enzyme EcoKI subunit R; Provisional


Pssm-ID: 236912  Cd Length: 1123  Bit Score: 38.01  E-value: 5.01e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  144 QEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEE 223
Cdd:PRK11448  140 PENLLHALQQEVLTLKQQLELQAREKAQSQALAEAQQQELVALEGLAAELEEKQQELEAQLEQLQEKAAETSQERKQKRK 219
                          90
                  ....*....|....*....
gi 568961221  224 EIKVLSDK---LKEAETRA 239
Cdd:PRK11448  220 EITDQAAKrleLSEEETRI 238
PRK10929 PRK10929
putative mechanosensitive channel protein; Provisional
70-264 5.08e-03

putative mechanosensitive channel protein; Provisional


Pssm-ID: 236798  Cd Length: 1109  Bit Score: 38.11  E-value: 5.08e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   70 SLLAADETAAKAEADVASLNRRIQLVEEELDRAQ----ERLATALQKLEEAEKAADESERGMKVI--------ESRAQKD 137
Cdd:PRK10929   10 AWLLSWGAYAATAPDEKQITQELEQAKAAKTPAQaeivEALQSALNWLEERKGSLERAKQYQQVIdnfpklsaELRQQLN 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  138 EEKMEIQEIqlkEAKHIAEDADRKYEEVARKLVIIESDLERAEERA-ELSE------GKCAELEEELKTVTNNLKSLE-- 208
Cdd:PRK10929   90 NERDEPRSV---PPNMSTDALEQEILQVSSQLLEKSRQAQQEQDRArEISDslsqlpQQQTEARRQLNEIERRLQTLGtp 166
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 568961221  209 -----------AQAEKYSQKEDKYEEEIKVLSDKLKE--AETRAEFAERSVTKLEKSIDDLEDELYAQK 264
Cdd:PRK10929  167 ntplaqaqltaLQAESAALKALVDELELAQLSANNRQelARLRSELAKKRSQQLDAYLQALRNQLNSQR 235
chaperone_ClpB TIGR03346
ATP-dependent chaperone ClpB; Members of this protein family are the bacterial ATP-dependent ...
75-206 5.10e-03

ATP-dependent chaperone ClpB; Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins. [Protein fate, Protein folding and stabilization]


Pssm-ID: 274529  Cd Length: 850  Bit Score: 38.01  E-value: 5.10e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   75 DETAAKAEADVAS-------LNRRI-QLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKME-IQE 145
Cdd:TIGR03346 390 DEAAARIRMEIDSkpeeldeLDRRIiQLEIEREALKKEKDEASKKRLEDLEKELADLEEEYAELEEQWKAEKASIQgIQQ 469
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 568961221  146 I--QLKEAKHIAEDADRKYeevarklviiesDLERAeerAELSEGKCAELEEELKTVTNNLKS 206
Cdd:TIGR03346 470 IkeEIEQVRLELEQAEREG------------DLAKA---AELQYGKLPELEKQLQAAEQKLGE 517
2A1904 TIGR00927
K+-dependent Na+/Ca+ exchanger; [Transport and binding proteins, Cations and iron carrying ...
20-240 6.17e-03

K+-dependent Na+/Ca+ exchanger; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273344  Cd Length: 1096  Bit Score: 38.05  E-value: 6.17e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    20 DRAEQAEADKKAAEDRSKQLEEDIAAKEKllraSEDERDRVLEELHKAEDSLLAADETAAKAEAdvaslnrriqlvEEEL 99
Cdd:TIGR00927  692 EQEGEGEIEAKEADHKGETEAEEVEHEGE----TEAEGTEDEGEIETGEEGEEVEDEGEGEAEG------------KHEV 755
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   100 DRAQERLATALQKLEEAEKAADESERgmkviESRAQKD-EEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLER 178
Cdd:TIGR00927  756 ETEGDRKETEHEGETEAEGKEDEDEG-----EIQAGEDgEMKGDEGAEGKVEHEGETEAGEKDEHEGQSETQADDTEVKD 830
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 568961221   179 AEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE 240
Cdd:TIGR00927  831 ETGEQELNAENQGEAKQDEKGVDGGGGSDGGDSEEEEEEEEEEEEEEEEEEEEEEEEEENEE 892
PTZ00121 PTZ00121
MAEBL; Provisional
2-252 6.39e-03

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 37.81  E-value: 6.39e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKA 81
Cdd:PTZ00121 1507 EAKKKADEAKKAEEAKKADEAKKAEEAKKADEAKKAEEKKKADELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEA 1586
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   82 -EADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIA----- 155
Cdd:PTZ00121 1587 kKAEEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELKKAEEEKKKVEQLKKKEAEEKKKAEELKKAEEENKIkaaee 1666
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  156 ---EDADRKYEEVARKLVIIESDLERAEERAELSEGKCAEL----EEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVL 228
Cdd:PTZ00121 1667 akkAEEDKKKAEEAKKAEEDEKKAAEALKKEAEEAKKAEELkkkeAEEKKKAEELKKAEEENKIKAEEAKKEAEEDKKKA 1746
                         250       260
                  ....*....|....*....|....
gi 568961221  229 SDKLKEAETRAEFAERSVTKLEKS 252
Cdd:PTZ00121 1747 EEAKKDEEEKKKIAHLKKEEEKKA 1770
TIGR02680 TIGR02680
TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene ...
18-197 7.28e-03

TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length. [Hypothetical proteins, Conserved]


Pssm-ID: 274256  Cd Length: 1353  Bit Score: 37.86  E-value: 7.28e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    18 ALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDslLAADETAAKAEADVASLNRRIQLVEE 97
Cdd:TIGR02680  791 AHRRAAEAERQAESAERELARAARKAAAAAAAWKQARRELERDAADLDLPTD--PDALEAVGLALKRFGDHLHTLEVAVR 868
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221    98 ELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKM---------EIQEIQLKEAkhiaeDADRKYEEVARK 168
Cdd:TIGR02680  869 ELRHAATRAAEQRARAARAESDAREAAEDAAEARAEAEEASLRLrtleesvgaMVDEIRARLA-----ETRAALASGGRE 943
                          170       180
                   ....*....|....*....|....*....
gi 568961221   169 LVIIESDLERAEERAELSEGKCAELEEEL 197
Cdd:TIGR02680  944 LPRLAEALATAEEARGRAEEKRAEADATL 972
RNase_Y TIGR03319
ribonuclease Y; Members of this family are RNase Y, an endoribonuclease. The member from ...
15-165 8.24e-03

ribonuclease Y; Members of this family are RNase Y, an endoribonuclease. The member from Bacillus subtilis, YmdA, has been shown to be involved in turnover of yitJ riboswitch. [Transcription, Degradation of RNA]


Pssm-ID: 188306  Cd Length: 514  Bit Score: 37.21  E-value: 8.24e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   15 KENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKAEADVASLNRRIQL 94
Cdd:TIGR03319  50 KEALLEAKEEVHKLRAELERELKERRNELQRLERRLLQREETLDRKMESLDKKEENLEKKEKELSNKEKNLDEKEEELEE 129
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 568961221   95 VEEELDRAQERLATALQklEEAEkaadesERGMKVIESRAQKDEEKMeIQEIQlKEAKhiaEDADRKYEEV 165
Cdd:TIGR03319 130 LIAEQREELERISGLTQ--EEAK------EILLEEVEEEARHEAAKL-IKEIE-EEAK---EEADKKAKEI 187
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
2-251 8.66e-03

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496  Cd Length: 908  Bit Score: 37.43  E-value: 8.66e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221   2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRASEDERDRVLEELHKAEDSLLAADETAAKA 81
Cdd:COG0419  203 DLLEALEEELKELKKLEEIQEEQEEEELEQEIEALEERLAELEEEKERLEELKARLLEIESLELEALKIREEELRELERL 282
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  82 EADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADEsergMKVIESRAQKDEEKMEIQEIQLKEakhIAEDADRK 161
Cdd:COG0419  283 LEELEEKIERLEELEREIEELEEELEGLRALLEELEELLEK----LKSLEERLEKLEEKLEKLESELEE---LAEEKNEL 355
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221 162 YEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEF 241
Cdd:COG0419  356 AKLLEERLKELEERLEELEKELEKALERLKQLEEAIQELKEELAELSAALEEIQEELEELEKELEELERELEELEEEIKK 435
                        250
                 ....*....|
gi 568961221 242 AERSVTKLEK 251
Cdd:COG0419  436 LEEQINQLES 445
EmrA COG1566
Multidrug resistance efflux pump [Defense mechanisms];
11-117 9.92e-03

Multidrug resistance efflux pump [Defense mechanisms];


Pssm-ID: 224482  Cd Length: 352  Bit Score: 36.92  E-value: 9.92e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568961221  11 LKLDKENALDRAEQAEADKKAAEDRSKQLE-EDIAAKEKLLRASEDERDRVLEELHKAED----------SLLAADETAA 79
Cdd:COG1566   82 FRIDPRDYRAALEQAEAALAAAEAQLRNLRaQLASAQALIAQAEAQDLDQAQNELERRAElaqrgvvsreELDRARAALQ 161
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|..
gi 568961221  80 KAEADVA----SLNRRIQLVEEELDRAQERLATALQKLEEAE 117
Cdd:COG1566  162 AAEAALAaaqaAQKQNLALLESEVSGAQAQVASAEAALDQAK 203
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH